HHsearch alignment for GI: 254780181 and conserved domain: cd02167

>cd02167 NMNAT_NadR The NMNAT domain of NadR protein. The NadR protein (hiNadR) is a bifunctional enzyme possessing both NMN adenylytransferase (NMNAT) and ribosylnicotinamide kinase (RNK) activities. Its function is essential for the growth and survival of H. influenzae and thus may present a new highly specific anti-infectious drug target. The N-terminal domain that hosts the NMNAT activity is closely related to archaeal NMNAT. The bound NAD at the active site of the NMNAT domain reveals several critical interactions between NAD and the protein.The NMNAT domain of hiNadR defines yet another member of the pyridine nucleotide adenylyltransferase
Probab=99.56  E-value=4.5e-15  Score=109.95  Aligned_cols=63  Identities=16%  Similarity=0.283  Sum_probs=53.7

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHCCEEEEECCCCCCC-CCCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             99658998784899999999997489799964558887-6657898999999999764201335
Q gi|254780181|r    5 AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVK-TKGFLSIQERSELIKQSIFHFIPDS   67 (182)
Q Consensus         5 gifgGsFdPiH~GHL~ia~~a~~~~D~vii~~~~~p~k-~~~~~s~e~r~~m~~~a~~~~~~~~   67 (182)
T Consensus         1 Glv~GkF~P~H~GH~~lI~~A~~~~d~l~Vvv~~~~~~~~~~~i~~~~R~rWl~~~f~~~~~i~   64 (157)
T cd02167           1 GLVFGKFAPLHTGHQYLIYTAAAQVDELHVIVSGDPEEDGQIGITLEDRLRWLREAFPDQEQIL   64 (157)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCCEEE
T ss_conf             9552464799737899999999868969999847886555668999999999999779998799