HHsearch results for GI: 254780181 and protein with PDBid: 3guz_A

>3guz_A Pantothenate synthetase; pantothenate biosynthesis, substrate binding, competitive inhibition, rossmann fold; HET: PAF; 1.67A {Escherichia coli}
Probab=93.47  E-value=0.059  Score=30.49  Aligned_cols=58  Identities=19%  Similarity=0.293  Sum_probs=39.6

Q ss_pred             EEEEECCCCCCCCHHHHHHHHHHHHHCCEEEEECCCCCCCCCC-------CCCHHHHHHHHHHHHH
Q ss_conf             5999658998784899999999997489799964558887665-------7898999999999764
Q gi|254780181|r    3 RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKG-------FLSIQERSELIKQSIF   61 (182)
Q Consensus         3 kigifgGsFdPiH~GHL~ia~~a~~~~D~vii~~~~~p~k~~~-------~~s~e~r~~m~~~a~~   61 (182)
                      +||+.+ |--=+|-||+.++++|.+..|.+++.+..||..-+.       +.+.+.-.+.++.+..
T Consensus        23 ~IgfVP-TMGaLH~GHlsLI~~A~~~~d~vvVSIFVNP~QF~~~eD~~~YPr~~~~D~~~l~~~gv   87 (176)
T 3guz_A           23 RVALVP-TMGNLHDGHMKLVDEAKARADVVAVSIFVNPMQFDRPEDLARYPRTLQEDCEKLNKRKV   87 (176)
T ss_dssp             CEEEEE-ECSCCCGGGHHHHHHHHHTCSEEEEEECCCGGGCSCHHHHHHSCCCHHHHHHHHHHTTC
T ss_pred             EEEEEC-CCCCHHHHHHHHHHHHHHHCCEEEEEEECCCHHCCCCCCCCCCCCCHHHHHHHHHHCCC
T ss_conf             499983-87306599999999999759938999603703246666665499980778999997699