HHsearch results for GI: 254780181 and protein with PDBid: 1coz_A

>1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A*
Probab=99.56  E-value=1.3e-14  Score=105.94  Aligned_cols=124  Identities=23%  Similarity=0.235  Sum_probs=81.0

Q ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHHCCEEEEECCCCCC----CCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEECCC
Q ss_conf             6599965899878489999999999748979996455888----766578989999999997642013355441242033
Q gi|254780181|r    2 MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSV----KTKGFLSIQERSELIKQSIFHFIPDSSNRVSVISFE   77 (182)
Q Consensus         2 mkigifgGsFdPiH~GHL~ia~~a~~~~D~vii~~~~~p~----k~~~~~s~e~r~~m~~~a~~~~~~~~~~~~~~~~~~   77 (182)
                      ||.++.+|+|||+|.||+.+.++|.+++|+++++....+.    |..+..|.++|.++++.. .     ..+........
T Consensus         1 Mk~V~~~G~FD~lH~GH~~~l~~Ak~~gd~liV~v~~D~~~~~~k~~pi~~~~eR~~~l~~l-~-----~Vd~v~~~~~~   74 (129)
T 1coz_A            1 MKKVITYGTFDLLHWGHIKLLERAKQLGDYLVVAISTDEFNLQKQKKAYHSYEHRKLILETI-R-----YVDEVIPEKNW   74 (129)
T ss_dssp             CCEEEEEECCCSCCHHHHHHHHHHHTTSSEEEEEEECHHHHHHHTCCCSSCHHHHHHHHTTB-T-----TCCEEEEECCS
T ss_pred             CCEEEEEEEECCCCHHHHHHHHHHHHHCCEEEEEEECCCHHHCCCCCCCCCHHHHHHHHHHC-C-----CCCEEEEECCC
T ss_conf             93999934548799899999999997299899997067102058998878999999998652-5-----87889973785


Q ss_pred             CCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHC
Q ss_conf             3332210014970799943765201246779989876479986899706857211326999999985
Q gi|254780181|r   78 GLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISI  144 (182)
Q Consensus        78 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~l~~~~~~~~ISST~IR~~i~~  144 (182)
                      .............+.+.|.+....+.          .+....+.+++....   .+|||.||++|++
T Consensus        75 ~~~~~~i~~~~~d~~v~g~d~~~~~~----------~~k~~~~v~~~~~~~---~iSSt~i~~~I~~  128 (129)
T 1coz_A           75 EQKKQDIIDHNIDVFVMGDDWEGKFD----------FLKDQCEVVYLPRTE---GISTTKIKEEIAG  128 (129)
T ss_dssp             TTHHHHHHHTTCSEEEEEGGGTTTTG----------GGTTTSEEEEECCCT---TCCHHHHHHTC--
T ss_pred             CCCHHHHHHCCCCEEEECCCCCCHHH----------HHHCCCEEEEECCCC---CCCHHHHHHHHHC
T ss_conf             53788885239969998787466568----------886498899968998---8758999999973