HHsearch alignment for GI: 254780181 and conserved domain: PTZ00308

>PTZ00308 ethanolamine-phosphate cytidylytransferase; Provisional.
Probab=97.57  E-value=0.00059  Score=43.71  Aligned_cols=53  Identities=23%  Similarity=0.365  Sum_probs=32.3

Q ss_pred             ECCCCCCCCHHHHHHHHHHHHHCCEEEEECCCC----CCCCCCCCCHHHHHHHHHHH
Q ss_conf             658998784899999999997489799964558----88766578989999999997
Q gi|254780181|r    7 YTGSFDPITNGHMDIIIQALSFVEDLVIAIGCN----SVKTKGFLSIQERSELIKQS   59 (182)
Q Consensus         7 fgGsFdPiH~GHL~ia~~a~~~~D~vii~~~~~----p~k~~~~~s~e~r~~m~~~a   59 (182)
T Consensus        16 ~DG~fDl~H~GH~~~l~QAk~lg~~LiVGV~sDe~i~~~Kg~pVm~~~ER~~~v~~c   72 (353)
T PTZ00308         16 VDGCFDMLHFGHANALRQARALGDELFVGCHSDEEIMRNKGPPVMHQEERYEALRAC   72 (353)
T ss_pred             EECCCHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHCCCCCCCCHHHHHHHHHCC
T ss_conf             716442103888999999998599899996888999952899868889999999616