HHsearch alignment for GI: 254780181 and conserved domain: PRK00168

>PRK00168 coaD phosphopantetheine adenylyltransferase; Provisional.
Probab=100.00  E-value=1.6e-39  Score=255.64  Aligned_cols=158  Identities=42%  Similarity=0.767  Sum_probs=147.8

Q ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHHCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCC
Q ss_conf             65999658998784899999999997489799964558887665789899999999976420133554412420333332
Q gi|254780181|r    2 MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIPDSSNRVSVISFEGLAV   81 (182)
Q Consensus         2 mkigifgGsFdPiH~GHL~ia~~a~~~~D~vii~~~~~p~k~~~~~s~e~r~~m~~~a~~~~~~~~~~~~~~~~~~~~~~   81 (182)
T Consensus         1 Mriai~pGSFDPit~GHldii~ra~~lfD~viv~v~~Np~K-~~~f~~eeR~~mi~~~~~~~~-----nv~V~~~~gL~v   74 (159)
T PRK00168          1 MKIAIYPGSFDPITNGHLDIIERASKLFDEVIVAVAINPSK-KPLFSLEERVELIREVTAHLP-----NVEVVGFDGLLV   74 (159)
T ss_pred             CCEEEECCCCCCCCHHHHHHHHHHHHHCCEEEEECCCCCCC-CCCCCHHHHHHHHHHHHCCCC-----CEEEEECCCHHH
T ss_conf             94899472679884479999999998679999940569887-777899999999999851589-----979994365032


Q ss_pred             CCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHCCCCHHHCCCHHHHHHHH
Q ss_conf             21001497079994376520124677998987647998689970685721132699999998599955839999999999
Q gi|254780181|r   82 NLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK  161 (182)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~l~~~~~~~~ISST~IR~~i~~g~~i~~lVP~~V~~yIk  161 (182)
T Consensus        75 d~ak~~~a~~iiRGlR~~~DfeyE~~~a~~N~~l~~~ieTvfl~~~~~~~~ISSs~VRei~~~ggdi~~~VP~~V~~~lk  154 (159)
T PRK00168         75 DFAREVGATVIVRGLRAVSDFEYEFQMAGMNRKLAPEIETVFLMPSEEYSFISSSLVREVARLGGDVSHFVPPAVARALK  154 (159)
T ss_pred             HHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCEECHHHHHHHHHCCCCHHHHCCHHHHHHHH
T ss_conf             35776698499960564047599988999997438998889963897677453899999998499944636999999999


Q ss_pred             HHHH
Q ss_conf             9999
Q gi|254780181|r  162 NIVI  165 (182)
Q Consensus       162 ~~~~  165 (182)
T Consensus       155 ~k~~  158 (159)
T PRK00168        155 AKFK  158 (159)
T ss_pred             HHHC
T ss_conf             9865