HHsearch alignment for GI: 254780181 and conserved domain: cd00560

>cd00560 PanC PanC Pantoate-beta-alanine ligase, also known as pantothenate synthase, catalyzes the formation of pantothenate from pantoate and alanine. PanC belongs to a large superfamily of nucleotidyltransferases that includes , ATP sulfurylase (ATPS), phosphopantetheine adenylyltransferase (PPAT), and the amino-acyl tRNA synthetases. The enzymes of this family are structurally similar and share a dinucleotide-binding domain.
Probab=94.06  E-value=0.12  Score=29.99  Aligned_cols=60  Identities=13%  Similarity=0.206  Sum_probs=42.8

Q ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHHCCEEEEECCCCCCCCCC-------CCCHHHHHHHHHHHHHH
Q ss_conf             65999658998784899999999997489799964558887665-------78989999999997642
Q gi|254780181|r    2 MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKG-------FLSIQERSELIKQSIFH   62 (182)
Q Consensus         2 mkigifgGsFdPiH~GHL~ia~~a~~~~D~vii~~~~~p~k~~~-------~~s~e~r~~m~~~a~~~   62 (182)
T Consensus        22 ~~ig~VP-TMGaLH~GHlsLi~~A~~~~d~vvvSIFVNP~QF~~~eD~~~YPr~~~~D~~~l~~~gvd   88 (276)
T cd00560          22 KSIGFVP-TMGALHEGHLSLIKRAKKENDKVVVSIFVNPTQFGPKEDLDNYPRTLEADLKLLEKAGVD   88 (276)
T ss_pred             CEEEEEC-CCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHCCCCHHHHHHHHHHCCCC
T ss_conf             9099973-862265899999999998599289998447102698502320899778999999976998