HHsearch alignment for GI: 254780181 and conserved domain: TIGR01527

>TIGR01527 arch_NMN_Atrans nicotinamide-nucleotide adenylyltransferase; InterPro: IPR006418 This family of archaeal proteins exhibits NAD salvage biosynthesis enzyme nicotinamide-nucleotide adenylyltransferase (2.7.7.1 from EC) activity. In some cases, the enzyme was tested and found also to have the activity of nicotinate-nucleotide adenylyltransferase (2.7.7.18 from EC), an enzyme of NAD de novo biosynthesis, although with a higher Km. In some archaeal species, a number of proteins which are uncharacterised with respect to activity, are also present.; GO: 0000309 nicotinamide-nucleotide adenylyltransferase activity, 0009435 NAD biosynthetic process, 0005737 cytoplasm.
Probab=99.92  E-value=2.5e-25  Score=171.04  Aligned_cols=149  Identities=21%  Similarity=0.308  Sum_probs=114.6

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHCCEEEEECCCC--CCCCCCCCCHHHHHHHHHHHHHHHCCCCCCC-------CEEEC
Q ss_conf             99658998784899999999997489799964558--8876657898999999999764201335544-------12420
Q gi|254780181|r    5 AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCN--SVKTKGFLSIQERSELIKQSIFHFIPDSSNR-------VSVIS   75 (182)
Q Consensus         5 gifgGsFdPiH~GHL~ia~~a~~~~D~vii~~~~~--p~k~~~~~s~e~r~~m~~~a~~~~~~~~~~~-------~~~~~   75 (182)
T Consensus         2 Gfy~GRFQPFH~GH~~Vik~~l~~VDELiiGiGSAq~SHt~~NPFTAGERv~MI~~sl~~~~rel~~d~~~Y~iP~~Di~   81 (171)
T TIGR01527         2 GFYIGRFQPFHLGHLEVIKKILEEVDELIIGIGSAQESHTLENPFTAGERVLMITKSLKEVKRELMDDLKVYIIPIEDIE   81 (171)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCEECCCHHHHH
T ss_conf             73467768755213799998873547779874048862022289761307899999999865544221322111424453


Q ss_pred             CCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHCCCC-HHHCCCH
Q ss_conf             333332210014970799943765201246779989876479986899706857211326999999985999-5583999
Q gi|254780181|r   76 FEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISIDAD-ITSFVPD  154 (182)
Q Consensus        76 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~l~~~~~~~~ISST~IR~~i~~g~~-i~~lVP~  154 (182)
T Consensus        82 ~N~iWv~yV~s~~PkFevvY~~NPLV~rLF~EaGy-------~V~~p~mfnR~~y---~gteIRR~m~~gednWe~lVP~  151 (171)
T TIGR01527        82 RNSIWVSYVESMTPKFEVVYSNNPLVVRLFKEAGY-------KVKRPPMFNREEY---EGTEIRRRMLEGEDNWEELVPK  151 (171)
T ss_pred             HHHHHHHEECCCCCCCEEEECCCCEEEEEECCCCE-------EECCCCCCCCCCC---CCHHHHHHHHCCCCCCHHCCCH
T ss_conf             40100000004889840687387847875401531-------5438887576654---5256666655288650131773


Q ss_pred             HHHHHHHHH
Q ss_conf             999999999
Q gi|254780181|r  155 PVCVFLKNI  163 (182)
Q Consensus       155 ~V~~yIk~~  163 (182)
T Consensus       152 aV~~~i~EI  160 (171)
T TIGR01527       152 AVADVIKEI  160 (171)
T ss_pred             HHHHHHHHC
T ss_conf             143532304