HHsearch alignment for GI: 254780181 and conserved domain: cd02169

>cd02169 Citrate_lyase_ligase Citrate lyase ligase, also known as [Citrate (pro-3S)-lyase] ligase, is responsible for acetylation of the (2-(5''-phosphoribosyl)-3'-dephosphocoenzyme-A) prosthetic group of the gamma subunit of citrate lyase, converting the inactive thiol form of this enzyme to the active form. The acetylation of 1 molecule of deacetyl-citrate lyase to enzymatically active citrate lyase requires 6 molecules of ATP. The Adenylylyltranferase activity of the enzyme involves the formation of AMP and and pyrophosphate in the acetylation reaction.
Probab=98.97  E-value=1.1e-08  Score=71.88  Aligned_cols=145  Identities=14%  Similarity=0.238  Sum_probs=83.7

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCEEE-EECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEE---E--CCCCCCCCC
Q ss_conf             998784899999999997489799-9645588876657898999999999764201335544124---2--033333221
Q gi|254780181|r   10 SFDPITNGHMDIIIQALSFVEDLV-IAIGCNSVKTKGFLSIQERSELIKQSIFHFIPDSSNRVSV---I--SFEGLAVNL   83 (182)
Q Consensus        10 sFdPiH~GHL~ia~~a~~~~D~vi-i~~~~~p~k~~~~~s~e~r~~m~~~a~~~~~~~~~~~~~~---~--~~~~~~~~~   83 (182)
T Consensus       121 NaNPFTlGHrYLvE~Aa~~~D~l~vFVV~E----D~S~F~f~~R~~LVk~G~~~L~NV~v~~g~~YiIS~aTFPsYFlK~  196 (296)
T cd02169         121 NANPFTLGHRYLVEKAASENDWVYVFVVSE----DSSLFPFEDRLKLVKKGTAHLKNVTVHPGGDYIISSATFPSYFLKE  196 (296)
T ss_pred             ECCCCCCHHHHHHHHHHHHCCEEEEEEEEC----CCCCCCHHHHHHHHHHHHCCCCCEEEECCCCEEEECCCCCHHHCCC
T ss_conf             379875147999999996499899999945----4564878999999999747588869977999798646671444077


Q ss_pred             C--------------------CCCCCEEEEEECCCCCCHHHHHHHHHHHHHH-CCCCCEEEEECCCC--CCCCCHHHHHH
Q ss_conf             0--------------------0149707999437652012467799898764-79986899706857--21132699999
Q gi|254780181|r   84 A--------------------KDISAQVIVRGLRDMTDFDYEMRMTSVNRCL-CPEIATIALFAKES--SRYVTSTLIRH  140 (182)
Q Consensus        84 ~--------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l-~~~~~~i~l~~~~~--~~~ISST~IR~  140 (182)
T Consensus       197 ~~~v~~~qa~lD~~iF~~~IApaL~It~RfVG~EP~~~vT~-~YN~~M~~~Lp~~~Iev~~i-~R~~~~g~~ISAS~VR~  274 (296)
T cd02169         197 DDVVIKSQAALDARIFRKYIAPALGITRRYVGEEPFSPVTA-IYNQAMKSELPPPGIEVIEI-ERKTTDGQPISASTVRQ  274 (296)
T ss_pred             HHHHHHHHHHHHHHHHHHHCHHHHCCCCCEECCCCCCHHHH-HHHHHHHHHCCCCCCEEEEE-CCCCCCCCEEEHHHHHH
T ss_conf             43788999888699999844365087521517898987699-99999998557699679996-04115993870999999


Q ss_pred             HHHCCC--CHHHCCCHHHHHHH
Q ss_conf             998599--95583999999999
Q gi|254780181|r  141 LISIDA--DITSFVPDPVCVFL  160 (182)
Q Consensus       141 ~i~~g~--~i~~lVP~~V~~yI  160 (182)
T Consensus       275 ~l~~~~~~~i~~lVP~tT~~fL  296 (296)
T cd02169         275 ALKNGDLETLAKLVPETTLEFL  296 (296)
T ss_pred             HHHCCCHHHHHHHCCHHHHHHC
T ss_conf             9985999999763886437439