HHsearch results for GI: 254780181 and protein with PDBid: 1yum_A

>1yum_A 'probable nicotinate-nucleotide adenylyltransferase; alpha/beta domain; HET: CIT NCN; 1.70A {Pseudomonas aeruginosa} PDB: 1yul_A* 1yun_A*
Probab=99.97  E-value=3.7e-32  Score=210.43  Aligned_cols=165  Identities=15%  Similarity=0.201  Sum_probs=118.0

Q ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHH--CCEEEEECC-CCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEE----
Q ss_conf             659996589987848999999999974--897999645-5888766578989999999997642013355441242----
Q gi|254780181|r    2 MRKAVYTGSFDPITNGHMDIIIQALSF--VEDLVIAIG-CNSVKTKGFLSIQERSELIKQSIFHFIPDSSNRVSVI----   74 (182)
Q Consensus         2 mkigifgGsFdPiH~GHL~ia~~a~~~--~D~vii~~~-~~p~k~~~~~s~e~r~~m~~~a~~~~~~~~~~~~~~~----   74 (182)
                      ||||||||||||+|+||+.+|+.|++.  +|+|+|+|+ .||.|.+...+.++|..|++.++........+..+..    
T Consensus        23 kkIgifgGSFdP~H~GHl~i~~~a~~~~~~d~V~~~p~~~n~~K~~~~~~~~~Rl~m~~~a~~~~~~i~vs~~E~~~~~~  102 (242)
T 1yum_A           23 KRIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRETPQVSAAQRLAMVERAVAGVERLTVDPRELQRDKP  102 (242)
T ss_dssp             CEEEEEEECCTTCCHHHHHHHHHHHHHHTCSEEEEEECCCCGGGSCTTCCHHHHHHHHHHHHTTCTTEEECCGGGGSSSS
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCCC
T ss_conf             86999675857150999999999999819998999983979887876558899999987776515605850243347887


Q ss_pred             --CCCCCCCCC--CCCCCCEEEEEECCCCCCHHHHHHHHHHHHH---------------------------------HCC
Q ss_conf             --033333221--0014970799943765201246779989876---------------------------------479
Q gi|254780181|r   75 --SFEGLAVNL--AKDISAQVIVRGLRDMTDFDYEMRMTSVNRC---------------------------------LCP  117 (182)
Q Consensus        75 --~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------------------------------l~~  117 (182)
                        +..++....  ......++++.|.|....+..|..+..+...                                 ...
T Consensus       103 ~~t~dtL~~l~~~~~~~~~~~~iiG~D~l~~i~~W~~~~~il~~~~ilV~~R~~~~~~~~~~~~~~~~~~~~~~~~~~~~  182 (242)
T 1yum_A          103 SYTIDTLESVRAELAADDQLFMLIGWDAFCGLPTWHRWEALLDHCHIVVLQRPDADSEPPESLRDLLAARSVADPQALKG  182 (242)
T ss_dssp             CCHHHHHHHHHHHSCTTCEEEEEEEHHHHTTGGGSTTGGGSTTTCEEEEEECSSSCCCCCGGGHHHHHHHBCSCGGGCCS
T ss_pred             CCHHHHHHHHHHHCCCCCEEEEEECCCHHHHCCCCCCHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCHHHHHC
T ss_conf             30999999987641467517997465306433677689999626858999689864200578999999873126888737


Q ss_pred             CCCEEEEECCCCCCCCCHHHHHHHHHCCCCHHHCCCHHHHHHHHHHHHHH
Q ss_conf             98689970685721132699999998599955839999999999999986
Q gi|254780181|r  118 EIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL  167 (182)
Q Consensus       118 ~~~~i~l~~~~~~~~ISST~IR~~i~~g~~i~~lVP~~V~~yIk~~~~~~  167 (182)
                      ....+++...++ .+||||+||++++.|++|+++||++|.+||++.-+|.
T Consensus       183 ~~~~i~~~~~~~-~dISST~IR~~i~~g~~i~~lvp~~V~~YI~~~~LY~  231 (242)
T 1yum_A          183 PGGQITFVWQTP-LAVSATQIRALLGAGRSVRFLVPDAVLNYIEAHHLYR  231 (242)
T ss_dssp             SSCCEEEEECCC-CSCCHHHHHHHHHTTCCCBTTBCHHHHHHHHHTTTTC
T ss_pred             CCCCEEEECCCC-CCCCHHHHHHHHHCCCCHHHHCCHHHHHHHHHCCCCC
T ss_conf             688589968997-4416999999998599913708999999999749999