HHsearch alignment for GI: 254780181 and conserved domain: PRK01153

>PRK01153 nicotinamide-nucleotide adenylyltransferase; Provisional.
Probab=99.95  E-value=1e-26  Score=179.27  Aligned_cols=149  Identities=23%  Similarity=0.269  Sum_probs=98.5

Q ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHHCCEEEEECCCC--CCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCE----EEC
Q ss_conf             65999658998784899999999997489799964558--887665789899999999976420133554412----420
Q gi|254780181|r    2 MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCN--SVKTKGFLSIQERSELIKQSIFHFIPDSSNRVS----VIS   75 (182)
Q Consensus         2 mkigifgGsFdPiH~GHL~ia~~a~~~~D~vii~~~~~--p~k~~~~~s~e~r~~m~~~a~~~~~~~~~~~~~----~~~   75 (182)
T Consensus         1 Mr-~~~~GrFqP~H~GHl~~i~~al~~~d~vii~Igsa~~~~~~~NPft~~ER~~Mi~~~L~~~~i~~~~~~iv~i~di~   79 (170)
T PRK01153          1 MR-ALFIGRFQPFHKGHLEVIKWILEEVDELIIGIGSAQESHTLKNPFTAGERIMMIRKALEEAGIDLSRYYIIPIPDIE   79 (170)
T ss_pred             CE-EEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCC
T ss_conf             92-79971659986789999999997389259995566557778999889999999999999759875508999636544


Q ss_pred             CCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHH--CCCCCEEEEECCCCCCCCCHHHHHHHHHCCCCHHHCCC
Q ss_conf             3333322100149707999437652012467799898764--79986899706857211326999999985999558399
Q gi|254780181|r   76 FEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCL--CPEIATIALFAKESSRYVTSTLIRHLISIDADITSFVP  153 (182)
Q Consensus        76 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l--~~~~~~i~l~~~~~~~~ISST~IR~~i~~g~~i~~lVP  153 (182)
T Consensus        80 ~~~~wv~~v~~~~~~f~~~~s~n~-----------~~~~lf~~~g~~v~~-~p~~~r~~~Sst~IR~~~~~g~~w~~lVP  147 (170)
T PRK01153         80 FNAVWVSHVESLTPPFDVVYTGNP-----------LVAQLFREAGYEVRQ-PPMFNRDEYSGTEIRRRMIEGDPWEELVP  147 (170)
T ss_pred             CHHHHHHHHHHHCCCEEEEEECCH-----------HHHHHHHHCCCEEEE-CCCCCCCCEEHHHHHHHHHCCCCHHHHCC
T ss_conf             077899999985898369984878-----------999986644976982-68645673037999999986998568589


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999999
Q gi|254780181|r  154 DPVCVFLKNI  163 (182)
Q Consensus       154 ~~V~~yIk~~  163 (182)
T Consensus       148 ~~Va~~i~e~  157 (170)
T PRK01153        148 KSVAEVIKEI  157 (170)
T ss_pred             HHHHHHHHHC
T ss_conf             9999999994