HHsearch results for GI: 254780181 and protein with PDBid: 3cr8_A

>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans}
Probab=97.65  E-value=0.00072  Score=41.89  Aligned_cols=157  Identities=8%  Similarity=-0.006  Sum_probs=74.3

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHC-CEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEECCC---------
Q ss_conf             5899878489999999999748-979996455888766578989999999997642013355441242033---------
Q gi|254780181|r    8 TGSFDPITNGHMDIIIQALSFV-EDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIPDSSNRVSVISFE---------   77 (182)
Q Consensus         8 gGsFdPiH~GHL~ia~~a~~~~-D~vii~~~~~p~k~~~~~s~e~r~~m~~~a~~~~~~~~~~~~~~~~~~---------   77 (182)
                      .-|=||+|.||..++++++... |-|++.|-... +.. ......++.....++..+..............         
T Consensus       169 fqTRNp~HraHe~~~~~~~~~~~~~lli~~v~g~-~~~-~~~~~~~~~~~~~~~~~y~p~~~v~l~~l~~~~r~aGprEa  246 (552)
T 3cr8_A          169 WQARQPMHRAQYEFCLKSAIENEANLLLHPQVGG-DIT-EAPAYFGLVRSFLAIRDRFPAATTQLSLLPAPPPEASGRAL  246 (552)
T ss_dssp             ECCSSCCCHHHHHHHHHHHHHTTCEEEECCBCCC-CTT-TCTTHHHHHHHHHHHGGGSCGGGEEECBBCSCCCCSCSHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCC-CCC-CCCHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHH
T ss_conf             4226899778999999999854886676034577-766-66469999999999986467664477124776566760777


Q ss_pred             CCCCCCCCCCCCEEEEEECCCCCC--------HHHHH----HHHHHHHHHC----CCCCEEEE--------EC----CCC
Q ss_conf             333221001497079994376520--------12467----7998987647----99868997--------06----857
Q gi|254780181|r   78 GLAVNLAKDISAQVIVRGLRDMTD--------FDYEM----RMTSVNRCLC----PEIATIAL--------FA----KES  129 (182)
Q Consensus        78 ~~~~~~~~~~~~~~~~~~~~~~~~--------~~~~~----~~~~~~~~l~----~~~~~i~l--------~~----~~~  129 (182)
                      ......-.....-.+++|-+-...        |....    ........+.    ...+.++.        ..    ...
T Consensus       247 ilhAiirkN~GcthfiVGRDHAGvg~~~~~~~~y~~~~a~~~~~~~~~~lgI~~v~~~~~~Yc~~c~~~~~~~~c~h~~~  326 (552)
T 3cr8_A          247 LLRAIVARNFGCSLLIAGGEHQPDGGDCRRGEDLTQNRVDPSVAERAEKIGVRLIAYPRMVYVEDRAEHLPEAEAPQGAR  326 (552)
T ss_dssp             HHHHHHHHHHTCSEEEC----------------------CCSSHHHHHHHTCEEECCCCEEEEGGGTEEEEGGGSCTTCC
T ss_pred             HHHHHHHHHCCCCCCEECCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCEEEECCCCEEECCCCEEEECCCCCCCCC
T ss_conf             77778887468876227977777776766765457422567877341004966742253589757765987777898663


Q ss_pred             CCCCCHHHHHHHHHCCCC-HHHCCCHHHHHHHHHHHHH
Q ss_conf             211326999999985999-5583999999999999998
Q gi|254780181|r  130 SRYVTSTLIRHLISIDAD-ITSFVPDPVCVFLKNIVIS  166 (182)
Q Consensus       130 ~~~ISST~IR~~i~~g~~-i~~lVP~~V~~yIk~~~~~  166 (182)
                      ...||+|++|++++.|+. -..+.++.|++.|.+-+..
T Consensus       327 ~~~iSgt~lR~~L~~G~~pP~~f~rpEV~~~L~~~~~~  364 (552)
T 3cr8_A          327 LLTLSGEEFQRRMRAGLKIPEWYSFPEVLAELHRQTPP  364 (552)
T ss_dssp             EECCCHHHHHHHHTTTCCCCTTTSCHHHHHHHHHHSCC
T ss_pred             EECCCHHHHHHHHHCCCCCCCHHCCCHHHHHHHHHHHH
T ss_conf             75568899999997699999120263278999987544