HHsearch results for GI: 254780181 and protein with PDBid: 3nbk_A

>3nbk_A Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: PNS; 1.58A {Mycobacterium tuberculosis} PDB: 3nba_A* 3lcj_A* 1tfu_A
Probab=100.00  E-value=1.6e-34  Score=224.59  Aligned_cols=156  Identities=29%  Similarity=0.459  Sum_probs=117.0

Q ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHHCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCC
Q ss_conf             65999658998784899999999997489799964558887665789899999999976420133554412420333332
Q gi|254780181|r    2 MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIPDSSNRVSVISFEGLAV   81 (182)
Q Consensus         2 mkigifgGsFdPiH~GHL~ia~~a~~~~D~vii~~~~~p~k~~~~~s~e~r~~m~~~a~~~~~~~~~~~~~~~~~~~~~~   81 (182)
                      ||||||||||||||+||+.+|++|+++||+|+|+++.+|++++.....+.+..+..........      ..........
T Consensus        21 mriai~~GsFdPiH~GHl~i~~~a~~~~D~viv~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~   94 (177)
T 3nbk_A           21 MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNL------RVQVGHGLVV   94 (177)
T ss_dssp             CCEEEEEECCTTCCHHHHHHHHHHHHHSSEEEEEECCCTTSCCSSCHHHHHHHHHHHCTTCTTE------EEEECCSCHH
T ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCC------CCCCCCCHHH
T ss_conf             6699968677988789999999999869989998345787666557999999998765402454------2233321025


Q ss_pred             CCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHCCCCHHHCCCHHHHHHHH
Q ss_conf             21001497079994376520124677998987647998689970685721132699999998599955839999999999
Q gi|254780181|r   82 NLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK  161 (182)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~l~~~~~~~~ISST~IR~~i~~g~~i~~lVP~~V~~yIk  161 (182)
                      .........................+.....+.+. ..+++++..++++.+||||+||+++++|++|++|||++|++|||
T Consensus        95 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~-~~~~i~~~~~~~~~~ISST~IRe~i~~g~~i~~lVP~~V~~yIk  173 (177)
T 3nbk_A           95 DFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIA-GVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLR  173 (177)
T ss_dssp             HHHHHTTCCEEEEEECTTCCHHHHHHHHHHHHHHH-CCEEEEEECCGGGSSCCHHHHHHHHHTTCCCGGGSCHHHHHHHH
T ss_pred             HHHHHCCCEEEEEEEECCCHHHHHHHHHHHHHHHC-CCCEEEEECCCCCCCCCHHHHHHHHHCCCCHHHHCCHHHHHHHH
T ss_conf             56653487087521021411554626999999728-97779996588777533599999998499867956999999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254780181|r  162 NIV  164 (182)
Q Consensus       162 ~~~  164 (182)
                      ||+
T Consensus       174 ekl  176 (177)
T 3nbk_A          174 DRL  176 (177)
T ss_dssp             HHH
T ss_pred             HHC
T ss_conf             862