RPSBLAST alignment of GI: 254780180 and protein with PDBid: 1vky

>1vky_A S-adenosylmethionine:tRNA ribosyltransferase- isomerase; TM0574, structural genomics, JCSG, protein structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: e.53.1.1 Length = 347
 Score =  331 bits (851), Expect = 1e-91
 Identities = 140/356 (39%), Positives = 193/356 (54%), Gaps = 22/356 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V EFD++LPP  IA  PV PRD++RLMV+H        I   +  ++  +L   D +V
Sbjct: 13  MKVSEFDYELPPELIAQEPVEPRDASRLMVLHRKTQR---IEHRIFREIIEYLEPGDLLV 69

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N +KVI A+L   +    +     I   L  R+    W    RP + +KKG  L     
Sbjct: 70  LNVSKVIPARLYARKKTGAS-----IEILLIERLEEGIWKCLVRPGQKVKKGTELVIDED 124

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                  A  + +   G  +L F      L  +    G  PLPPYI  + P++      Y
Sbjct: 125 L-----SAVCLGRGEDGTRILKFQPQDDRLIFEK---GRTPLPPYIKNEVPLE-----RY 171

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GSVAAPTAGLHFT  L+ +L   G++   V LHVG GTF PVKVE+ + H M
Sbjct: 172 QTVYAKEEGSVAAPTAGLHFTPELIEKLKKKGVQFAEVVLHVGIGTFRPVKVEEVEKHKM 231

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   +   T + L   + RG RIV+VGTT++R LET          + G T++FI P 
Sbjct: 232 HEEFYQVPKETVRKLRETRERGNRIVAVGTTTVRTLETIAR-LPEQEEYVGKTDLFIYPP 290

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           + F+ VD L++NFHLP+STLLMLV+AF G +   + Y+ A+   YRF+S+GD  L+
Sbjct: 291 FEFKLVDALVTNFHLPRSTLLMLVAAFAGKDFVMEAYREAVKRRYRFFSFGDAMLI 346