RPSBLAST alignment for GI: 254780180 and conserved domain: COG0809

>gnl|CDD|31151 COG0809, QueA, S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) [Translation, ribosomal structure and biogenesis]. Length = 348
 Score =  422 bits (1087), Expect = e-119
 Identities = 175/360 (48%), Positives = 227/360 (63%), Gaps = 16/360 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA  P  PRDS+RL+V+         I      DL  +LN  D +V
Sbjct: 1   MRLSDFDFDLPEELIAQYPAEPRDSSRLLVLDRKTG---EIEHRTFYDLIDYLNPGDLLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L    F   +    ++   L  R+  N W    +PSK +K GD ++F   
Sbjct: 58  FNDTRVIPARL----FGRKHESGGKVEVLLERRLDDNRWLALIKPSKRLKAGDEIYF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179
                L+ATV+++   G  LL F   GI  L   +   G +PLPPYI  KR +D  D   
Sbjct: 111 --GDGLKATVLERLEHGLRLLEFDYEGIFSLLELLEKYGEMPLPPYI--KRKLDELDRDR 166

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GSVAAPTAGLHFT  LL +L + G+++ FVTLHVGAGTF PVKVE+ ++H 
Sbjct: 167 YQTVYAKEPGSVAAPTAGLHFTEELLEKLKAKGVEIAFVTLHVGAGTFRPVKVENIEEHK 226

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MHSE   +   TA A+N+ K+RGGRI++VGTTS+R LE+A  E G +  +SG+T+IFI P
Sbjct: 227 MHSEYYEVPQETADAINAAKARGGRIIAVGTTSVRTLESAAREAG-LKAFSGWTDIFIYP 285

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           GYRF+ VD L++NFHLPKSTLLMLVSAF G EE    Y+HAI   YRF+SYGD  L+ + 
Sbjct: 286 GYRFKVVDALITNFHLPKSTLLMLVSAFAGREELLAAYKHAIEQKYRFFSYGDAMLILRN 345