BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780181|ref|YP_003064594.1| phosphopantetheine
adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62]
         (182 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780181|ref|YP_003064594.1| phosphopantetheine adenylyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039858|gb|ACT56654.1| phosphopantetheine adenylyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 182

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/182 (100%), Positives = 182/182 (100%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI
Sbjct: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
           FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA
Sbjct: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTI 180
           TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTI
Sbjct: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTI 180

Query: 181 FS 182
           FS
Sbjct: 181 FS 182


>gi|315122779|ref|YP_004063268.1| phosphopantetheine adenylyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496181|gb|ADR52780.1| phosphopantetheine adenylyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 165

 Score =  275 bits (703), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 148/162 (91%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+RKAVYTGSF+PITNGH+DI+IQ+LSFVE++V++IGCN VK   FLSIQERSEL+ +S+
Sbjct: 1   MLRKAVYTGSFNPITNGHIDILIQSLSFVEEVVVSIGCNPVKQDDFLSIQERSELVMKSV 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              IP S NRVSVISFEGLAVNLAKD+SAQVI+RGLRDMTDFDYEMRMTSVNR LCPEI 
Sbjct: 61  ADVIPGSINRVSVISFEGLAVNLAKDLSAQVIIRGLRDMTDFDYEMRMTSVNRRLCPEIV 120

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           TIALFAKESSRYVTSTLIRHL+SI +DITSFVPDPVCVFLK 
Sbjct: 121 TIALFAKESSRYVTSTLIRHLVSIGSDITSFVPDPVCVFLKE 162


>gi|116252155|ref|YP_767993.1| phosphopantetheine adenylyltransferase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|166216579|sp|Q1MGM6|COAD_RHIL3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|115256803|emb|CAK07893.1| putative phosphopantetheine adenylyltransferase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 164

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 109/159 (68%), Gaps = 1/159 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDPITNGH+D+++QAL+  E +++AIG +  K   F S +ER+ELI++S+ 
Sbjct: 1   MTTAFYPGSFDPITNGHVDVLVQALNVAEKVIVAIGIHPGKAPLF-SFEERAELIRRSLA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  +  +SV++F+ L V+ A+   A +++RGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  EALPGKTGDISVVAFDNLVVDAARTHGATLLIRGLRDGTDLDYEMQMAGMNRTMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           I L A  +SR +T+TL+R + ++  D+++FVP  V   L
Sbjct: 120 IFLPAGTASRPITATLVRQIAAMGGDVSAFVPAAVLQAL 158


>gi|86357732|ref|YP_469624.1| phosphopantetheine adenylyltransferase [Rhizobium etli CFN 42]
 gi|123511944|sp|Q2K8D9|COAD_RHIEC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|86281834|gb|ABC90897.1| phosphopantetheine adenylyltransferase protein [Rhizobium etli CFN
           42]
          Length = 164

 Score =  150 bits (379), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 108/159 (67%), Gaps = 1/159 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDPITNGH+D+++QAL+  E +++AIG +  K   F S +ER+ELI+ S+ 
Sbjct: 1   MTTAFYPGSFDPITNGHVDVLVQALNVAEKVIVAIGIHPGKAPLF-SFEERAELIRLSLA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  S  ++V++F+ L V+ A+   A +++RGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  EALPGKSANITVVAFDNLVVDAARAHGATLLIRGLRDGTDLDYEMQMAGMNRTMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           I L A  +SR +T+TL+R + ++  D+++FVP  V   L
Sbjct: 120 IFLPAGTASRPITATLVRQIAAMGGDVSAFVPAAVLQAL 158


>gi|222148796|ref|YP_002549753.1| phosphopantetheine adenylyltransferase [Agrobacterium vitis S4]
 gi|254763921|sp|B9JWW7|COAD_AGRVS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|221735782|gb|ACM36745.1| pantetheine-phosphate adenylyltransferase [Agrobacterium vitis S4]
          Length = 164

 Score =  150 bits (379), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 110/161 (68%), Gaps = 1/161 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDP+TNGH+D+++QAL+ V  +V+ IG +  K   F S +ER+ELI  S+ 
Sbjct: 1   MTIAFYPGSFDPMTNGHLDVLVQALNVVPKVVVGIGIHPGKVPMF-SFEERAELIATSLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  +  VSVI+F+GLAV+ A+   A ++VRGLRD +D DYEM++  +NR + P++ T
Sbjct: 60  EAVPLRAGDVSVIAFDGLAVDAARQHGATLLVRGLRDGSDLDYEMQLAGMNRQMAPDLQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L A  +SR +T+TL+R + ++  D+++FVP  V   LK+
Sbjct: 120 VFLPAGTASRPITATLVRQIATMGGDVSAFVPPQVSRALKS 160


>gi|327193333|gb|EGE60237.1| phosphopantetheine adenylyltransferase protein [Rhizobium etli
           CNPAF512]
          Length = 164

 Score =  150 bits (378), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 107/159 (67%), Gaps = 1/159 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDPITNGH+D+++QAL+  E +++AIG +  K   F S  ER+ELI+ S+ 
Sbjct: 1   MTTAFYPGSFDPITNGHVDVLVQALNVAEKVIVAIGIHPGKAPLF-SFDERAELIRLSLA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  +  +SV++F+ L V+ A+   A +++RGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  EALPGKTGDISVVAFDNLVVDAARAHGATLLIRGLRDGTDLDYEMQMAGMNRAMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           I L A  +SR +T+TL+R + ++  D+++FVP  V   L
Sbjct: 120 IFLPAGTASRPITATLVRQIAAMGGDVSAFVPSAVLQAL 158


>gi|209549344|ref|YP_002281261.1| phosphopantetheine adenylyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|226709011|sp|B5ZPR5|COAD_RHILW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|209535100|gb|ACI55035.1| pantetheine-phosphate adenylyltransferase [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 164

 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 105/152 (69%), Gaps = 1/152 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDPITNGH+D+++QAL+  E +++AIG +  K   F S +ER+ELI+ S+ 
Sbjct: 1   MTTAFYPGSFDPITNGHVDVLVQALNVAEKVIVAIGIHPGKAPLF-SFEERAELIRLSLA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  +  + V++F+ L V+ A+   A +++RGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  EVLPGKTGDIDVVAFDNLVVDAARSHGATLLIRGLRDGTDLDYEMQMAGMNRTMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           I L A  +SR +T+TL+R + ++  D+++FVP
Sbjct: 120 IFLPAGTASRPITATLVRQIAAMGGDVSAFVP 151


>gi|190891759|ref|YP_001978301.1| phosphopantetheine adenylyltransferase protein [Rhizobium etli CIAT
           652]
 gi|229541044|sp|B3PZQ8|COAD_RHIE6 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|190697038|gb|ACE91123.1| phosphopantetheine adenylyltransferase protein [Rhizobium etli CIAT
           652]
          Length = 164

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 107/159 (67%), Gaps = 1/159 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDPITNGH+D+++QAL+  E +++AIG +  K   F S  ER+ELI+ S+ 
Sbjct: 1   MTTAFYPGSFDPITNGHVDVLVQALNVAEKVIVAIGIHPGKAPLF-SFDERAELIRLSLA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  +  ++V++F+ L V+ A+   A +++RGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  QALPGKTGDITVVAFDNLVVDAARAHGATLLIRGLRDGTDLDYEMQMAGMNRAMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           I L A  +SR +T+TL+R + ++  D+++FVP  V   L
Sbjct: 120 IFLPAGTASRPITATLVRQIAAMGGDVSAFVPPAVLQAL 158


>gi|328543839|ref|YP_004303948.1| Phosphopantetheine adenylyltransferase [Polymorphum gilvum
           SL003B-26A1]
 gi|326413583|gb|ADZ70646.1| Phosphopantetheine adenylyltransferase [Polymorphum gilvum
           SL003B-26A1]
          Length = 168

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/162 (45%), Positives = 106/162 (65%), Gaps = 2/162 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+R A+Y GSFDP+TNGH+DI+ Q+L+  + +V+AIG +  K+  F   +ER E+I  S 
Sbjct: 1   MIRTALYPGSFDPVTNGHLDILHQSLALADRVVVAIGIHPGKSPMF-GFEERVEMIHASA 59

Query: 61  FH-FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
              F    S R+SVISF+ L V  A+ + A+ +VRGLRD TD DYEM+M  +N  L P+I
Sbjct: 60  RDAFGEADSERISVISFDNLVVETARRLGARYLVRGLRDGTDLDYEMQMAGMNATLAPDI 119

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            T+ + A    R++T+TL+R +  +  DIT+FVP PV   LK
Sbjct: 120 RTVFMPASPEVRHITATLVRQIAKMGGDITAFVPGPVAGRLK 161


>gi|15965335|ref|NP_385688.1| phosphopantetheine adenylyltransferase [Sinorhizobium meliloti
           1021]
 gi|307312707|ref|ZP_07592338.1| pantetheine-phosphate adenylyltransferase [Sinorhizobium meliloti
           BL225C]
 gi|307317193|ref|ZP_07596634.1| pantetheine-phosphate adenylyltransferase [Sinorhizobium meliloti
           AK83]
 gi|29427918|sp|Q92PY8|COAD_RHIME RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|15074515|emb|CAC46161.1| Probable phosphopantetheine adenylyltransferase [Sinorhizobium
           meliloti 1021]
 gi|306897281|gb|EFN28026.1| pantetheine-phosphate adenylyltransferase [Sinorhizobium meliloti
           AK83]
 gi|306899432|gb|EFN30064.1| pantetheine-phosphate adenylyltransferase [Sinorhizobium meliloti
           BL225C]
          Length = 163

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 110/160 (68%), Gaps = 1/160 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDPITNGH+D+++QAL+    +++AIG +  K   F S  ER++LI+ ++ 
Sbjct: 1   MTTAFYPGSFDPITNGHLDVLVQALNVAAKVIVAIGVHPGKAPLF-SFDERADLIRAALE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P+ +  +SV+SF+ L V+ A++  A+++VRGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  ETLPERAADISVVSFDNLVVDAAREHGARLLVRGLRDGTDLDYEMQMAGMNRQMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L A  +SR +T+TL+R + ++  D+++FVP  V   L+
Sbjct: 120 LFLPAGTASRPITATLVRQIAAMGGDVSAFVPGAVHQALQ 159


>gi|222085991|ref|YP_002544523.1| pantetheine-phosphate adenylyltransferase [Agrobacterium
           radiobacter K84]
 gi|254763920|sp|B9JFA5|COAD_AGRRK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|221723439|gb|ACM26595.1| pantetheine-phosphate adenylyltransferase [Agrobacterium
           radiobacter K84]
          Length = 167

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 107/159 (67%), Gaps = 1/159 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDP+TNGH+D+++QAL+    +++AIG +  K K   S +ER+ELI +S+ 
Sbjct: 1   MTTAFYPGSFDPMTNGHLDVLVQALNVASKVIVAIGIHPGK-KPLFSFEERAELINRSLA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  +  +SV+SF+ L V+ A+   A ++VRGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  DALPKKAADISVVSFDNLVVDAARKHGASLLVRGLRDGTDLDYEMQMAGMNRQMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L A  +SR +T+TL+R + S+  ++++FVP  V   L
Sbjct: 120 LFLPAGTASRPITATLVRQIASMGGNVSAFVPPAVLEAL 158


>gi|227822129|ref|YP_002826100.1| phosphopantetheine adenylyltransferase [Sinorhizobium fredii
           NGR234]
 gi|254764164|sp|C3MD28|COAD_RHISN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|227341129|gb|ACP25347.1| phosphopantetheine adenylyltransferase [Sinorhizobium fredii
           NGR234]
          Length = 164

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 67/160 (41%), Positives = 109/160 (68%), Gaps = 1/160 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDP+TNGH+D+++QAL+    +++AIG +  KT  F S  ER+ LI++S+ 
Sbjct: 1   MTTAFYPGSFDPMTNGHLDVLVQALNVASKVIVAIGIHPGKTPLF-SFDERAGLIRRSLS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  +  ++V++F+ L V+ A+   A ++VRGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  ESLPQRAGDIAVVAFDNLVVDAARQHGASLLVRGLRDGTDLDYEMQMAGMNRQMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L A  +SR +T+TL+R + ++  ++++FVP PV   L+
Sbjct: 120 LFLPAGTASRPITATLVRQIAAMGGNVSAFVPGPVFQALQ 159


>gi|241204659|ref|YP_002975755.1| phosphopantetheine adenylyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858549|gb|ACS56216.1| pantetheine-phosphate adenylyltransferase [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 164

 Score =  147 bits (371), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 105/152 (69%), Gaps = 1/152 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDPITNGH+D+++QAL+  E +++ IG +  K   F S +ER+ELI+ S+ 
Sbjct: 1   MTTAFYPGSFDPITNGHVDVLVQALNVAEKVIVGIGIHPGKAPLF-SFEERAELIRCSLA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  +  ++V++F+ L V+ A+   A +++RGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  EALPGKTGDIAVVAFDNLVVDAARTHGATLLIRGLRDGTDLDYEMQMAGMNRTMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           I L A  +SR +T+TL+R + ++  D+++FVP
Sbjct: 120 IFLPAGTASRPITATLVRQIAAMGGDVSAFVP 151


>gi|150396482|ref|YP_001326949.1| phosphopantetheine adenylyltransferase [Sinorhizobium medicae
           WSM419]
 gi|150027997|gb|ABR60114.1| pantetheine-phosphate adenylyltransferase [Sinorhizobium medicae
           WSM419]
          Length = 181

 Score =  147 bits (370), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 109/160 (68%), Gaps = 1/160 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDPITNGH+D+++QAL+    +++AIG +  K   F S  ER++LI+ ++ 
Sbjct: 19  MTTAFYPGSFDPITNGHLDVLVQALNVAAKVIVAIGAHPGKAPLF-SFDERADLIRAALV 77

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P+ +  +SV+SF+ L V+ A+   A+++VRGLRD TD DYEM+M  +NR + P+I T
Sbjct: 78  ETLPERAVDISVVSFDNLVVDAARKHGARLLVRGLRDGTDLDYEMQMAGMNRQMAPDIQT 137

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L A  +SR +T+TL+R + ++  D+++FVP  V   L+
Sbjct: 138 LFLPAGTASRPITATLVRQIAAMGGDVSAFVPGAVHQALQ 177


>gi|319405588|emb|CBI79208.1| Phosphopantetheine adenylyltransferase [Bartonella sp. AR 15-3]
          Length = 164

 Score =  147 bits (370), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 103/156 (66%), Gaps = 1/156 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDPITNGH+DI+  +L F + +V+AIG  + K K F S +ER+ LI Q   
Sbjct: 1   MKIALYAGSFDPITNGHLDILQSSLIFTDKVVVAIGIQATK-KPFFSFEERAALITQVRK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   S+R+ VISF+ L +  A++I A  ++RGLRD TDFDYEM+M  +N  + PE+ T
Sbjct: 60  DLLNIGSDRLQVISFDNLLIEKAREIGASFLIRGLRDGTDFDYEMQMAGMNEVMAPELRT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I L    SSR ++STL+R + ++  D+T FVP  V 
Sbjct: 120 IFLPTSISSRMISSTLVRQIATMGGDVTPFVPQNVA 155


>gi|319404136|emb|CBI77727.1| Phosphopantetheine adenylyltransferase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 168

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 104/156 (66%), Gaps = 1/156 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDPITNGH+DI+  +L     +V+AIG  ++K K F S +ER +LI Q   
Sbjct: 1   MTVALYAGSFDPITNGHLDILRSSLVLANKVVMAIGIQAIK-KPFFSFEERVDLIAQVRK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   S+R+ VISF+ L ++ A++I A  ++RGLRD TDFDYEM+M  +N  + PE+ T
Sbjct: 60  DILNIGSDRLQVISFDNLLIDKAREIGASFLIRGLRDGTDFDYEMQMAGINEMMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I L A  SSR ++STL+R ++++  DIT FVP  V 
Sbjct: 120 IFLPASISSRMISSTLVRQIVTMGGDITPFVPPNVA 155


>gi|254500933|ref|ZP_05113084.1| pantetheine-phosphate adenylyltransferase [Labrenzia alexandrii
           DFL-11]
 gi|222437004|gb|EEE43683.1| pantetheine-phosphate adenylyltransferase [Labrenzia alexandrii
           DFL-11]
          Length = 167

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/163 (44%), Positives = 106/163 (65%), Gaps = 2/163 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS- 59
           M R A+Y GSFDP+TNGHMDI+ Q+L+  + +V+AIG +  K K   S +ER ELI  S 
Sbjct: 1   MTRIALYPGSFDPVTNGHMDILRQSLALADKVVVAIGIHPGK-KPLFSFEERVELIHTSA 59

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           +  F    ++R+ VI+F  L +N A+   A  +VRGLRD TD DYEM+M  +N  L P+I
Sbjct: 60  VAEFSEAEASRIEVIAFSDLVINTARTQKADYLVRGLRDGTDLDYEMQMAGMNGTLEPDI 119

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            T+ L A  + R++T+TL+R +  +  +I++FVPDPV   L+ 
Sbjct: 120 KTVFLPASPAVRHITATLVRQIAQMGGEISAFVPDPVADPLRQ 162


>gi|118589191|ref|ZP_01546598.1| Coenzyme A biosynthesis
           protein:Cytidylyltransferase:Cytidyltransferase-related
           [Stappia aggregata IAM 12614]
 gi|118438520|gb|EAV45154.1| Coenzyme A biosynthesis
           protein:Cytidylyltransferase:Cytidyltransferase-related
           [Stappia aggregata IAM 12614]
          Length = 168

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 106/162 (65%), Gaps = 2/162 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGHMDI+ Q+L+  + +V+AIG +  K+  F S +ER ELI  S 
Sbjct: 1   MNRIALYPGSFDPVTNGHMDILRQSLALADRVVVAIGVHPGKSPLF-SFKERVELIHASA 59

Query: 61  F-HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
              F P+ + R+ VI+F+ L +  A+   A  +VRGLRD TD DYEM+M  +N  L P+I
Sbjct: 60  RSEFTPEEAERIDVIAFDNLVIETARQQKAAYLVRGLRDGTDLDYEMQMAGMNGTLEPDI 119

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            T+ L A    R++T+TL+R +  +  +I++FVP+PV   L+
Sbjct: 120 RTVFLPASPPVRHITATLVRQIAKMGGEISAFVPEPVAEPLR 161


>gi|153009510|ref|YP_001370725.1| phosphopantetheine adenylyltransferase [Ochrobactrum anthropi ATCC
           49188]
 gi|166216569|sp|A6X0Z2|COAD_OCHA4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|151561398|gb|ABS14896.1| pantetheine-phosphate adenylyltransferase [Ochrobactrum anthropi
           ATCC 49188]
          Length = 164

 Score =  144 bits (363), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 68/152 (44%), Positives = 101/152 (66%), Gaps = 1/152 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGHMD++  AL   +++++AIG +  K K   + +ER  LI +S  
Sbjct: 1   MTIAIYAGSFDPVTNGHMDVLKGALRLADEVIVAIGVHPGK-KPLFTFEERVALIGESSK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + RVSVISF+GL ++ A+  +AQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AILGKDAGRVSVISFDGLVIDAARKHAAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + L A  + R +T+TL+R + S+  DI  FVP
Sbjct: 120 VFLPADPAVRTITATLVRQIASMGGDIKPFVP 151


>gi|239831890|ref|ZP_04680219.1| pantetheine-phosphate adenylyltransferase [Ochrobactrum intermedium
           LMG 3301]
 gi|239824157|gb|EEQ95725.1| pantetheine-phosphate adenylyltransferase [Ochrobactrum intermedium
           LMG 3301]
          Length = 164

 Score =  144 bits (362), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 68/152 (44%), Positives = 101/152 (66%), Gaps = 1/152 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGHMD++  AL   +++++AIG +  K K   + +ER  LI +S  
Sbjct: 1   MTIAIYAGSFDPVTNGHMDVLKGALRLADEVIVAIGVHPGK-KPLFTFEERVALIDESCK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + R+SVISF+GL ++ A+  SAQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AVLGKDAGRLSVISFDGLVIDAARKHSAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + L A  + R +T+TL+R + S+  DI  FVP
Sbjct: 120 VFLPADPAVRTITATLVRQIASMGGDIKPFVP 151


>gi|325293067|ref|YP_004278931.1| Phosphopantetheine adenylyltransferase [Agrobacterium sp. H13-3]
 gi|325060920|gb|ADY64611.1| Phosphopantetheine adenylyltransferase [Agrobacterium sp. H13-3]
          Length = 164

 Score =  143 bits (361), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 105/156 (67%), Gaps = 1/156 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDP+TNGH+D++IQAL+    +++A+G +  K   F S +ER+ LI +++ 
Sbjct: 1   MTIAFYPGSFDPMTNGHLDVLIQALNVASKVIVAVGIHPGKAPLF-SFEERATLISRALS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  + RV V+SF+ L V+ A+   A++++RGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  ESLPGEAARVEVVSFDNLVVDAARQHGARLLLRGLRDGTDLDYEMQMAGMNRQMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + L A  SSR +T+TL+R + ++  ++ +FVP  V 
Sbjct: 120 VFLPAGTSSRPITATLVRQIAAMGGNVDAFVPKAVL 155


>gi|163843362|ref|YP_001627766.1| phosphopantetheine adenylyltransferase [Brucella suis ATCC 23445]
 gi|189082557|sp|B0CGP5|COAD_BRUSI RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|163674085|gb|ABY38196.1| pantetheine-phosphate adenylyltransferase [Brucella suis ATCC
           23445]
          Length = 164

 Score =  143 bits (361), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 101/159 (63%), Gaps = 1/159 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+D++  AL   + +++AIG +  K K   S  ER  LI+ S  
Sbjct: 1   MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGMHPGK-KPLFSFDERVALIEASAK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + RVSVI+F+GL ++ A+   AQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AVLHKDAARVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L A  + R +T+TL+R + S+  DI  FVP PV   L
Sbjct: 120 VFLPADPAVRTITATLVRQIASMGGDIKPFVPVPVAAAL 158


>gi|154253490|ref|YP_001414314.1| pantetheine-phosphate adenylyltransferase [Parvibaculum
           lavamentivorans DS-1]
 gi|171769668|sp|A7HXM4|COAD_PARL1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|154157440|gb|ABS64657.1| pantetheine-phosphate adenylyltransferase [Parvibaculum
           lavamentivorans DS-1]
          Length = 170

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 100/153 (65%), Gaps = 1/153 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R  +Y G+FDP+TNGH+DII + L  V+ L++AIG N+ KT   L+++ER +LI+Q  
Sbjct: 1   MARIGLYPGTFDPMTNGHLDIIRRGLKLVDHLIVAIGVNATKTP-LLTLEERFQLIEQEA 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                +  +++S  SF GL VN A +  A VI+RGLR   DF+YE +M  +NR + P + 
Sbjct: 60  GPIAKELGSKISTASFSGLVVNAADEHGATVILRGLRGAVDFEYETQMVGMNRVMNPHVE 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           T+ L A   +++++STL+R +  +D DI+ FVP
Sbjct: 120 TVFLAASPDTQFISSTLVRQIAGMDGDISPFVP 152


>gi|15888987|ref|NP_354668.1| phosphopantetheine adenylyltransferase [Agrobacterium tumefaciens
           str. C58]
 gi|29427860|sp|Q8UES4|COAD_AGRT5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|15156771|gb|AAK87453.1| phosphopantetheine adenylyltransferase [Agrobacterium tumefaciens
           str. C58]
          Length = 164

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/155 (42%), Positives = 103/155 (66%), Gaps = 1/155 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDP+TNGH+D++IQAL+    +++A+G +  K   F S  ER+ LI +++ 
Sbjct: 1   MTIAFYPGSFDPMTNGHLDVLIQALNVASKVIVAVGIHPGKAPLF-SFDERAALISRALS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  + RV V+SF+ L V+ A+   A +++RGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  ETLPGEAARVEVVSFDNLVVDAARQHGAHLLLRGLRDGTDLDYEMQMAGMNRQMAPDIQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L A  SSR +T+TL+R + ++  ++ +FVP  V
Sbjct: 120 VFLPAGTSSRPITATLVRQIAAMGGNVDAFVPKAV 154


>gi|319407151|emb|CBI80789.1| Phosphopantetheine adenylyltransferase [Bartonella sp. 1-1C]
          Length = 168

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 102/156 (65%), Gaps = 1/156 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDPITNGH+DI+  +L     +V+AIG  ++K K F S +ER +LI Q   
Sbjct: 1   MTVALYAGSFDPITNGHLDILRSSLVLANKVVMAIGIQAIK-KPFFSFEERVDLIAQVRK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   S+R+ VISF+ L ++ A++I A  ++RGLRD TDFDYEM+M  +N  + PE+ T
Sbjct: 60  DILNIGSDRLQVISFDNLLIDKAREIGASFLIRGLRDGTDFDYEMQMAGINEIMAPELRT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I L A  SSR ++STL+R + ++  DI  FVP  V 
Sbjct: 120 IFLPASISSRMISSTLVRQIATMGGDIRPFVPPNVV 155


>gi|254719162|ref|ZP_05180973.1| phosphopantetheine adenylyltransferase [Brucella sp. 83/13]
 gi|265984157|ref|ZP_06096892.1| phosphopantetheine adenylyltransferase [Brucella sp. 83/13]
 gi|306838153|ref|ZP_07471009.1| pantetheine-phosphate adenylyltransferase [Brucella sp. NF 2653]
 gi|264662749|gb|EEZ33010.1| phosphopantetheine adenylyltransferase [Brucella sp. 83/13]
 gi|306406743|gb|EFM62966.1| pantetheine-phosphate adenylyltransferase [Brucella sp. NF 2653]
          Length = 164

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 100/159 (62%), Gaps = 1/159 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+D++  AL   + +++AIG +  K K   S  ER  LIK S  
Sbjct: 1   MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGMHPGK-KPLFSFDERVALIKASAK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + RVSVI+F+GL ++ A+   AQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AVLHKDAARVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L A  + R +T+TL+R + S+  DI  FVP  V   L
Sbjct: 120 VFLPADPAVRTITATLVRQIASMGGDIKPFVPVAVAAAL 158


>gi|307947100|ref|ZP_07662435.1| pantetheine-phosphate adenylyltransferase [Roseibium sp. TrichSKD4]
 gi|307770764|gb|EFO29990.1| pantetheine-phosphate adenylyltransferase [Roseibium sp. TrichSKD4]
          Length = 166

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 106/163 (65%), Gaps = 2/163 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDPITNGH+DI+ Q+L+  + +V+AIG +  KT  F + +ER +LI ++ 
Sbjct: 1   MTRIALYPGSFDPITNGHIDILGQSLALADRVVVAIGIHPGKTPLF-TFEERVQLIHEAA 59

Query: 61  -FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
              F  D + R+ VISF  L V+ A+  +A  +VRGLRD TD DYEM+M  +N  L P I
Sbjct: 60  GVEFGVDEARRIEVISFSNLVVDAARAQTAAYLVRGLRDGTDLDYEMQMAGMNGTLAPSI 119

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            T+ L A  S R++T+TL+R +  +  DIT+FVP  V   L++
Sbjct: 120 KTVFLPASPSVRHITATLVRQIAKMGGDITAFVPSCVVSPLRD 162


>gi|306843963|ref|ZP_07476558.1| pantetheine-phosphate adenylyltransferase [Brucella sp. BO1]
 gi|306275718|gb|EFM57442.1| pantetheine-phosphate adenylyltransferase [Brucella sp. BO1]
          Length = 164

 Score =  140 bits (353), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 100/159 (62%), Gaps = 1/159 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+D++  AL   + +++AIG +  K K   S  ER  LIK S  
Sbjct: 1   MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGMHPGK-KPLFSFDERVALIKASAK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + RVSVI+F+GL ++ A+   AQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AVLHKDAVRVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L A  + R +T+TL+R + S+  DI  FVP  V   L
Sbjct: 120 VFLPADPAVRTITATLVRQIASMGGDIKPFVPVAVAAAL 158


>gi|163760252|ref|ZP_02167335.1| phosphopantetheine adenylyltransferase [Hoeflea phototrophica
           DFL-43]
 gi|162282651|gb|EDQ32939.1| phosphopantetheine adenylyltransferase [Hoeflea phototrophica
           DFL-43]
          Length = 182

 Score =  140 bits (353), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 98/153 (64%), Gaps = 1/153 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A Y GSFDP+TNGH+D++ QAL+  ++LVI IG +  K   F S  ER+ +I   + 
Sbjct: 18  MRTAFYPGSFDPMTNGHIDVLEQALALCDELVIGIGVHPGKAPLF-SFDERASMISHVVQ 76

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
              P     V+VISF+GL ++ A    A V+VRGLRD TD DYEM+M  +NR + P+I T
Sbjct: 77  SEFPLRFETVTVISFDGLVIDAASQAGATVLVRGLRDGTDLDYEMQMAGMNRAMAPDITT 136

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           +   A   +R++T+TL+R +  +  D++ FVP+
Sbjct: 137 VFAPAFPQTRHITATLVRQIAKMGGDVSPFVPE 169


>gi|17987169|ref|NP_539803.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 1
           str. 16M]
 gi|23501973|ref|NP_698100.1| phosphopantetheine adenylyltransferase [Brucella suis 1330]
 gi|62290010|ref|YP_221803.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 1 str.
           9-941]
 gi|82699938|ref|YP_414512.1| phosphopantetheine adenylyltransferase [Brucella melitensis biovar
           Abortus 2308]
 gi|148560691|ref|YP_001259019.1| phosphopantetheine adenylyltransferase [Brucella ovis ATCC 25840]
 gi|189024251|ref|YP_001935019.1| Coenzyme A biosynthesis protein [Brucella abortus S19]
 gi|225852597|ref|YP_002732830.1| phosphopantetheine adenylyltransferase [Brucella melitensis ATCC
           23457]
 gi|254689325|ref|ZP_05152579.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 6 str.
           870]
 gi|254693810|ref|ZP_05155638.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697458|ref|ZP_05159286.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701842|ref|ZP_05163670.1| phosphopantetheine adenylyltransferase [Brucella suis bv. 5 str.
           513]
 gi|254706717|ref|ZP_05168545.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|254710176|ref|ZP_05171987.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           B2/94]
 gi|254714174|ref|ZP_05175985.1| phosphopantetheine adenylyltransferase [Brucella ceti M644/93/1]
 gi|254717609|ref|ZP_05179420.1| phosphopantetheine adenylyltransferase [Brucella ceti M13/05/1]
 gi|254730355|ref|ZP_05188933.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 4 str.
           292]
 gi|256031670|ref|ZP_05445284.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           M292/94/1]
 gi|256044755|ref|ZP_05447659.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256113655|ref|ZP_05454466.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 3
           str. Ether]
 gi|256257572|ref|ZP_05463108.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 9 str.
           C68]
 gi|256263909|ref|ZP_05466441.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 2
           str. 63/9]
 gi|256369522|ref|YP_003107032.1| phosphopantetheine adenylyltransferase [Brucella microti CCM 4915]
 gi|260546565|ref|ZP_05822304.1| phosphopantetheine adenylyltransferase [Brucella abortus NCTC 8038]
 gi|260565642|ref|ZP_05836126.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 1
           str. 16M]
 gi|260754839|ref|ZP_05867187.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 6 str.
           870]
 gi|260758056|ref|ZP_05870404.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 4 str.
           292]
 gi|260761880|ref|ZP_05874223.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883851|ref|ZP_05895465.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 9 str.
           C68]
 gi|261214090|ref|ZP_05928371.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|261219443|ref|ZP_05933724.1| phosphopantetheine adenylyltransferase [Brucella ceti M13/05/1]
 gi|261314180|ref|ZP_05953377.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|261317731|ref|ZP_05956928.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           B2/94]
 gi|261321939|ref|ZP_05961136.1| phosphopantetheine adenylyltransferase [Brucella ceti M644/93/1]
 gi|261752402|ref|ZP_05996111.1| phosphopantetheine adenylyltransferase [Brucella suis bv. 5 str.
           513]
 gi|265988762|ref|ZP_06101319.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           M292/94/1]
 gi|265991177|ref|ZP_06103734.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265995013|ref|ZP_06107570.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 3
           str. Ether]
 gi|297248412|ref|ZP_06932130.1| pantetheine-phosphate adenylyltransferase [Brucella abortus bv. 5
           str. B3196]
 gi|54036867|sp|P63815|COAD_BRUSU RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|54040900|sp|P63814|COAD_BRUME RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|75496775|sp|Q57D42|COAD_BRUAB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123547038|sp|Q2YPY4|COAD_BRUA2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216062|sp|A5VQM2|COAD_BRUO2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488121|sp|B2S5U8|COAD_BRUA1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254763933|sp|C0RJ68|COAD_BRUMB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|17982836|gb|AAL52067.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 1
           str. 16M]
 gi|23347921|gb|AAN30015.1| pantetheine-phosphate adenylyltransferase [Brucella suis 1330]
 gi|62196142|gb|AAX74442.1| CoaD, pantetheine-phosphate adenylyltransferase [Brucella abortus
           bv. 1 str. 9-941]
 gi|82616039|emb|CAJ11075.1| Coenzyme A biosynthesis
           protein:Cytidylyltransferase:Cytidyltransferase-related
           domain [Brucella melitensis biovar Abortus 2308]
 gi|148371948|gb|ABQ61927.1| pantetheine-phosphate adenylyltransferase [Brucella ovis ATCC
           25840]
 gi|189019823|gb|ACD72545.1| Coenzyme A biosynthesis protein [Brucella abortus S19]
 gi|225640962|gb|ACO00876.1| pantetheine-phosphate adenylyltransferase [Brucella melitensis ATCC
           23457]
 gi|255999684|gb|ACU48083.1| phosphopantetheine adenylyltransferase [Brucella microti CCM 4915]
 gi|260095615|gb|EEW79492.1| phosphopantetheine adenylyltransferase [Brucella abortus NCTC 8038]
 gi|260151710|gb|EEW86804.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 1
           str. 16M]
 gi|260668374|gb|EEX55314.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 4 str.
           292]
 gi|260672312|gb|EEX59133.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674947|gb|EEX61768.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 6 str.
           870]
 gi|260873379|gb|EEX80448.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 9 str.
           C68]
 gi|260915697|gb|EEX82558.1| phosphopantetheine adenylyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260924532|gb|EEX91100.1| phosphopantetheine adenylyltransferase [Brucella ceti M13/05/1]
 gi|261294629|gb|EEX98125.1| phosphopantetheine adenylyltransferase [Brucella ceti M644/93/1]
 gi|261296954|gb|EEY00451.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           B2/94]
 gi|261303206|gb|EEY06703.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|261742155|gb|EEY30081.1| phosphopantetheine adenylyltransferase [Brucella suis bv. 5 str.
           513]
 gi|262766126|gb|EEZ11915.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 3
           str. Ether]
 gi|263001961|gb|EEZ14536.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|263094042|gb|EEZ17976.1| phosphopantetheine adenylyltransferase [Brucella melitensis bv. 2
           str. 63/9]
 gi|264660959|gb|EEZ31220.1| phosphopantetheine adenylyltransferase [Brucella pinnipedialis
           M292/94/1]
 gi|297175581|gb|EFH34928.1| pantetheine-phosphate adenylyltransferase [Brucella abortus bv. 5
           str. B3196]
 gi|326409118|gb|ADZ66183.1| Coenzyme A biosynthesis protein [Brucella melitensis M28]
 gi|326538825|gb|ADZ87040.1| pantetheine-phosphate adenylyltransferase [Brucella melitensis
           M5-90]
          Length = 164

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 100/159 (62%), Gaps = 1/159 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+D++  AL   + +++AIG +  K K   S  ER  LI+ S  
Sbjct: 1   MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGMHPGK-KPLFSFDERVALIEASAK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + RVSVI+F+GL ++ A+   AQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AVLHKDAARVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L A  + R +T+TL+R + S+  DI  FVP  V   L
Sbjct: 120 VFLPADPAVRTITATLVRQIASMGGDIKPFVPVAVAAAL 158


>gi|319898826|ref|YP_004158919.1| phosphopantetheine adenylyltransferase [Bartonella clarridgeiae 73]
 gi|319402790|emb|CBI76339.1| Phosphopantetheine adenylyltransferase [Bartonella clarridgeiae 73]
          Length = 164

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 107/159 (67%), Gaps = 3/159 (1%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y GSFDPITNGH+D++  +L F + +V+AIG  + K + F S +ER  LI +     +
Sbjct: 4   ALYAGSFDPITNGHLDVLRSSLVFSDKVVMAIGMQATK-RPFFSFEERVALIAEVRKDLL 62

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
             SS+R+ VISF+ L ++ A++I A  ++RGLRD TDFDYEM++  +N  + PE+ T+ L
Sbjct: 63  NISSDRLQVISFDNLLIDKAREIGASFLIRGLRDGTDFDYEMQIAGMNEMMAPELRTVFL 122

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPV--CVFLK 161
            A  +SR ++STL+R + ++  D+T FVP  V   ++LK
Sbjct: 123 PASIASRMISSTLVRQIATMGGDVTPFVPQNVARALYLK 161


>gi|225627570|ref|ZP_03785607.1| pantetheine-phosphate adenylyltransferase [Brucella ceti str. Cudo]
 gi|256159821|ref|ZP_05457558.1| phosphopantetheine adenylyltransferase [Brucella ceti M490/95/1]
 gi|256255072|ref|ZP_05460608.1| phosphopantetheine adenylyltransferase [Brucella ceti B1/94]
 gi|260168804|ref|ZP_05755615.1| phosphopantetheine adenylyltransferase [Brucella sp. F5/99]
 gi|261222263|ref|ZP_05936544.1| phosphopantetheine adenylyltransferase [Brucella ceti B1/94]
 gi|261758287|ref|ZP_06001996.1| phosphopantetheine adenylyltransferase [Brucella sp. F5/99]
 gi|265998227|ref|ZP_06110784.1| phosphopantetheine adenylyltransferase [Brucella ceti M490/95/1]
 gi|225617575|gb|EEH14620.1| pantetheine-phosphate adenylyltransferase [Brucella ceti str. Cudo]
 gi|260920847|gb|EEX87500.1| phosphopantetheine adenylyltransferase [Brucella ceti B1/94]
 gi|261738271|gb|EEY26267.1| phosphopantetheine adenylyltransferase [Brucella sp. F5/99]
 gi|262552695|gb|EEZ08685.1| phosphopantetheine adenylyltransferase [Brucella ceti M490/95/1]
          Length = 164

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 100/159 (62%), Gaps = 1/159 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+D++  AL   + +++AIG +  K K   S  ER  LI+ S  
Sbjct: 1   MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGIHPGK-KPLFSFDERVALIEASAK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + RVSVI+F+GL ++ A+   AQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AVLHKDAARVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L A  + R +T+TL+R + S+  DI  FVP  V   L
Sbjct: 120 VFLPADPAVRTITATLVRQIASMGGDIKPFVPVAVAAAL 158


>gi|256061182|ref|ZP_05451334.1| phosphopantetheine adenylyltransferase [Brucella neotomae 5K33]
 gi|261325186|ref|ZP_05964383.1| phosphopantetheine adenylyltransferase [Brucella neotomae 5K33]
 gi|261301166|gb|EEY04663.1| phosphopantetheine adenylyltransferase [Brucella neotomae 5K33]
          Length = 164

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 100/159 (62%), Gaps = 1/159 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+D++  AL   + +++AIG +  K K   S  ER  LI+ S  
Sbjct: 1   MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGMHPGK-KPLFSFDERVALIEASAK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + RVSVI+F+GL ++ A+   AQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AVLHKDAARVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L A  + R +T+TL+R + S+  DI  FVP  V   L
Sbjct: 120 VFLPADPAVRTITTTLVRQIASMGGDIKPFVPVAVAAAL 158


>gi|294852436|ref|ZP_06793109.1| pantetheine-phosphate adenylyltransferase [Brucella sp. NVSL
           07-0026]
 gi|294821025|gb|EFG38024.1| pantetheine-phosphate adenylyltransferase [Brucella sp. NVSL
           07-0026]
          Length = 164

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 100/159 (62%), Gaps = 1/159 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+D++  AL   + +++AIG +  K K   S  ER  LI+ S  
Sbjct: 1   MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGMHPGK-KPLFSFDERVALIEASAK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + RVSVI+F+GL ++ A+   AQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AVLHKDAARVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L A  + R +T+TL+R + S+  DI  FVP  V   L
Sbjct: 120 VFLPADPAVRTITATLVRQIASMGGDIKPFVPVAVAATL 158


>gi|161619046|ref|YP_001592933.1| phosphopantetheine adenylyltransferase [Brucella canis ATCC 23365]
 gi|254704387|ref|ZP_05166215.1| phosphopantetheine adenylyltransferase [Brucella suis bv. 3 str.
           686]
 gi|260566366|ref|ZP_05836836.1| phosphopantetheine adenylyltransferase [Brucella suis bv. 4 str.
           40]
 gi|261755062|ref|ZP_05998771.1| phosphopantetheine adenylyltransferase [Brucella suis bv. 3 str.
           686]
 gi|189082556|sp|A9M5A7|COAD_BRUC2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|161335857|gb|ABX62162.1| pantetheine-phosphate adenylyltransferase [Brucella canis ATCC
           23365]
 gi|260155884|gb|EEW90964.1| phosphopantetheine adenylyltransferase [Brucella suis bv. 4 str.
           40]
 gi|261744815|gb|EEY32741.1| phosphopantetheine adenylyltransferase [Brucella suis bv. 3 str.
           686]
          Length = 164

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 100/159 (62%), Gaps = 1/159 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+D++  AL   + +++AIG +  K K   S  ER  LI+ S  
Sbjct: 1   MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGMHPGK-KPLFSFDERVALIEVSAK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   + RVSVI+F+GL ++ A+   AQ++VRGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  AVLHKDAARVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L A  + R +T+TL+R + S+  DI  FVP  V   L
Sbjct: 120 VFLPADPAVRTITATLVRQIASMGGDIKPFVPVAVAAAL 158


>gi|49475755|ref|YP_033796.1| phosphopantetheine adenylyltransferase [Bartonella henselae str.
           Houston-1]
 gi|49238562|emb|CAF27802.1| Phosphopantetheine adenylyltransferase [Bartonella henselae str.
           Houston-1]
          Length = 177

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 100/157 (63%), Gaps = 1/157 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           MM+ A+Y GSFDP+TNGH+DI+  +    + +++AIG  + K +   S +ER +LI Q+ 
Sbjct: 5   MMKIALYAGSFDPLTNGHLDILKASFVLADKVIVAIGIQA-KKESLFSFEERVDLITQAG 63

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +   S+R+ VISFE L ++ A++I A  ++RGLRD TD DYEM+M  +N  + PE+ 
Sbjct: 64  KELLNMGSDRLQVISFETLLIDKAREIGASFLIRGLRDGTDLDYEMQMAGMNGLMAPELQ 123

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           T+ L A    R +TSTL+R + S+  D+  FVP  V 
Sbjct: 124 TVFLPAGVLGRVITSTLVRQIASMGGDVAPFVPANVA 160


>gi|319408725|emb|CBI82382.1| Phosphopantetheine adenylyltransferase [Bartonella schoenbuchensis
           R1]
          Length = 168

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 111/174 (63%), Gaps = 9/174 (5%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDPITNGH+D++  +L   +++V+AIG  S K   F S +ER +LI Q   
Sbjct: 1   MTIALYAGSFDPITNGHLDVLQGSLLLADEVVVAIGIQSGKQSLF-SFEERVDLITQVGK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +    +R+ VI+F+ L +N A++I A  ++RGLRD TD DYEM+M  +N+ + PE+ T
Sbjct: 60  DLLNIGPDRLRVIAFDNLLINKAREIQASFLIRGLRDGTDLDYEMQMAGMNKIMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL-VKYDSIK 174
           + L A  SSR +TSTL+R + ++  ++  FVP       +N+  +L +K+ S+K
Sbjct: 120 VFLPASVSSRPITSTLVRQIAAMGGNVMPFVP-------QNVAQALCLKFKSLK 166


>gi|220925040|ref|YP_002500342.1| phosphopantetheine adenylyltransferase [Methylobacterium nodulans
           ORS 2060]
 gi|254764158|sp|B8IK26|COAD_METNO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|219949647|gb|ACL60039.1| pantetheine-phosphate adenylyltransferase [Methylobacterium
           nodulans ORS 2060]
          Length = 166

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 101/161 (62%), Gaps = 1/161 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D+I QA   V  LVIAIG +  KT  F S +ER+ELI+ + 
Sbjct: 1   MNRTALYAGSFDPVTNGHVDVIRQACRLVGRLVIAIGVHPGKTPLF-SAEERAELIRATC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   + + V++F+ LAV+ A+   A + +RGLRD TD DYEM++  +N  + PE+ 
Sbjct: 60  DPIAAAEGSALEVVTFDDLAVSAARRAGASLFIRGLRDGTDLDYEMQLAGMNSAMAPEVQ 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ L A    R +T+TL+R + ++  D+  FVP+ V   L+
Sbjct: 120 TVFLPASTGVRPITATLVRQIAAMGGDVRPFVPELVAERLE 160


>gi|61212584|sp|Q6G304|COAD_BARHE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
          Length = 172

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 99/156 (63%), Gaps = 1/156 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+TNGH+DI+  +    + +++AIG  + K +   S +ER +LI Q+  
Sbjct: 1   MKIALYAGSFDPLTNGHLDILKASFVLADKVIVAIGIQA-KKESLFSFEERVDLITQAGK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   S+R+ VISFE L ++ A++I A  ++RGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  ELLNMGSDRLQVISFETLLIDKAREIGASFLIRGLRDGTDLDYEMQMAGMNGLMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + L A    R +TSTL+R + S+  D+  FVP  V 
Sbjct: 120 VFLPAGVLGRVITSTLVRQIASMGGDVAPFVPANVA 155


>gi|240850764|ref|YP_002972164.1| phosphopantetheine adenylyltransferase [Bartonella grahamii as4aup]
 gi|240267887|gb|ACS51475.1| phosphopantetheine adenylyltransferase [Bartonella grahamii as4aup]
          Length = 168

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 95/152 (62%), Gaps = 1/152 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+TNGH+D++       + +V+AIG  + K K   S +ER + I Q   
Sbjct: 1   MKIALYAGSFDPLTNGHLDVLKGCFVLADKVVVAIGIQADK-KTLFSFEERVDFITQVGK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F    SNR+ V+SF  L +  A+++ A  ++RGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  DFFGADSNRLQVLSFSNLLIEKAREVGASFLIRGLRDGTDLDYEMQMAGMNGVMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + L A  S R +TSTL+R + S+  D+T FVP
Sbjct: 120 VFLPASVSGRAITSTLVRQIASMGGDVTPFVP 151


>gi|121601709|ref|YP_989036.1| phosphopantetheine adenylyltransferase [Bartonella bacilliformis
           KC583]
 gi|120613886|gb|ABM44487.1| pantetheine-phosphate adenylyltransferase [Bartonella bacilliformis
           KC583]
          Length = 169

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 99/160 (61%), Gaps = 1/160 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDPITNGH+D++  +L   + +V+AIG  + K +   S +ER +LI Q   
Sbjct: 6   MTIAFYAGSFDPITNGHLDVLRGSLLLADKVVVAIGVQAQK-QSLFSFEERVDLITQVGR 64

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +    +R+ VISF  L ++ A++I A  +VRGLRD TDFDYEM+M  +N  + PE+ T
Sbjct: 65  DLLNVGPDRLQVISFNNLLIDTAREIGASFLVRGLRDGTDFDYEMQMAGMNGIMAPELQT 124

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L A  S R +TSTL+  + ++  D+T FVP  V   L+
Sbjct: 125 VFLPASISGRVITSTLVHQIAAMGGDVTHFVPQNVAQALR 164


>gi|29427853|sp|Q8RT67|COAD_BARBK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|18920721|gb|AAL82404.1|AF469609_3 phosphopantetheine adenylyltransferase [Bartonella bacilliformis]
          Length = 164

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 99/160 (61%), Gaps = 1/160 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDPITNGH+D++  +L   + +V+AIG  + K +   S +ER +LI Q   
Sbjct: 1   MTIAFYAGSFDPITNGHLDVLRGSLLLADKVVVAIGVQAQK-QSLFSFEERVDLITQVGR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +    +R+ VISF  L ++ A++I A  +VRGLRD TDFDYEM+M  +N  + PE+ T
Sbjct: 60  DLLNVGPDRLQVISFNNLLIDTAREIGASFLVRGLRDGTDFDYEMQMAGMNGIMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L A  S R +TSTL+  + ++  D+T FVP  V   L+
Sbjct: 120 VFLPASISGRVITSTLVHQIAAMGGDVTHFVPQNVAQALR 159


>gi|170742579|ref|YP_001771234.1| phosphopantetheine adenylyltransferase [Methylobacterium sp. 4-46]
 gi|229500840|sp|B0UP59|COAD_METS4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|168196853|gb|ACA18800.1| pantetheine-phosphate adenylyltransferase [Methylobacterium sp.
           4-46]
          Length = 166

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/161 (41%), Positives = 100/161 (62%), Gaps = 1/161 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D+I QA   V  LVIAIG +  KT  F   +ER+EL+++  
Sbjct: 1   MNRTALYAGSFDPVTNGHVDVIRQACRLVPRLVIAIGVHPGKTPLF-GAEERAELLREIC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     + V++F+ LAV+ A+ + A + +RGLRD TD DYEM++  +N  + PE+ 
Sbjct: 60  APLAAAEGAALDVVTFDDLAVSAARRVGASLFIRGLRDGTDLDYEMQLAGMNGAMAPEVQ 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ L A    R +T+TL+R + ++  D+  FVPD V   L+
Sbjct: 120 TVFLPASTGVRPITATLVRQIAAMGGDVRPFVPDLVAERLR 160


>gi|170748568|ref|YP_001754828.1| pantetheine-phosphate adenylyltransferase [Methylobacterium
           radiotolerans JCM 2831]
 gi|229500839|sp|B1LVR4|COAD_METRJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|170655090|gb|ACB24145.1| pantetheine-phosphate adenylyltransferase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 167

 Score =  134 bits (338), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 63/162 (38%), Positives = 98/162 (60%), Gaps = 1/162 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++ QA   V+ LVIAIG +  K   F S +ER+ L+ ++ 
Sbjct: 1   MTRTALYAGSFDPVTNGHLDVVRQACRLVDRLVIAIGVHPGKAPLF-SAEERAALLTETC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     + +++F  LAV+ A+   A + +RGLRD TD DYEM++  +N  + PE+ 
Sbjct: 60  GPVAQAEGAALEIVTFNDLAVSAARRCGAAIFIRGLRDGTDLDYEMQLAGMNGAMAPEVQ 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ L A   +R +T+TL+R +  +  D++ FVP  V   L+ 
Sbjct: 120 TVFLPASTQARPITATLVRQIAGMGGDVSPFVPAAVAARLRQ 161


>gi|182679300|ref|YP_001833446.1| phosphopantetheine adenylyltransferase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|229488117|sp|B2IHR4|COAD_BEII9 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|182635183|gb|ACB95957.1| pantetheine-phosphate adenylyltransferase [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 167

 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 100/158 (63%), Gaps = 1/158 (0%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+YTGSFDP+T GHMD+I  A    +++++AIG N  KT  F + QER  LI+ +     
Sbjct: 5   ALYTGSFDPLTLGHMDVIGNAAVLCDEVIVAIGVNPSKTPLF-TAQERITLIESACGPLF 63

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
              + ++SV  F GLAV  A++  AQ++VRGLRD +D D+EM+M S+NR + P+I TI  
Sbjct: 64  ASHACKLSVRLFSGLAVEAAREAGAQLLVRGLRDGSDLDFEMQMASMNRVMAPDIQTIFF 123

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            A  + R++T+TL+R + ++  D + FVP  V   L  
Sbjct: 124 PAAPAVRHITATLVRQVATMGGDASPFVPPVVAAALAQ 161


>gi|163868580|ref|YP_001609789.1| phosphopantetheine adenylyltransferase [Bartonella tribocorum CIP
           105476]
 gi|189082555|sp|A9IVT5|COAD_BART1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|161018236|emb|CAK01794.1| Phosphopantetheine adenylyltransferase [Bartonella tribocorum CIP
           105476]
          Length = 168

 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 95/156 (60%), Gaps = 1/156 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A Y GSFDP+TNGH+D++       + +V+AIG  + K K   S +ER + I Q   
Sbjct: 1   MKIAFYAGSFDPLTNGHLDVLKGCFVLADKVVVAIGLQANK-KTLFSFEERVDFITQVGK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   SNR+ V+SF  L +  A+++ A  ++RGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  DLLGADSNRLQVLSFNNLLIEKAREVGASFLIRGLRDGTDLDYEMQMAGMNGIMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + L A  S R +TSTL+R + S+  D+T FVP  + 
Sbjct: 120 VFLPASVSGRAITSTLVRQIASMGGDVTPFVPSNIA 155


>gi|296445822|ref|ZP_06887774.1| pantetheine-phosphate adenylyltransferase [Methylosinus
           trichosporium OB3b]
 gi|296256650|gb|EFH03725.1| pantetheine-phosphate adenylyltransferase [Methylosinus
           trichosporium OB3b]
          Length = 188

 Score =  134 bits (336), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 99/162 (61%), Gaps = 5/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+YTGSFDP+T GH+D+I       + LV+AIG +  KT   L++ ER  LI++  
Sbjct: 25  MTRTALYTGSFDPLTLGHLDVIRAGAGLCDRLVVAIGAHPGKTP-LLALDERIALIREVC 83

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+SF GLAV  A++  A++I+RGLRD +DFDYEM+M  +N  + PEI 
Sbjct: 84  AGL----DGTFEVVSFAGLAVEAAREHKAEIILRGLRDGSDFDYEMQMAGMNLAMAPEIR 139

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           TI L +  + R++T+TL+R + S+  D++ FVP      L+ 
Sbjct: 140 TIFLPSSPTVRHITATLVRQIASLGGDVSPFVPPQAAEALRR 181


>gi|299133973|ref|ZP_07027167.1| pantetheine-phosphate adenylyltransferase [Afipia sp. 1NLS2]
 gi|298591809|gb|EFI52010.1| pantetheine-phosphate adenylyltransferase [Afipia sp. 1NLS2]
          Length = 165

 Score =  133 bits (335), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 101/161 (62%), Gaps = 1/161 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++ QA + V+ L++AIG +  K   F SI ER  +I +  
Sbjct: 1   MARVALYPGSFDPVTNGHVDVVRQACTLVDRLIVAIGVHPGKAPLF-SIDERRAMIVEVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F   S   +  ++F+ L V  A+   A +++RGLRD TD DYEM++  +N+ L P++ 
Sbjct: 60  APFAAASGCGIECVTFDNLTVAAAQKAGASILIRGLRDGTDLDYEMQIAGMNQTLVPDVQ 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           TI + A  + R +T+TL+R + S+  D+++FVP  V   LK
Sbjct: 120 TIFIPASPTVRPITATLVRQIASMGGDVSAFVPKAVATRLK 160


>gi|114707077|ref|ZP_01439976.1| phosphopantetheine adenylyltransferase protein [Fulvimarina pelagi
           HTCC2506]
 gi|114537627|gb|EAU40752.1| phosphopantetheine adenylyltransferase protein [Fulvimarina pelagi
           HTCC2506]
          Length = 161

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/161 (39%), Positives = 104/161 (64%), Gaps = 3/161 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A + GSFDP+T GH+ I+ QAL+  +++V+ IG ++ KT  F S + R++LI+ S+ 
Sbjct: 1   MTTAFFPGSFDPMTFGHLSILRQALAAFDEVVVGIGVHAAKTPMF-SFEMRADLIRASLK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +   S  ++++SF+GL V  A +  A V+VRGLRD TD +YEM+M  +N  + P+I T
Sbjct: 60  --VDGGSADIAIVSFDGLVVEAAANAQASVLVRGLRDGTDLNYEMQMAGMNGAMRPDITT 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L A   +R +T+TL+R +  +  D++ FVP+PV   L+ 
Sbjct: 118 VFLPASPETRPITATLVRQIAKMGGDVSPFVPEPVLAALRG 158


>gi|217979655|ref|YP_002363802.1| phosphopantetheine adenylyltransferase [Methylocella silvestris
           BL2]
 gi|254764159|sp|B8EIU8|COAD_METSB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|217505031|gb|ACK52440.1| pantetheine-phosphate adenylyltransferase [Methylocella silvestris
           BL2]
          Length = 167

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 102/156 (65%), Gaps = 1/156 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+YTGSFDP+TNGH+D+I  A S  ++LV+ IG +  K   F S+ ER+ LI +S 
Sbjct: 1   MNRIALYTGSFDPLTNGHLDVITSAASICDELVVGIGAHPSKAPLF-SVDERAALIDRSC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F+ + S R+SV  F GLAV  A+   A++++RGLR+ +DFDYE +M  +N  + PEI 
Sbjct: 60  RDFLKERSCRLSVQPFFGLAVEAARAAGARILIRGLRNGSDFDYEAQMAGMNAAMAPEIR 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           T+   A     ++T+TL+R + ++  D++ FVP PV
Sbjct: 120 TVFFVASPGVGHITATLVRQIAAMGGDVSHFVPQPV 155


>gi|49474365|ref|YP_032407.1| phosphopantetheine adenylyltransferase [Bartonella quintana str.
           Toulouse]
 gi|61212582|sp|Q6FZG1|COAD_BARQU RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|49239869|emb|CAF26267.1| Phosphopantetheine adenylyltransferase [Bartonella quintana str.
           Toulouse]
          Length = 172

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 98/152 (64%), Gaps = 1/152 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+TNGH+ I+  +    + +V+AIG  + K K   S +ER +LI Q   
Sbjct: 1   MKIALYAGSFDPLTNGHIAILQGSFVLADKVVVAIGIQA-KKKSLFSFEERVDLITQVGK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +    +R+ VISF+ L ++ A++I A  ++RGLRD TD DYEM+M  +N  + PE+ T
Sbjct: 60  DLLSIGPDRLQVISFDTLLIDKAREIGASFLIRGLRDGTDLDYEMQMAGMNGVMAPELQT 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + L A  S R +TSTL+R + S+  D+++FVP
Sbjct: 120 VFLPASVSGRAITSTLVRQIASMGGDVSAFVP 151


>gi|110633755|ref|YP_673963.1| phosphopantetheine adenylyltransferase [Mesorhizobium sp. BNC1]
 gi|122966032|sp|Q11IH7|COAD_MESSB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|110284739|gb|ABG62798.1| Phosphopantetheine adenylyltransferase [Chelativorans sp. BNC1]
          Length = 166

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/160 (40%), Positives = 97/160 (60%), Gaps = 1/160 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A Y GSFDP+TNGH+D++  AL   + +VI IG +  K K   S  ER  LI++S   
Sbjct: 4   RTAFYAGSFDPLTNGHLDVLKGALELADTVVIGIGIHPGK-KPLFSYGERVALIERSAKD 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
            +     R+ V++F+ L ++ A+   A +++RGLRD TD DYEM+M  +N+ + PE+ T+
Sbjct: 63  ELGADGGRIKVVAFDNLVIDAARVHGASIMIRGLRDGTDLDYEMQMAGMNQTMAPELLTV 122

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L A  S R VT+TL+R + S+  ++  FVP  V   LK 
Sbjct: 123 FLPASPSVRTVTATLVRQIASMGGNVAPFVPAVVAAALKE 162


>gi|296535361|ref|ZP_06897561.1| pantetheine-phosphate adenylyltransferase [Roseomonas cervicalis
           ATCC 49957]
 gi|296264303|gb|EFH10728.1| pantetheine-phosphate adenylyltransferase [Roseomonas cervicalis
           ATCC 49957]
          Length = 183

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 94/151 (62%), Gaps = 1/151 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  VY G+FDP+TNGH+DII +A   ++ LVI +  N+ K   F  ++ER EL+K     
Sbjct: 16  RSGVYPGTFDPVTNGHIDIINRAARILDRLVIGVAMNAGKGPLF-PLEERVELVKAETDA 74

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +   + V+ F+ L V  A+++ AQVIVRGLR +TDFDYE +M  +NR L PEI  +
Sbjct: 75  IARRTGTVIEVVPFDSLLVGFAREVGAQVIVRGLRAVTDFDYEFQMAGLNRRLDPEIELV 134

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVP 153
            L A E + +++S  ++ +  +  DITSFVP
Sbjct: 135 FLMASEGNHFISSRFVKEIARLGGDITSFVP 165


>gi|13470907|ref|NP_102476.1| phosphopantetheine adenylyltransferase [Mesorhizobium loti
           MAFF303099]
 gi|29427963|sp|Q98M51|COAD_RHILO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|14021650|dbj|BAB48262.1| phosphopantetheine adenylyltransferase [Mesorhizobium loti
           MAFF303099]
          Length = 166

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 63/158 (39%), Positives = 97/158 (61%), Gaps = 1/158 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y GSFDP+TNGH+D++  +L+  + +  AIG +  K K   S +ER +LI+ +   
Sbjct: 4   RTALYAGSFDPLTNGHLDVLKASLAVADIVYAAIGIHPGK-KPLFSFEERVQLIEDATKA 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                  R+ V++F+GL ++ A+   A +++RGLRD TD DYEM+M  +N  + PE+ T+
Sbjct: 63  EFGRDGARIKVVAFDGLVIDAARKQGASIMIRGLRDGTDLDYEMQMAGMNETMAPELQTV 122

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
            L A  S R +T+TL+R + S+  DI  FVP  V   L
Sbjct: 123 FLPASPSVRTITATLVRQIASMGGDIRPFVPAAVAGAL 160


>gi|260459147|ref|ZP_05807402.1| pantetheine-phosphate adenylyltransferase [Mesorhizobium
           opportunistum WSM2075]
 gi|259034701|gb|EEW35957.1| pantetheine-phosphate adenylyltransferase [Mesorhizobium
           opportunistum WSM2075]
          Length = 166

 Score =  130 bits (327), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 63/158 (39%), Positives = 97/158 (61%), Gaps = 1/158 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y GSFDP+TNGH+D++  +L+  + +  AIG +  K K   S +ER +LI+ +   
Sbjct: 4   RIALYAGSFDPLTNGHLDVLKASLAVADIVYAAIGIHPGK-KPLFSFEERVQLIEAATKA 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                  R+ V++F+GL ++ A+   A +++RGLRD TD DYEM+M  +N  + PE+ T+
Sbjct: 63  EFGRDGGRIKVVAFDGLVIDAARREGASIMIRGLRDGTDLDYEMQMAGMNETMAPELQTV 122

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
            L A  S R +T+TL+R + S+  DI  FVP  V   L
Sbjct: 123 FLPASPSVRTITATLVRQIASMGGDIRPFVPAAVAGAL 160


>gi|218532906|ref|YP_002423722.1| phosphopantetheine adenylyltransferase [Methylobacterium
           chloromethanicum CM4]
 gi|218525209|gb|ACK85794.1| pantetheine-phosphate adenylyltransferase [Methylobacterium
           chloromethanicum CM4]
          Length = 167

 Score =  130 bits (326), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 97/158 (61%), Gaps = 1/158 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y GSFDP+TNGH+D++ QA   V  LV+AIG +  K   F + +ER+ L++++   
Sbjct: 4   RTALYAGSFDPVTNGHLDVVRQACRLVPRLVLAIGVHPGKAPLF-TAEERAALLRETCEP 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   + V++F+ LAV  A+   A++ +RGLRD TD DYEM++  +N  + PE+ T+
Sbjct: 63  LAAAEGANLDVVTFDDLAVTAARRCGARLFIRGLRDGTDLDYEMQLAGMNGAMAPEVQTV 122

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
            L A    R +T+TL+R + ++  D++ FVP  V   L
Sbjct: 123 FLPASTGVRPITATLVRQIAAMGGDVSPFVPSVVAARL 160


>gi|188584273|ref|YP_001927718.1| phosphopantetheine adenylyltransferase [Methylobacterium populi
           BJ001]
 gi|179347771|gb|ACB83183.1| pantetheine-phosphate adenylyltransferase [Methylobacterium populi
           BJ001]
          Length = 167

 Score =  130 bits (326), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 95/152 (62%), Gaps = 1/152 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           +R A+Y GSFDP+TNGH+D++ QA   V  LV+AIG +  K   F S +ER+ L+ ++  
Sbjct: 3   IRTALYAGSFDPVTNGHLDVVRQACRLVPRLVLAIGVHPGKAPLF-SAEERAALLSETCG 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    + V++F+ LAV+ A+   A + +RGLRD TD DYEM++  +N  + PE+ T
Sbjct: 62  PLAAAEGASLEVVTFDDLAVSAARRCGASLFIRGLRDGTDLDYEMQLAGMNGAMAPEVQT 121

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + L A    R +T+TL+R + ++  D++ FVP
Sbjct: 122 VFLPASTGVRPITATLVRQIAAMGGDVSPFVP 153


>gi|163853965|ref|YP_001642008.1| pantetheine-phosphate adenylyltransferase [Methylobacterium
           extorquens PA1]
 gi|240141419|ref|YP_002965899.1| Pantetheine-phosphate adenylyltransferase [Methylobacterium
           extorquens AM1]
 gi|254563934|ref|YP_003071029.1| Pantetheine-phosphate adenylyltransferase [Methylobacterium
           extorquens DM4]
 gi|163665570|gb|ABY32937.1| pantetheine-phosphate adenylyltransferase [Methylobacterium
           extorquens PA1]
 gi|240011396|gb|ACS42622.1| Pantetheine-phosphate adenylyltransferase [Methylobacterium
           extorquens AM1]
 gi|254271212|emb|CAX27224.1| Pantetheine-phosphate adenylyltransferase [Methylobacterium
           extorquens DM4]
          Length = 167

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 97/158 (61%), Gaps = 1/158 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y GSFDP+TNGH+D++ QA   V  LV+AIG +  K   F + +ER+ L++++   
Sbjct: 4   RTALYAGSFDPVTNGHLDVVRQACRLVPRLVLAIGVHPGKAPLF-TAEERAALLRETCEP 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   + V++F+ LAV  A+   A++ +RGLRD TD DYEM++  +N  + PE+ T+
Sbjct: 63  LAAAEGASLDVVTFDDLAVTAARRCGARLFIRGLRDGTDLDYEMQLAGMNGAMAPEVQTV 122

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
            L A    R +T+TL+R + ++  D++ FVP  V   L
Sbjct: 123 FLPASTGVRPITATLVRQIAAMGGDVSPFVPSVVAARL 160


>gi|154247711|ref|YP_001418669.1| pantetheine-phosphate adenylyltransferase [Xanthobacter
           autotrophicus Py2]
 gi|154161796|gb|ABS69012.1| pantetheine-phosphate adenylyltransferase [Xanthobacter
           autotrophicus Py2]
          Length = 169

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 98/160 (61%), Gaps = 1/160 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y GSFDP+TNGH+D++  A    + LV+A+G +  K   F S QER E++++    
Sbjct: 7   RTAIYGGSFDPLTNGHLDVVRSACRLADRLVLAVGIHPGKAPLF-SAQERLEMLREVCEP 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                +  +  I+F+GL  + A+ + A +++RGLRD TD DYEM+M  +N  L P I T+
Sbjct: 66  VAAQENATLETITFDGLITSTAQGLGATLLIRGLRDGTDLDYEMQMAGMNGVLAPAIQTV 125

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L A    R +T+TL+R + ++  D+++FVP  V   LK+
Sbjct: 126 FLPASPRVRPITATLVRQIAAMGGDVSAFVPAEVLARLKD 165


>gi|323136307|ref|ZP_08071389.1| pantetheine-phosphate adenylyltransferase [Methylocystis sp. ATCC
           49242]
 gi|322398381|gb|EFY00901.1| pantetheine-phosphate adenylyltransferase [Methylocystis sp. ATCC
           49242]
          Length = 190

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 98/162 (60%), Gaps = 1/162 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y+G+FDP+T GH+D+I Q  +  + +V+AIG +  K   +L+ +ER+ +I ++   
Sbjct: 26  RTALYSGTFDPLTYGHLDVIRQGAAMFDRIVVAIGVHPGKAP-WLTFEERAAVIAEACED 84

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
           F       + V SF+GL V  A+   A  I+RGLRD TDFDYEM+M  +N  L PE+ T+
Sbjct: 85  FELSRPCAIEVTSFDGLVVEAARACGACAILRGLRDGTDFDYEMQMAGMNGTLAPEVHTL 144

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
            L A    R+++ TL+R + S+  D+++F P      LK  +
Sbjct: 145 FLPAAPGLRHISGTLVRQIASLGGDVSAFAPPASVEALKRAI 186


>gi|300023683|ref|YP_003756294.1| pantetheine-phosphate adenylyltransferase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525504|gb|ADJ23973.1| pantetheine-phosphate adenylyltransferase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 167

 Score =  128 bits (321), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 64/161 (39%), Positives = 99/161 (61%), Gaps = 1/161 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+R   Y+GSFDP+T GH D+I +A   ++ LVI IG N  K+  F +  +R  +++  +
Sbjct: 1   MIRIGFYSGSFDPVTLGHTDVIRRAAGLLDRLVIGIGVNPGKSPMF-TTDDRIAMLQDEV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              + D+  ++ V++F GLAV+ AK   A VIVRGLRD TDFDYEM+M  +N  + P+I 
Sbjct: 60  RPIVRDTKTKIEVVTFSGLAVDAAKANRATVIVRGLRDGTDFDYEMQMAGMNGEMAPDIQ 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ + A    R++ + L+R ++S+  D + FV   V   LK
Sbjct: 120 TVYVAASPHVRHIAANLVRAVVSMGGDPSPFVSKDVLKRLK 160


>gi|90419652|ref|ZP_01227562.1| phosphopantetheine adenylyltransferase KDTB [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336589|gb|EAS50330.1| phosphopantetheine adenylyltransferase KDTB [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 160

 Score =  127 bits (318), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 97/152 (63%), Gaps = 4/152 (2%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A Y GSFDP+TNGH+DI+ QAL+  + +V+ IG +  KT  F S  ER+ LI   + 
Sbjct: 1   MTRAFYPGSFDPMTNGHLDILRQALAVFDTVVVGIGVHPGKTPMF-SFDERARLIADCVG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                S   + V++F+ LAV+ A +  A  IVRGLRD TD +YEM+M+ +N  + PE+ T
Sbjct: 60  G---TSDAELRVVAFDNLAVDAAVEAGASAIVRGLRDGTDLNYEMQMSGMNGVMRPEVTT 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           +   A  ++R +T+TL+R +  +  D+++FVP
Sbjct: 117 VFFPASPATRPITATLVRQIARMGGDVSAFVP 148


>gi|218514408|ref|ZP_03511248.1| phosphopantetheine adenylyltransferase [Rhizobium etli 8C-3]
          Length = 130

 Score =  127 bits (318), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 88/130 (67%), Gaps = 1/130 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A Y GSFDPITNGH+D+++QAL+  E +++AIG +  K   F S  ER+ELI+ S+ 
Sbjct: 1   MTTAFYPGSFDPITNGHVDVLVQALNVAEKVIVAIGIHPGKAPLF-SFDERAELIRLSLA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P  +  ++V++F+ L V+ A+   A +++RGLRD TD DYEM+M  +NR + P+I T
Sbjct: 60  QALPGKTGDITVVAFDNLVVDAARAHGATLLIRGLRDGTDLDYEMQMAGMNRAMAPDIQT 119

Query: 122 IALFAKESSR 131
           I L A  +SR
Sbjct: 120 IFLPAGTASR 129


>gi|319783737|ref|YP_004143213.1| pantetheine-phosphate adenylyltransferase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317169625|gb|ADV13163.1| pantetheine-phosphate adenylyltransferase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 166

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 97/158 (61%), Gaps = 1/158 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y GSFDP+TNGH+D++  +L+  + +  AIG +  K   F S +ER +LI+ +   
Sbjct: 4   RIALYAGSFDPLTNGHLDVLKASLAVADIVYAAIGIHPGKQPLF-SFEERVKLIETAAKA 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                  R+ V++F+GL ++ A+   A +++RGLRD TD DYEM+M  +N  + PE+ T+
Sbjct: 63  EFGSDGARIKVVAFDGLVIDAARKHGASIMIRGLRDGTDLDYEMQMAGMNETMAPELQTV 122

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
            L A  S R +T+TL+R + S+  +I  FVP  V   L
Sbjct: 123 FLPASPSVRTITATLVRQIASMGGNIRPFVPAAVAGAL 160


>gi|73666955|ref|YP_302971.1| CoA biosynthesis protein [Ehrlichia canis str. Jake]
 gi|72394096|gb|AAZ68373.1| Co enzyme A biosynthesis protein:Cytidyl transferase-related domain
           [Ehrlichia canis str. Jake]
          Length = 162

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 104/161 (64%), Gaps = 5/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y G+FDPIT GH+DII +A + V+ L+I +  N VK   F S + R+ELI+    
Sbjct: 1   MKVGIYPGTFDPITFGHIDIIKRAYNLVDKLIIGVAKNCVKNTIF-SAEVRAELIQ---- 55

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H I   +  V  I F+GL V  A++ +A VI+RGLR ++DFDYE +M+ VN  L P+I T
Sbjct: 56  HEIQLLNIAVETIIFDGLLVYFAQENNASVIIRGLRAVSDFDYEFQMSWVNYKLTPQIET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           I L A E +++++S+ ++ +  ++ DI +FVP  V  +LKN
Sbjct: 116 IFLPASEDTQFISSSFVKEIARLNGDINAFVPISVQKYLKN 156


>gi|209885352|ref|YP_002289209.1| pantetheine-phosphate adenylyltransferase [Oligotropha
           carboxidovorans OM5]
 gi|226709010|sp|B6JFC5|COAD_OLICO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|209873548|gb|ACI93344.1| pantetheine-phosphate adenylyltransferase [Oligotropha
           carboxidovorans OM5]
          Length = 165

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 98/161 (60%), Gaps = 1/161 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y GSFDP+TNGH+D++ QA + V+ L++AIG +  K   F S+ ER  +I +  
Sbjct: 1   MAHVALYPGSFDPVTNGHVDVVRQACTLVDRLIVAIGVHPGKAPLF-SVDERRAMIVEVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +   +  ++F+ L V  A+   A +++RGLRD TD DYEM++  +N+ L P + 
Sbjct: 60  SPLAATTGCAIECVTFDNLTVAAAEKSGATILIRGLRDGTDLDYEMQIAGMNQTLVPSVQ 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           TI + A  + R +T+TL+R + S+  D+++FVP  V   LK
Sbjct: 120 TIFIPASPTVRPITATLVRQIASMGGDVSAFVPKAVAARLK 160


>gi|269925127|ref|YP_003321750.1| pantetheine-phosphate adenylyltransferase [Thermobaculum terrenum
           ATCC BAA-798]
 gi|269788787|gb|ACZ40928.1| pantetheine-phosphate adenylyltransferase [Thermobaculum terrenum
           ATCC BAA-798]
          Length = 162

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 100/159 (62%), Gaps = 6/159 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY GSFDP+TNGH+D+I +A    + LV+A+G N  K   F S+++R +++++   H I
Sbjct: 5   AVYAGSFDPVTNGHLDLIERASPLFKKLVVAVGVNPRKPAAF-SLEDRLDMLRRVTAH-I 62

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V SF+GL V+ AK I A+ I+RGLR + DFDYEM+   +NR LCPEI T+ L
Sbjct: 63  PN----VEVDSFDGLLVDYAKSIGAKAIIRGLRAVADFDYEMQQVLMNRRLCPEIETVFL 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
                  +++S+L++ +  +   +   VP  V  +L+ +
Sbjct: 119 TTSTQYSFLSSSLVKEVSILGGSVEGLVPKEVEPYLEKL 157


>gi|322436433|ref|YP_004218645.1| pantetheine-phosphate adenylyltransferase [Acidobacterium sp.
           MP5ACTX9]
 gi|321164160|gb|ADW69865.1| pantetheine-phosphate adenylyltransferase [Acidobacterium sp.
           MP5ACTX9]
          Length = 169

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 98/158 (62%), Gaps = 5/158 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KA+Y G+FDP+TNGH+D+I +    V++LV+AI  NS K     ++ ER E+I +++   
Sbjct: 10  KAIYPGTFDPLTNGHLDLIARGAKIVDELVVAILRNSEKGTPLFTVPERLEMIAEAV--- 66

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                  VSV +F+GL V+ A+   A+ ++RG+R ++D++YE +M  +NR L PE+ T+ 
Sbjct: 67  --SGMPNVSVTTFDGLLVDFARQQGARAVLRGIRAISDYEYEFQMAMMNRKLDPELETLF 124

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +   E   YV+S LI+ +  +  D+TS VP  V   LK
Sbjct: 125 MMPAEKYTYVSSRLIKGVFRLGGDVTSLVPPLVVERLK 162


>gi|300714653|ref|YP_003739456.1| Phosphopantetheine adenylyltransferase [Erwinia billingiae Eb661]
 gi|299060489|emb|CAX57596.1| Phosphopantetheine adenylyltransferase [Erwinia billingiae Eb661]
          Length = 158

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 99/156 (63%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+DI+ +A    + +V+AI  +  K K   +++ER  L +Q +
Sbjct: 1   MSTKAIYPGTFDPMTNGHLDIVTRAALMFDRIVLAIAASPSK-KPMFTLEERVSLAQQVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V+ F  L  N A+D  A V+VRGLR ++DF+YEM++  +NR L PE+ 
Sbjct: 60  AH-LPN----VEVVGFSDLMANFARDQQANVLVRGLRAVSDFEYEMQLAHMNRHLLPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   E   +++S+L++ +     D+++F+P PV
Sbjct: 115 SVFLMPSEQYSFISSSLVKEVARHKGDVSAFLPQPV 150


>gi|299136481|ref|ZP_07029664.1| pantetheine-phosphate adenylyltransferase [Acidobacterium sp.
           MP5ACTX8]
 gi|298600996|gb|EFI57151.1| pantetheine-phosphate adenylyltransferase [Acidobacterium sp.
           MP5ACTX8]
          Length = 163

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 99/164 (60%), Gaps = 5/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D+I +    V+ LV+AI  NS K     +  ER E+I+++ 
Sbjct: 1   MQTKAIYPGTFDPLTNGHLDLIARGAKIVDQLVVAILRNSEKGAPLFTASEREEMIREAT 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     VSV +F+GL V+ A+   A+ ++RG+R ++D++YE +M  +NR L PE+ 
Sbjct: 61  LGL-----GNVSVATFDGLLVDFARSQGAKAVLRGIRAVSDYEYEFQMAMMNRKLDPELE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ +   E   YV+S LI+ +  +  D++S VP  V   LK+ V
Sbjct: 116 TLFMMPAEKYTYVSSRLIKGVFHLGGDVSSLVPPLVMDRLKSKV 159


>gi|251770982|gb|EES51566.1| phosphopantetheine adenylyltransferase [Leptospirillum
           ferrodiazotrophum]
          Length = 163

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 101/156 (64%), Gaps = 5/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+R+AVY G+FDP+TNGH+D++ + LS  +++VI +  +S +     S++ER  L+K++I
Sbjct: 1   MIRRAVYPGTFDPVTNGHLDMLHRGLSLFDEIVIGV-ADSPRKAPLFSLEERILLLKKTI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
               P    +VSV+ F  L V+  ++  A+ I+RG+R + DFDYE+RM  +N+ L  +I 
Sbjct: 60  ----PYPEPKVSVLGFSHLLVHFVRETGARCILRGVRAVADFDYELRMALINQNLDRDIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           T+ L   E+  ++TST IR +  +  D++ FVP PV
Sbjct: 116 TVFLMPSENYMFITSTAIREIAELGGDLSHFVPLPV 151


>gi|237728931|ref|ZP_04559412.1| phosphopantetheine adenylyltransferase [Citrobacter sp. 30_2]
 gi|283836013|ref|ZP_06355754.1| pantetheine-phosphate adenylyltransferase [Citrobacter youngae ATCC
           29220]
 gi|226909553|gb|EEH95471.1| phosphopantetheine adenylyltransferase [Citrobacter sp. 30_2]
 gi|291068195|gb|EFE06304.1| pantetheine-phosphate adenylyltransferase [Citrobacter youngae ATCC
           29220]
          Length = 159

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 97/156 (62%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A S  + +++AI  +  K K   +++ER EL +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATSMFDHVILAIAASPSK-KPMFTLEERVELAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHL-----GNVEVLGFSDLMANFARDNQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|331091195|ref|ZP_08340036.1| phosphopantetheine adenylyltransferase [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330404642|gb|EGG84181.1| phosphopantetheine adenylyltransferase [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 158

 Score =  124 bits (312), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 100/156 (64%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDP+T GHMDII ++   V++L++ +  N+ KT  F S++ER ++++++  
Sbjct: 1   MLRAIYPGSFDPVTLGHMDIIKRSCKIVDELIVGVLNNNAKTPLF-SVEERVKMLREATK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V V+ FEGL V+ AK I A+V++RGLR +TDF+YE++MT  N  L P++ T
Sbjct: 60  EL-----KNVKVVEFEGLLVDFAKAIDAKVVIRGLRAITDFEYELQMTQTNHKLEPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + L       +++ST ++ + +   DIT FVP+ V 
Sbjct: 115 LFLTTSIEYSFLSSTTVKEVAAFGGDITQFVPEVVV 150


>gi|305432213|ref|ZP_07401377.1| pantetheine-phosphate adenylyltransferase [Campylobacter coli JV20]
 gi|304444756|gb|EFM37405.1| pantetheine-phosphate adenylyltransferase [Campylobacter coli JV20]
          Length = 158

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 99/158 (62%), Gaps = 6/158 (3%)

Query: 6   VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIP 65
           +Y G+FDPITNGH+D+I +AL   + +++AI  NS   K   S+++R EL K +  H   
Sbjct: 4   LYPGTFDPITNGHLDVIKRALKIFDKVIVAIA-NSEHKKPCFSLEQRKELAKLATSHL-- 60

Query: 66  DSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALF 125
              N V +I+F+ L VNLAK++    IVRGLR ++DF+YE+++   N  L  EI TI L 
Sbjct: 61  ---NNVEIITFDNLLVNLAKELKVNTIVRGLRAVSDFEYELQIGYANHALWEEIETIYLM 117

Query: 126 AKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
               + +++S+++R + S   DI++ VP  +  FLK++
Sbjct: 118 PNLKNAFISSSIVRSIASHGGDISTLVPKEILPFLKDL 155


>gi|229827748|ref|ZP_04453817.1| hypothetical protein GCWU000182_03140 [Abiotrophia defectiva ATCC
           49176]
 gi|229787947|gb|EEP24061.1| hypothetical protein GCWU000182_03140 [Abiotrophia defectiva ATCC
           49176]
          Length = 159

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 104/152 (68%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KAVY GSFDP+TNGH+D+I +A + V++++I +  N  K+  F +++ER E++K+S+ 
Sbjct: 1   MVKAVYPGSFDPVTNGHIDVITRAAAIVDEVIIGVLVNKKKSP-FFTMEERFEMLKKSV- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V+V +FEG  V+ AK+  A++IVRGLR +TD++ EM++   NR +C +I T
Sbjct: 59  EDIPN----VTVKTFEGTTVDFAKENDARIIVRGLRAVTDYENEMQIAQTNRQICEDIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + L       +++ST+++ + S   D++S+VP
Sbjct: 115 LFLITSLEYAFLSSTIVKEIASFGKDVSSWVP 146


>gi|268315831|ref|YP_003289550.1| pantetheine-phosphate adenylyltransferase [Rhodothermus marinus DSM
           4252]
 gi|262333365|gb|ACY47162.1| pantetheine-phosphate adenylyltransferase [Rhodothermus marinus DSM
           4252]
          Length = 162

 Score =  124 bits (311), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 95/160 (59%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y GSFDP T GH+DI+ +AL   + + + +  N +  +   SI+ER ELI+Q   H
Sbjct: 4   RLALYPGSFDPFTYGHLDIVERALRIFDRVEVTVAVN-IGKEPLFSIEERCELIRQCTAH 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                 +RV V++FEGL V+ A+   A  +VRGLR ++DF+YE RM   NR L PE+ T+
Sbjct: 63  L-----DRVEVVAFEGLLVDHARARGATALVRGLRQVSDFEYEFRMAFANRRLYPELETV 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   E    ++S+++R +     D++ FVP PV   L+ 
Sbjct: 118 FLMTSEEYAMISSSIVREIHRWGGDVSLFVPPPVVEALRK 157


>gi|304391771|ref|ZP_07373713.1| pantetheine-phosphate adenylyltransferase [Ahrensia sp. R2A130]
 gi|303296000|gb|EFL90358.1| pantetheine-phosphate adenylyltransferase [Ahrensia sp. R2A130]
          Length = 163

 Score =  124 bits (311), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 98/160 (61%), Gaps = 4/160 (2%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA Y GSFDP T GH D++  AL   E +V+AIG +S K  G LS  ER ELI+ S+
Sbjct: 1   MTGKAFYPGSFDPFTLGHRDVLRAALRLSETVVVAIGRHSSKA-GMLSHDERRELIEASL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                +  +R+ V++F+ LA   A       +VRGLRD TD +YEM++  +N  L PE+ 
Sbjct: 60  ---TAEEVSRIEVVTFDDLATEAAVRHGCTTMVRGLRDGTDLNYEMQLAGMNGQLRPEVQ 116

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           T+ + +  ++R++T+TL+R + ++  ++  FVP+PV   L
Sbjct: 117 TVFVPSTPATRHITATLVRQVAAMGGNVAPFVPEPVAQRL 156


>gi|160872274|ref|ZP_02062406.1| pantetheine-phosphate adenylyltransferase [Rickettsiella grylli]
 gi|159121073|gb|EDP46411.1| pantetheine-phosphate adenylyltransferase [Rickettsiella grylli]
          Length = 167

 Score =  124 bits (311), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 98/153 (64%), Gaps = 6/153 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  K +Y G+FDPITNGH+D++ +A    E +++A+  N  KT  F S++ER  L K+++
Sbjct: 1   MKTKVIYPGTFDPITNGHLDLVQRAARLFETVIVAVAKNPPKTPLF-SLKERMCLAKEAL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   N V V  F+GL  + AK+  A++I+RGLR ++DF+YE ++ S+NR + P++ 
Sbjct: 60  IDL-----NNVHVEGFDGLLTHYAKEQHARIILRGLRAVSDFEYEFQLASMNRNMLPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           T+ L   E   ++++ L+R + S+  DITSFVP
Sbjct: 115 TLFLTPAEQHSFISAHLVREIASLGGDITSFVP 147


>gi|288942582|ref|YP_003444822.1| pantetheine-phosphate adenylyltransferase [Allochromatium vinosum
           DSM 180]
 gi|298286794|sp|P71154|COAD_ALLVD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|288897954|gb|ADC63790.1| pantetheine-phosphate adenylyltransferase [Allochromatium vinosum
           DSM 180]
          Length = 158

 Score =  124 bits (310), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 99/160 (61%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY G+FDPITNGH+D+I +A    + +V+A+  ++ KT  F S +ER EL++ S+ 
Sbjct: 1   MRTVVYPGTFDPITNGHVDLIHRAARLFDRVVVAVAADTGKTPVF-STEERVELVRGSV- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V ++ FEGL VN A+ +   VI+RGLR ++DF+YE ++  +NR + P+I T
Sbjct: 59  ----AGDPNVEILPFEGLLVNFARTLGVSVIMRGLRAVSDFEYEFQLAGMNRRMAPDIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L   E   Y++S+L+R +  +  D+++FV   V   L+
Sbjct: 115 LFLTPAEQYAYISSSLVREIARLRGDVSTFVTPTVQAALR 154


>gi|1518926|gb|AAC44332.1| protein thought to participate in the synthesis of the
           lipopolysaccharide core [Allochromatium vinosum DSM 180]
          Length = 169

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 99/160 (61%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY G+FDPITNGH+D+I +A    + +V+A+  ++ KT  F S +ER EL++ S+ 
Sbjct: 1   MRTVVYPGTFDPITNGHVDLIHRAARLFDRVVVAVAADTGKTPVF-STEERVELVRGSV- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V ++ FEGL VN A+ +   VI+RGLR ++DF+YE ++  +NR + P+I T
Sbjct: 59  ----AGDPNVEILPFEGLLVNFARTLGVSVIMRGLRAVSDFEYEFQLAGMNRRMAPDIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L   E   Y++S+L+R +  +  D+++FV   V   L+
Sbjct: 115 LFLTPAEQYAYISSSLVREIARLRGDVSTFVTPTVQAALR 154


>gi|27379804|ref|NP_771333.1| phosphopantetheine adenylyltransferase [Bradyrhizobium japonicum
           USDA 110]
 gi|31563017|sp|Q89L55|COAD_BRAJA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|27352957|dbj|BAC49958.1| phosphopantetheine adenylyltransferase [Bradyrhizobium japonicum
           USDA 110]
          Length = 165

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 95/161 (59%), Gaps = 1/161 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A Y GSFDPITNGH+D++  A+   + LV+AIG +  K K   S +ER  +++   
Sbjct: 1   MPRIAFYPGSFDPITNGHLDVVRHAVPLCDRLVVAIGVHPGK-KPLFSTEERLRMLEDVC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +   +  ++F+ L+V  A+   A +++RGLRD TD DYEM++  +N  + PE+ 
Sbjct: 60  GPVATQAGCVLEAVTFDDLSVTAARKHGATIMIRGLRDGTDLDYEMQLAGMNEAMAPEVH 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ L A    R +T+TL+R +  +  D+++FVP  V   LK
Sbjct: 120 TVFLPASPMVRPITATLVRQIAGMGGDVSTFVPPLVASLLK 160


>gi|78189401|ref|YP_379739.1| coenzyme A biosynthesis protein [Chlorobium chlorochromatii CaD3]
 gi|123579542|sp|Q3AQM9|COAD_CHLCH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|78171600|gb|ABB28696.1| Coenzyme A biosynthesis protein [Chlorobium chlorochromatii CaD3]
          Length = 164

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 98/152 (64%), Gaps = 5/152 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDP TNGH+D++ +AL+  E++++ I  NS K +   SI+ER  + +Q +
Sbjct: 1   MKQKAIYPGTFDPFTNGHLDVLERALTIFEEVIVVIAENSQK-RALFSIEERKMMTEQIV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            +       RV V++  GL  N A+D+ A+ IVRG+R + DF+YE +M+ +NR LCPEI 
Sbjct: 60  SNV---DGARVEVLA-HGLLANYARDVGARAIVRGVRQVKDFEYEFQMSLLNRQLCPEIT 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           T+ L       YV S++I+ +  +  D+++FV
Sbjct: 116 TVFLMPNVKYTYVASSIIKEVAMLGGDVSNFV 147


>gi|225572197|ref|ZP_03781061.1| hypothetical protein RUMHYD_00491 [Blautia hydrogenotrophica DSM
           10507]
 gi|225040369|gb|EEG50615.1| hypothetical protein RUMHYD_00491 [Blautia hydrogenotrophica DSM
           10507]
          Length = 175

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 100/152 (65%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KAVY GSFDP+T GH+D+I++     +++++ +  NS K+  F S++ER  ++K++  
Sbjct: 13  MSKAVYPGSFDPVTYGHLDVIVRGSKSFDEVIVGVLQNSAKSPLF-SVEERVNILKEATK 71

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P+    V + +F GL+VN A++  A VI+RGLR +TDF+YE++M   NR L P++ T
Sbjct: 72  E-LPN----VKICAFNGLSVNFAREHQANVILRGLRAITDFEYELQMAQTNRVLAPDVDT 126

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + L       Y++ST+++ + S   DI++FVP
Sbjct: 127 VFLTTGLKYAYLSSTIVKEVASFGGDISNFVP 158


>gi|82779124|ref|YP_405473.1| phosphopantetheine adenylyltransferase [Shigella dysenteriae Sd197]
 gi|309784389|ref|ZP_07679028.1| pantetheine-phosphate adenylyltransferase [Shigella dysenteriae
           1617]
 gi|123561127|sp|Q329M3|COAD_SHIDS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|81243272|gb|ABB63982.1| putative enzyme of LPS biosynthesis [Shigella dysenteriae Sd197]
 gi|308927896|gb|EFP73364.1| pantetheine-phosphate adenylyltransferase [Shigella dysenteriae
           1617]
          Length = 159

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 96/156 (61%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER EL +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK-KTMFTLEERVELAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|326790888|ref|YP_004308709.1| phosphopantetheine adenylyltransferase [Clostridium lentocellum DSM
           5427]
 gi|326541652|gb|ADZ83511.1| Phosphopantetheine adenylyltransferase [Clostridium lentocellum DSM
           5427]
          Length = 162

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 93/160 (58%), Gaps = 5/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y GSFDP+TNGH+DII +A   V++L++A+  N  K  G LS++ER  ++K++  
Sbjct: 1   MNRGIYPGSFDPMTNGHLDIITRAAKIVDELIVAVLLNPKKGTGLLSVEERIAVMKEATK 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H        V + SF GL V+ A    A+VI+RGLR+ +DF+ EM M  +N  L   + T
Sbjct: 61  HL-----ENVKIDSFSGLLVDFAHQKQARVIIRGLRNGSDFEQEMNMAQINSSLLKGLET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L       Y++ST +R ++    +  +FVP  V   LK
Sbjct: 116 VFLMTAPEHAYMSSTAVREIVCFGGEYEAFVPPAVADKLK 155


>gi|26250280|ref|NP_756320.1| phosphopantetheine adenylyltransferase [Escherichia coli CFT073]
 gi|91213150|ref|YP_543136.1| phosphopantetheine adenylyltransferase [Escherichia coli UTI89]
 gi|110643875|ref|YP_671605.1| phosphopantetheine adenylyltransferase [Escherichia coli 536]
 gi|191170409|ref|ZP_03031962.1| pantetheine-phosphate adenylyltransferase [Escherichia coli F11]
 gi|218560706|ref|YP_002393619.1| phosphopantetheine adenylyltransferase [Escherichia coli S88]
 gi|218691918|ref|YP_002400130.1| phosphopantetheine adenylyltransferase [Escherichia coli ED1a]
 gi|218707268|ref|YP_002414787.1| phosphopantetheine adenylyltransferase [Escherichia coli UMN026]
 gi|227883802|ref|ZP_04001607.1| phosphopantetheine adenylyltransferase [Escherichia coli 83972]
 gi|237703404|ref|ZP_04533885.1| phosphopantetheine adenylyltransferase [Escherichia sp. 3_2_53FAA]
 gi|254038833|ref|ZP_04872885.1| phosphopantetheine adenylyltransferase [Escherichia sp. 1_1_43]
 gi|256025636|ref|ZP_05439501.1| phosphopantetheine adenylyltransferase [Escherichia sp. 4_1_40B]
 gi|293407257|ref|ZP_06651181.1| coaD [Escherichia coli FVEC1412]
 gi|293413068|ref|ZP_06655736.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B354]
 gi|293417095|ref|ZP_06659722.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B185]
 gi|298383003|ref|ZP_06992598.1| phosphopantetheine adenylyltransferase [Escherichia coli FVEC1302]
 gi|300898567|ref|ZP_07116899.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           198-1]
 gi|300948033|ref|ZP_07162173.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           116-1]
 gi|300954472|ref|ZP_07166922.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           175-1]
 gi|300983559|ref|ZP_07176651.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           200-1]
 gi|300984966|ref|ZP_07177218.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           45-1]
 gi|301018963|ref|ZP_07183186.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           69-1]
 gi|301028393|ref|ZP_07191639.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           196-1]
 gi|301047423|ref|ZP_07194503.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           185-1]
 gi|301644300|ref|ZP_07244302.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           146-1]
 gi|306816018|ref|ZP_07450156.1| phosphopantetheine adenylyltransferase [Escherichia coli NC101]
 gi|307140332|ref|ZP_07499688.1| phosphopantetheine adenylyltransferase [Escherichia coli H736]
 gi|331649449|ref|ZP_08350535.1| pantetheine-phosphate adenylyltransferase [Escherichia coli M605]
 gi|331659954|ref|ZP_08360892.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA206]
 gi|331665259|ref|ZP_08366160.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA143]
 gi|29427784|sp|Q8FC88|COAD_ECOL6 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|122421891|sp|Q1R4V9|COAD_ECOUT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123048707|sp|Q0TBH5|COAD_ECOL5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226706694|sp|B7MFJ5|COAD_ECO45 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226706697|sp|B7NET8|COAD_ECOLU RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254764154|sp|B7N1T5|COAD_ECO81 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|26110710|gb|AAN82894.1|AE016769_9 Phosphopantetheine adenylyltransferase [Escherichia coli CFT073]
 gi|91074724|gb|ABE09605.1| phosphopantetheine adenylyltransferase [Escherichia coli UTI89]
 gi|110345467|gb|ABG71704.1| phosphopantetheine adenylyltransferase [Escherichia coli 536]
 gi|190909217|gb|EDV68803.1| pantetheine-phosphate adenylyltransferase [Escherichia coli F11]
 gi|218367475|emb|CAR05257.1| pantetheine-phosphate adenylyltransferase [Escherichia coli S88]
 gi|218429482|emb|CAR10305.1| pantetheine-phosphate adenylyltransferase [Escherichia coli ED1a]
 gi|218434365|emb|CAR15289.1| pantetheine-phosphate adenylyltransferase [Escherichia coli UMN026]
 gi|222035342|emb|CAP78087.1| Phosphopantetheine adenylyltransferase [Escherichia coli LF82]
 gi|226838798|gb|EEH70825.1| phosphopantetheine adenylyltransferase [Escherichia sp. 1_1_43]
 gi|226902668|gb|EEH88927.1| phosphopantetheine adenylyltransferase [Escherichia sp. 3_2_53FAA]
 gi|227839080|gb|EEJ49546.1| phosphopantetheine adenylyltransferase [Escherichia coli 83972]
 gi|291426068|gb|EFE99102.1| coaD [Escherichia coli FVEC1412]
 gi|291431126|gb|EFF04119.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B185]
 gi|291468715|gb|EFF11208.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B354]
 gi|294493453|gb|ADE92209.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           IHE3034]
 gi|298276839|gb|EFI18357.1| phosphopantetheine adenylyltransferase [Escherichia coli FVEC1302]
 gi|299878504|gb|EFI86715.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           196-1]
 gi|300300697|gb|EFJ57082.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           185-1]
 gi|300306883|gb|EFJ61403.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           200-1]
 gi|300318551|gb|EFJ68335.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           175-1]
 gi|300357787|gb|EFJ73657.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           198-1]
 gi|300399457|gb|EFJ82995.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           69-1]
 gi|300408246|gb|EFJ91784.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           45-1]
 gi|300452404|gb|EFK16024.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           116-1]
 gi|301077338|gb|EFK92144.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           146-1]
 gi|305850414|gb|EFM50871.1| phosphopantetheine adenylyltransferase [Escherichia coli NC101]
 gi|307555733|gb|ADN48508.1| phosphopantetheine adenylyltransferase [Escherichia coli ABU 83972]
 gi|307628707|gb|ADN73011.1| phosphopantetheine adenylyltransferase [Escherichia coli UM146]
 gi|309704036|emb|CBJ03382.1| phosphopantetheine adenylyltransferase [Escherichia coli ETEC
           H10407]
 gi|312948195|gb|ADR29022.1| phosphopantetheine adenylyltransferase [Escherichia coli O83:H1
           str. NRG 857C]
 gi|315285379|gb|EFU44824.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           110-3]
 gi|315292971|gb|EFU52323.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           153-1]
 gi|315297029|gb|EFU56309.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           16-3]
 gi|315618663|gb|EFU99249.1| pantetheine-phosphate adenylyltransferase [Escherichia coli 3431]
 gi|320193859|gb|EFW68492.1| Phosphopantetheine adenylyltransferase [Escherichia coli WV_060327]
 gi|323934821|gb|EGB31203.1| pantetheine-phosphate adenylyltransferase [Escherichia coli E1520]
 gi|323939607|gb|EGB35813.1| pantetheine-phosphate adenylyltransferase [Escherichia coli E482]
 gi|323949873|gb|EGB45757.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H252]
 gi|323954826|gb|EGB50606.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H263]
 gi|324008139|gb|EGB77358.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           57-2]
 gi|324012606|gb|EGB81825.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           60-1]
 gi|330909696|gb|EGH38210.1| phosphopantetheine adenylyltransferase [Escherichia coli AA86]
 gi|331041947|gb|EGI14091.1| pantetheine-phosphate adenylyltransferase [Escherichia coli M605]
 gi|331053169|gb|EGI25202.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA206]
 gi|331057769|gb|EGI29755.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA143]
          Length = 159

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 96/156 (61%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER EL +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK-KPMFTLEERVELAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|158423950|ref|YP_001525242.1| coenzyme A biosynthesis protein [Azorhizobium caulinodans ORS 571]
 gi|158330839|dbj|BAF88324.1| coenzyme A biosynthesis protein [Azorhizobium caulinodans ORS 571]
          Length = 173

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 92/159 (57%), Gaps = 1/159 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y GSFDP TNGH+D++  A    + LV+A+G +  KT  F +  ER  ++K     
Sbjct: 9   RVAIYAGSFDPPTNGHLDVVRSASRLADHLVLAVGIHPGKTPLF-TADERLAMLKDICGP 67

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
              +    +  I+F  L VN A+ + A +++RGLRD TD DYEM+M  +N  + PEI T+
Sbjct: 68  IAQEEGATLEAITFGDLVVNTARRVGATLLIRGLRDGTDLDYEMQMAGMNGTMAPEIQTV 127

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            L A    R +T+TL+R + ++  ++  FVP  V   LK
Sbjct: 128 FLPASPRVRPITATLVRQIAAMGGEVAPFVPAEVLARLK 166


>gi|54296578|ref|YP_122947.1| phosphopantetheine adenylyltransferase [Legionella pneumophila str.
           Paris]
 gi|61212503|sp|Q5X7J6|COAD_LEGPA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|53750363|emb|CAH11757.1| hypothetical protein lpp0609 [Legionella pneumophila str. Paris]
          Length = 168

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 102/161 (63%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDP+TNGH+DII +A +   +L++A+  N  K + +LS + R  L+++S+
Sbjct: 8   MKQKAIYPGTFDPVTNGHIDIITRASTIFPELIVAVASNKNK-RPYLSWETRISLLEESV 66

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F+ L ++   + SA +I+RGLR ++DF+YE ++  +NR L  ++ 
Sbjct: 67  GHL-----TGVRVVGFDNLLIDFVLEQSAGIILRGLRAVSDFEYEFQLAGMNRKLSKKVE 121

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ L   E   Y++STL+R + +++ DI+ FVP  V   LK
Sbjct: 122 TLFLTPAEHLMYISSTLVREIAALNGDISQFVPPNVVRELK 162


>gi|148244500|ref|YP_001219194.1| phosphopantetheine adenylyltransferase [Candidatus Vesicomyosocius
           okutanii HA]
 gi|166216617|sp|A5CX55|COAD_VESOH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|146326327|dbj|BAF61470.1| pantetheine-phosphate adenylyltransferase [Candidatus
           Vesicomyosocius okutanii HA]
          Length = 158

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 103/162 (63%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y GSFDPITNGH+D+I +A    ++++I I  NS K K FLSI +R + I  ++
Sbjct: 1   MKKIAIYPGSFDPITNGHVDLIKRASKLFDEIIIGISQNS-KKKAFLSINDRIDTINTAL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   N + ++SF+ L V+ A   +AQVI+RGLR ++DF+YE +++ +N+ L P I 
Sbjct: 60  -----KDINNIRILSFDTLLVDFASLKNAQVILRGLRAISDFEYEYQLSGINKHLNPNIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ +   E    ++S+LI+ +I++  DI+ FVP  V   LK+
Sbjct: 115 TLFMTPTEQYANISSSLIKEIIALGGDISVFVPASVKTLLKH 156


>gi|322516159|ref|ZP_08069092.1| pantetheine-phosphate adenylyltransferase [Streptococcus
           vestibularis ATCC 49124]
 gi|322125335|gb|EFX96690.1| pantetheine-phosphate adenylyltransferase [Streptococcus
           vestibularis ATCC 49124]
          Length = 165

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 95/157 (60%), Gaps = 5/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A++TGSFDPITNGHMDII +A  F ++L I +  N  K +GF  +  R  ++++  
Sbjct: 1   MTKIAMFTGSFDPITNGHMDIIARASKFFDELYIGLFYNKNK-QGFWDVATRKRILEE-- 57

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              + D  N   + + + LAV++AKD+    +VRGLR+ TDFDYE  M   N+ L PE+ 
Sbjct: 58  --VVADLPNVKVITAHDSLAVDVAKDLGVTYLVRGLRNATDFDYEANMDYFNKGLAPELE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           T+ L A      V+S+ +R LI  + +I+S+VP  V 
Sbjct: 116 TVYLIASHEVTPVSSSRVRELIYFEGNISSYVPQAVV 152


>gi|332084814|gb|EGI89997.1| pantetheine-phosphate adenylyltransferase [Shigella boydii 5216-82]
          Length = 159

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 95/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  N  K K   +++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAANPSK-KPMFTLEERVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|215488913|ref|YP_002331344.1| phosphopantetheine adenylyltransferase [Escherichia coli O127:H6
           str. E2348/69]
 gi|312968025|ref|ZP_07782236.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           2362-75]
 gi|254764152|sp|B7ULI9|COAD_ECO27 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|215266985|emb|CAS11430.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O127:H6
           str. E2348/69]
 gi|312287284|gb|EFR15193.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           2362-75]
          Length = 159

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 96/156 (61%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER EL +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK-KPMFTLEERVELAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHL-----GSVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|168214205|ref|ZP_02639830.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           CPE str. F4969]
 gi|170714275|gb|EDT26457.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           CPE str. F4969]
          Length = 164

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/166 (38%), Positives = 101/166 (60%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY GSFDPIT GH+D+I +A S  + +++A+  N +  KG  SI+ER  LI++ + 
Sbjct: 1   MRVGVYPGSFDPITKGHLDLIERAASKFDKVIVAVLIN-INKKGMFSIEERVNLIEKCVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +     N V V SF GL ++  +   A VI++GLR +TDF+YE +M  +NR L  E+ T
Sbjct: 60  KY-----NNVEVKSFNGLLIDFVRKEKADVIIKGLRSVTDFEYEFQMALMNRELANEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           I +    +  Y++S+ I+ + S + +I +FVP  +   L+  +ISL
Sbjct: 115 IFMVTSPNYSYISSSAIKQIASFNGEIKNFVPKEIVEDLEERIISL 160


>gi|40063042|gb|AAR37898.1| pantetheine-phosphate adenylyltransferase [uncultured marine
           bacterium 560]
          Length = 160

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 102/158 (64%), Gaps = 6/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y GSFDPITNGH+D+I +A    ++++IAI  N+ KT   L I +R E +++SI    
Sbjct: 5   AIYPGSFDPITNGHIDLIHRACKLFDEVIIAITQNANKT-SLLPINQRIEAVEKSI---- 59

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
             S +   V+SF  L V+ A+D +AQ+I+RGLR ++DF+YE +++ +N+ L   I T+ +
Sbjct: 60  -TSISNTRVLSFNSLLVDFARDHNAQIIIRGLRAVSDFEYEFQLSGMNKRLNHRIETLFM 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
              E    ++S+L+R + S+  DI++FVP PV   L N
Sbjct: 119 TPSEEFANISSSLVREIFSLGGDISAFVPAPVEKILHN 156


>gi|57167763|ref|ZP_00366903.1| pantetheine-phosphate adenylyltransferase [Campylobacter coli
           RM2228]
 gi|57020885|gb|EAL57549.1| pantetheine-phosphate adenylyltransferase [Campylobacter coli
           RM2228]
          Length = 158

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 99/158 (62%), Gaps = 6/158 (3%)

Query: 6   VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIP 65
           +Y G+FDPITNGH+D+I +AL   + +++AI  NS   K   S+++R EL K +  H   
Sbjct: 4   LYPGTFDPITNGHLDVIKRALKIFDKVIVAIA-NSEHKKPCFSLEQRKELAKLATSHL-- 60

Query: 66  DSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALF 125
              N V +I+F+ L V+LAK++    IVRGLR ++DF+YE+++   N  L  EI TI L 
Sbjct: 61  ---NNVEIITFDNLLVDLAKELKVNTIVRGLRAVSDFEYELQIGYANHALWEEIETIYLM 117

Query: 126 AKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
               + +++S+++R + S   DI++ VP  +  FLK++
Sbjct: 118 PNLKNAFISSSIVRSIASHGGDISTLVPKEILPFLKDL 155


>gi|281180680|dbj|BAI57010.1| phosphopantetheine adenylyltransferase [Escherichia coli SE15]
          Length = 159

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 96/156 (61%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER EL +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRASQMFDHVILAIAASPSK-KPMFTLEERVELAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHL-----ENVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|126700176|ref|YP_001089073.1| phosphopantetheine adenylyltransferase [Clostridium difficile 630]
 gi|254976147|ref|ZP_05272619.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           QCD-66c26]
 gi|255093537|ref|ZP_05323015.1| phosphopantetheine adenylyltransferase [Clostridium difficile CIP
           107932]
 gi|255101720|ref|ZP_05330697.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           QCD-63q42]
 gi|255307589|ref|ZP_05351760.1| phosphopantetheine adenylyltransferase [Clostridium difficile ATCC
           43255]
 gi|255315280|ref|ZP_05356863.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           QCD-76w55]
 gi|255517948|ref|ZP_05385624.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           QCD-97b34]
 gi|255651064|ref|ZP_05397966.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           QCD-37x79]
 gi|255656536|ref|ZP_05401945.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           QCD-23m63]
 gi|260684130|ref|YP_003215415.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           CD196]
 gi|260687789|ref|YP_003218923.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           R20291]
 gi|296450013|ref|ZP_06891777.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           NAP08]
 gi|296878394|ref|ZP_06902402.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           NAP07]
 gi|306520920|ref|ZP_07407267.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           QCD-32g58]
 gi|115251613|emb|CAJ69446.1| Phosphopantetheine adenylyltransferase (Pantetheine-phosphate
           adenylyltransferase) [Clostridium difficile]
 gi|260210293|emb|CBA64591.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           CD196]
 gi|260213806|emb|CBE05771.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           R20291]
 gi|296261283|gb|EFH08114.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           NAP08]
 gi|296430692|gb|EFH16531.1| phosphopantetheine adenylyltransferase [Clostridium difficile
           NAP07]
          Length = 165

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 97/159 (61%), Gaps = 6/159 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           RKA++ GSFDPITNGH+DII +A    ++L I +  N+   KG  S  ER +LI++S  H
Sbjct: 6   RKAIFAGSFDPITNGHLDIICRASKLFDELQIGV-LNNPNKKGLFSFDERVKLIEKSTSH 64

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                 N + V++F+GL +N  ++     +VRG+R   D DYE++M  +NR L P+I TI
Sbjct: 65  L-----NNIKVVTFDGLLINYCQENGIGALVRGVRSGADVDYELQMAHMNRELNPDIETI 119

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            L +     +++S+LI+ ++  DADI + VP  V   LK
Sbjct: 120 ILPSCTKYSFISSSLIKEVLLFDADIKNLVPKIVLEELK 158


>gi|226325133|ref|ZP_03800651.1| hypothetical protein COPCOM_02925 [Coprococcus comes ATCC 27758]
 gi|225206481|gb|EEG88835.1| hypothetical protein COPCOM_02925 [Coprococcus comes ATCC 27758]
          Length = 159

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 100/161 (62%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDP+T GH+DII ++   V++L+I +  N  KT  F S++ER +++K+   
Sbjct: 1   MIRAIYPGSFDPVTFGHLDIITRSSKIVDELIIGVLMNKAKTPLF-SVEERVKMLKE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +      V V+ F+GL V  A+   A++++RGLR +TDF+YE++M+  N  L PE+ T
Sbjct: 57  --VTKDLGNVKVVPFDGLLVEFARQQKARLVIRGLRAITDFEYEIQMSQTNHKLEPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L       Y++ST++R + +   DI+ FVP+ V   +K 
Sbjct: 115 MFLTTNLKYSYLSSTIVREVAAFGGDISQFVPETVAKSIKE 155


>gi|157963918|ref|YP_001503952.1| phosphopantetheine adenylyltransferase [Shewanella pealeana ATCC
           700345]
 gi|189082590|sp|A8HA30|COAD_SHEPA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|157848918|gb|ABV89417.1| pantetheine-phosphate adenylyltransferase [Shewanella pealeana ATCC
           700345]
          Length = 159

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 96/152 (63%), Gaps = 6/152 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDP+TNGH D+I +A +  E ++I I  N  K   F ++ ER EL+K   
Sbjct: 1   MHKRAIYPGTFDPVTNGHADLIERAANLFEHVIIGIAANPSKQPRF-TLAERVELLKTVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AKD +A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----DNVEVVGFSGLLVDFAKDQNASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           ++ L   E + +++STL++ +     D++ FV
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFV 146


>gi|323189458|gb|EFZ74739.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           RN587/1]
          Length = 159

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 96/156 (61%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER EL +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRASQMFDHVILAIAASPSK-KPMFTLEERVELAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  SHL-----ENVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|94986726|ref|YP_594659.1| phosphopantetheine adenylyltransferase [Lawsonia intracellularis
           PHE/MN1-00]
 gi|166216556|sp|Q1MRN8|COAD_LAWIP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|94730975|emb|CAJ54338.1| phosphopantetheine adenylyltransferase [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 172

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 102/160 (63%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           +R A+Y G+FDP+TNGH+ II +A    + ++IA+  +S K K   SI+ER  +I  + F
Sbjct: 6   IRLAIYPGTFDPLTNGHISIIHRAKHLFDKIIIAVAQDSGK-KPLFSIEERVSMINTTFF 64

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                S + V V +F GL V+  +  +A+ I+RGLR ++DF+YE + + +NR LCPEI T
Sbjct: 65  -----SDHMVDVENFSGLLVDYVEKKNAKTILRGLRAVSDFEYEFQTSLMNRKLCPEIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           I L +     Y++ST+++ + S+  D+T FVP+ V + LK
Sbjct: 120 IFLISDYKWLYISSTVVKTVASLGGDVTDFVPENVLICLK 159


>gi|290477291|ref|YP_003470212.1| CMP-deoxy-D-manno-octulosonate-lipid A transferase
           (phosphopantetheine adenylyltransferase) [Xenorhabdus
           bovienii SS-2004]
 gi|289176645|emb|CBJ83454.1| CMP-deoxy-D-manno-octulosonate-lipid A transferase
           (phosphopantetheine adenylyltransferase) [Xenorhabdus
           bovienii SS-2004]
          Length = 160

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 99/157 (63%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDPIT+GH+DI+ +A +  + +++AI  NS +     +++ER+ L K+  
Sbjct: 1   MKKKAIYPGTFDPITHGHLDIVTRAANMFDHVLLAI-ANSDRKNPMFNLEERTALAKEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N AK   A +++RG+R ++DF+YE ++ ++NR   PE+ 
Sbjct: 60  AHL-----KNVEVVGFSELMANFAKKQQATILIRGVRSVSDFEYEWQLANMNRHFMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   ++  +V+S+LI+ +   D D+++F+P+PV 
Sbjct: 115 SVFLLPSQNLSFVSSSLIKDVARHDGDVSTFLPEPVA 151


>gi|225378033|ref|ZP_03755254.1| hypothetical protein ROSEINA2194_03693 [Roseburia inulinivorans DSM
           16841]
 gi|225210034|gb|EEG92388.1| hypothetical protein ROSEINA2194_03693 [Roseburia inulinivorans DSM
           16841]
          Length = 161

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 94/152 (61%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+KA+Y GSFDP+T GH+DII +A   V++LV+ +  NS K   F S+ ER  +I++   
Sbjct: 1   MKKAIYPGSFDPLTLGHIDIIKRASGIVDELVVGVLNNSAKNSLF-SLDERVSMIEE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D  N VSV SF+GL V   K I A +IVRGLR +TDF+YE+++   N    PE+ T
Sbjct: 57  -MTKDLPN-VSVTSFDGLLVEHMKQIGATIIVRGLRAVTDFEYELQIAQTNHVESPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           I L A     Y++ST+++   S   DI+ FVP
Sbjct: 115 IFLTASLQYSYLSSTIVKEFASYGGDISKFVP 146


>gi|84386873|ref|ZP_00989897.1| phosphopantetheine adenylyltransferase [Vibrio splendidus 12B01]
 gi|84378163|gb|EAP95022.1| phosphopantetheine adenylyltransferase [Vibrio splendidus 12B01]
          Length = 160

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/156 (39%), Positives = 94/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +K +Y G+FDPITNGH+DII +A    ++++I +  +  K K   S+ ER ELI+Q+ 
Sbjct: 1   MTKKVIYPGTFDPITNGHLDIIERAAKMFDEVLIGVAASPSK-KTMFSLPERVELIEQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      N  SV  F GL V+ AK+  A +++RGLR   DF+YE  +TS+ R L P I 
Sbjct: 60  SHI-----NNTSVAGFSGLLVDFAKEQDANILIRGLRTTVDFEYEFGLTSMYRKLLPGIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   E   +++ST++R +     DI+ FVP+ V
Sbjct: 115 SVFLTPSEEYAFLSSTIVREVAIHGGDISGFVPNTV 150


>gi|307609351|emb|CBW98837.1| hypothetical protein LPW_06271 [Legionella pneumophila 130b]
          Length = 163

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 102/161 (63%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDP+TNGH+DII +A +   +L++A+  N  K + +LS + R  L+++S+
Sbjct: 1   MKQKAIYPGTFDPVTNGHIDIITRASTIFPELIVAVASNKNK-RPYLSWESRISLLEESV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F+ L ++   + +A +I+RGLR ++DF+YE ++  +NR L  ++ 
Sbjct: 60  GHL-----TGVRVVGFDNLLIDFVLEQNAGIILRGLRAVSDFEYEFQLAGMNRKLSKKVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ L   E   Y++STL+R + +++ DI+ FVP  V   LK
Sbjct: 115 TLFLTPAEHLMYISSTLVREIAALNGDISQFVPPNVVRELK 155


>gi|168698838|ref|ZP_02731115.1| phosphopantetheine adenylyltransferase [Gemmata obscuriglobus UQM
           2246]
          Length = 167

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 99/160 (61%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVYTG+FDP+  GH+D+I +     + L++ +G N  K K   +I+ER  LI +++  
Sbjct: 9   RIAVYTGTFDPVHYGHLDVIERGSKLFDKLIVGVGINPDK-KTLFTIEERVRLI-ETVAA 66

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
             P+    V V SFEGLAV   +D  A++++RGLR ++D +YE  M+ +N    P I T+
Sbjct: 67  GWPN----VEVQSFEGLAVRFVRDSGARIMLRGLRTLSDMEYEFTMSLMNLAQDPAIETL 122

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L AKE   +V+S+L+R + ++D ++T F+P PV   LK 
Sbjct: 123 FLMAKEEFSHVSSSLLRQIAALDGNLTKFLPQPVLDALKE 162


>gi|154483593|ref|ZP_02026041.1| hypothetical protein EUBVEN_01297 [Eubacterium ventriosum ATCC
           27560]
 gi|149735503|gb|EDM51389.1| hypothetical protein EUBVEN_01297 [Eubacterium ventriosum ATCC
           27560]
          Length = 165

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 67/156 (42%), Positives = 100/156 (64%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+A+Y GSFDP+T GH+DII +A   V++LV+ +  N+ KT  F S++ R +++++ + 
Sbjct: 1   MRRAIYPGSFDPVTFGHLDIIRRASKIVDELVVGVLNNNSKTPLF-SVENRVKMLEE-VV 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V V+SFEGL V+ AK I AQ+IVRGLR +TDF+YE++M+  N  L   I T
Sbjct: 59  RDIPN----VKVMSFEGLLVDFAKKIDAQIIVRGLRAVTDFEYELQMSQTNSILDDNIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I         Y++S+ +R      ADI+ FVP+ V 
Sbjct: 115 IFFTTSLEYAYLSSSTVREAAFYGADISRFVPESVV 150


>gi|228477097|ref|ZP_04061735.1| pantetheine-phosphate adenylyltransferase [Streptococcus salivarius
           SK126]
 gi|228251116|gb|EEK10287.1| pantetheine-phosphate adenylyltransferase [Streptococcus salivarius
           SK126]
          Length = 165

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 95/157 (60%), Gaps = 5/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A++TGSFDPITNGHMDII +A    ++L I +  N  K +GF  ++ R  ++++  
Sbjct: 1   MTKIAMFTGSFDPITNGHMDIIARASKLFDELYIGLFYNKNK-QGFWDVETRKRILEE-- 57

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              + D  N   + + + LAV++A+D+    +VRGLR+ TDFDYE  M   N+ L PE+ 
Sbjct: 58  --VVADLPNVKIITAHDSLAVDVARDLGVTYLVRGLRNATDFDYEANMDYFNKGLAPELE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           T+ L A      V+S+ +R LI  + DI+S+VP  V 
Sbjct: 116 TVYLIASHKVTPVSSSRVRELIYFEGDISSYVPQAVV 152


>gi|54293539|ref|YP_125954.1| hypothetical protein lpl0590 [Legionella pneumophila str. Lens]
 gi|296106136|ref|YP_003617836.1| pantetheine-phosphate adenylyltransferase [Legionella pneumophila
           2300/99 Alcoy]
 gi|61212501|sp|Q5WYZ4|COAD_LEGPL RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|61212514|sp|Q5ZY26|COAD_LEGPH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|53753371|emb|CAH14821.1| hypothetical protein lpl0590 [Legionella pneumophila str. Lens]
 gi|295648037|gb|ADG23884.1| pantetheine-phosphate adenylyltransferase [Legionella pneumophila
           2300/99 Alcoy]
          Length = 170

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 102/161 (63%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDP+TNGH+DII +A +   +L++A+  N  K + +LS + R  L+++S+
Sbjct: 8   MKQKAIYPGTFDPVTNGHIDIITRASTIFPELIVAVASNKNK-RPYLSWESRISLLEESV 66

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F+ L ++   + +A +I+RGLR ++DF+YE ++  +NR L  ++ 
Sbjct: 67  GHL-----TGVRVVGFDNLLIDFVLEQNAGIILRGLRAVSDFEYEFQLAGMNRKLSKKVE 121

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ L   E   Y++STL+R + +++ DI+ FVP  V   LK
Sbjct: 122 TLFLTPAEHLMYISSTLVREIAALNGDISQFVPPNVVRELK 162


>gi|18310711|ref|NP_562645.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           str. 13]
 gi|168207255|ref|ZP_02633260.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           E str. JGS1987]
 gi|168210639|ref|ZP_02636264.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           B str. ATCC 3626]
 gi|168217015|ref|ZP_02642640.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           NCTC 8239]
 gi|169342737|ref|ZP_02863777.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           C str. JGS1495]
 gi|182625825|ref|ZP_02953591.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           D str. JGS1721]
 gi|29427874|sp|Q8XJM7|COAD_CLOPE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|18145392|dbj|BAB81435.1| phosphopantetheine adenylyltransferase [Clostridium perfringens
           str. 13]
 gi|169299243|gb|EDS81313.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           C str. JGS1495]
 gi|170661347|gb|EDT14030.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           E str. JGS1987]
 gi|170711276|gb|EDT23458.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           B str. ATCC 3626]
 gi|177908859|gb|EDT71351.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           D str. JGS1721]
 gi|182380939|gb|EDT78418.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           NCTC 8239]
          Length = 164

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 101/166 (60%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY GSFDPIT GH+D+I +A S  + +++A+  N +  KG  SI+ER  LI++ + 
Sbjct: 1   MRVGVYPGSFDPITKGHLDLIERAASKFDKVIVAVLIN-INKKGMFSIEERVNLIEKCVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +     N V V SF GL ++  +   A VI++GLR +TDF+YE +M  +NR L  E+ T
Sbjct: 60  KY-----NNVEVKSFNGLLIDFVRKEKADVIIKGLRSVTDFEYEFQMALMNRELANEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + +    +  Y++S+ I+ + S + +I +FVP  +   L+  +ISL
Sbjct: 115 VFMVTSPNYSYISSSAIKQVASFNGEIKNFVPKEIVEDLEERIISL 160


>gi|307822857|ref|ZP_07653088.1| pantetheine-phosphate adenylyltransferase [Methylobacter
           tundripaludum SV96]
 gi|307736461|gb|EFO07307.1| pantetheine-phosphate adenylyltransferase [Methylobacter
           tundripaludum SV96]
          Length = 161

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/154 (40%), Positives = 95/154 (61%), Gaps = 6/154 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y G+FDPITNGH+D+I +A      +V+A+  N  KT  F S+ ER +L++   
Sbjct: 1   MQTTAIYPGTFDPITNGHLDLIARASRLYHKVVVAVAVNRGKTPLF-SLDERVDLVRA-- 57

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                D SN V VI F+ L V  AK   A VI+RGLR ++DF+YE ++  +NR L PE+ 
Sbjct: 58  --VTSDFSN-VEVIGFDNLLVECAKQQGANVILRGLRAVSDFEYEFQLAGMNRRLAPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           T+ L   E   +++S++IR +  ++ D++ FVPD
Sbjct: 115 TVFLTPAEQYEFISSSMIREIAQLNGDVSCFVPD 148


>gi|55821624|ref|YP_140066.1| phosphopantetheine adenylyltransferase [Streptococcus thermophilus
           LMG 18311]
 gi|55823552|ref|YP_141993.1| phosphopantetheine adenylyltransferase [Streptococcus thermophilus
           CNRZ1066]
 gi|55737609|gb|AAV61251.1| phosphopantetheine adenylyltransferase [Streptococcus thermophilus
           LMG 18311]
 gi|55739537|gb|AAV63178.1| phosphopantetheine adenylyltransferase [Streptococcus thermophilus
           CNRZ1066]
          Length = 165

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 94/157 (59%), Gaps = 5/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A++TGSFDPITNGHMDII++A    ++L I +  N  K +GF  +  R  ++ +  
Sbjct: 1   MTKIAMFTGSFDPITNGHMDIIVRASKLFDELYIGLFYNKNK-QGFWDVATRKRILDE-- 57

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              + D  N   + + + LAV++A+D+    +VRGLR+ TDFDYE  M   N+ L PE+ 
Sbjct: 58  --VVADFPNVKVITAHDSLAVDVARDLGVTYLVRGLRNATDFDYEANMDYFNKGLAPELE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           T+ L A      V+S+ +R LI  + DI+S+VP  V 
Sbjct: 116 TVYLIASHEVTPVSSSRVRELIYFEGDISSYVPQAVV 152


>gi|331644352|ref|ZP_08345481.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H736]
 gi|331036646|gb|EGI08872.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H736]
          Length = 194

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 96/156 (61%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER EL +Q+ 
Sbjct: 36  MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK-KPMFTLEERVELAQQAT 94

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 95  AHL-----GNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 149

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 150 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 185


>gi|310816556|ref|YP_003964520.1| phosphopantetheine adenylyltransferase [Ketogulonicigenium vulgare
           Y25]
 gi|308755291|gb|ADO43220.1| phosphopantetheine adenylyltransferase [Ketogulonicigenium vulgare
           Y25]
          Length = 159

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/155 (38%), Positives = 93/155 (60%), Gaps = 5/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+TNGH+DII +  + V+ LVI +  N+ K   F  + ER  L++  + 
Sbjct: 1   MRIGLYPGTFDPVTNGHLDIIRRGAALVDRLVIGVAINAGKGPLF-GVDERVALLEVEVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D    ++V+ FE L V+ A  + AQVI+RGLR   DF+YE  MT +NR L P+I T
Sbjct: 60  AIPAD----IAVVPFETLLVDFAGKVGAQVIIRGLRGAADFEYEFPMTGMNRTLAPDIET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L A+   + + S L++ +  +  D+++FVP  V
Sbjct: 116 VFLMAEARHQAIASRLVKEVSRLGGDVSAFVPPGV 150


>gi|52840791|ref|YP_094590.1| phosphopantetheine adenylyltransferase [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|52627902|gb|AAU26643.1| phosphopantetheine adenylyltransferase [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
          Length = 199

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 102/161 (63%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDP+TNGH+DII +A +   +L++A+  N  K + +LS + R  L+++S+
Sbjct: 37  MKQKAIYPGTFDPVTNGHIDIITRASTIFPELIVAVASNKNK-RPYLSWESRISLLEESV 95

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F+ L ++   + +A +I+RGLR ++DF+YE ++  +NR L  ++ 
Sbjct: 96  GHL-----TGVRVVGFDNLLIDFVLEQNAGIILRGLRAVSDFEYEFQLAGMNRKLSKKVE 150

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ L   E   Y++STL+R + +++ DI+ FVP  V   LK
Sbjct: 151 TLFLTPAEHLMYISSTLVREIAALNGDISQFVPPNVVRELK 191


>gi|240144127|ref|ZP_04742728.1| pantetheine-phosphate adenylyltransferase [Roseburia intestinalis
           L1-82]
 gi|257203919|gb|EEV02204.1| pantetheine-phosphate adenylyltransferase [Roseburia intestinalis
           L1-82]
 gi|291536222|emb|CBL09334.1| pantetheine-phosphate adenylyltransferase, bacterial [Roseburia
           intestinalis M50/1]
 gi|291538910|emb|CBL12021.1| pantetheine-phosphate adenylyltransferase, bacterial [Roseburia
           intestinalis XB6B4]
          Length = 161

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 95/152 (62%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+KA+Y GSFDP+T GH+DII ++   V++LV+ +  NS K   F S+ ER  +IK+   
Sbjct: 1   MKKAIYPGSFDPLTLGHLDIIERSARIVDELVVGVLNNSAKNSLF-SLDERVSMIKE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             + DS   V+V SF GL V+  ++I A +IVRGLR +TDF+YE+++   N    PE+ T
Sbjct: 57  --MTDSMPNVTVTSFNGLLVDYMREIDATIIVRGLRAVTDFEYELQIAQTNHVENPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           I L       Y++ST+++   S   D++ FVP
Sbjct: 115 IFLTTSLQYSYLSSTIVKEFASYGGDLSKFVP 146


>gi|16125828|ref|NP_420392.1| lipopolysaccharide core biosynthesis protein KdtB [Caulobacter
           crescentus CB15]
 gi|221234589|ref|YP_002517025.1| phosphopantetheine adenylyltransferase [Caulobacter crescentus
           NA1000]
 gi|14194502|sp|P58103|COAD_CAUCR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254763940|sp|B8GVE7|COAD_CAUCN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|13422972|gb|AAK23560.1| lipopolysaccharide core biosynthesis protein KdtB [Caulobacter
           crescentus CB15]
 gi|220963761|gb|ACL95117.1| phosphopantetheine adenylyltransferase [Caulobacter crescentus
           NA1000]
          Length = 163

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 97/156 (62%), Gaps = 3/156 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+TNGH+DII +A+  V+ LVI +  N  K   F S++ER E++++   
Sbjct: 1   MRVGLYPGTFDPVTNGHLDIIGRAVKLVDKLVIGVAINIGKGPLF-SLEERVEILERETA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H        + V  F+ L ++ A+D++AQ+IVRGLR + DF+YE +MT++N+ L  EI T
Sbjct: 60  HL--KKIAEIEVRPFDSLLMHFARDVNAQMIVRGLRAVADFEYEFQMTAMNQQLDREIET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + L A    + + S L++ + ++  DI  FVP  V 
Sbjct: 118 VFLMADPRHQAIASRLVKEIATLGGDIGKFVPPGVA 153


>gi|311696223|gb|ADP99096.1| phosphopantetheine adenylyltransferase [marine bacterium HP15]
          Length = 158

 Score =  121 bits (303), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 98/160 (61%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M K +Y G+FDPITNGH D+I +A    +++V+AI  N  K +  L ++ER EL++Q+  
Sbjct: 1   MSKVIYPGTFDPITNGHTDLIERAGRMFDEIVVAIAYNP-KKQPLLDLEERCELVRQATA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V+V  F  L  +  ++  A VI+RGLR ++DF+YE ++  +NR L PE+ +
Sbjct: 60  H-LPN----VTVTGFSNLLADFVREQGATVILRGLRAVSDFEYEFQLADMNRRLAPEVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L       Y++STLIR + S+  D++ FV   V   LK
Sbjct: 115 VFLTPANHLSYISSTLIREIASLGGDVSEFVDPAVEAALK 154


>gi|269103923|ref|ZP_06156620.1| phosphopantetheine adenylyltransferase [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268163821|gb|EEZ42317.1| phosphopantetheine adenylyltransferase [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 162

 Score =  121 bits (303), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 99/160 (61%), Gaps = 6/160 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D+I +A +  + +++ +  N  K K    + ER  L  QS+
Sbjct: 1   MTTRVIYPGTFDPITNGHLDLIERAAAMFDTVIVGVAYNPTK-KPLFDLDERVAL-AQSV 58

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +P+    V ++ F GL VN AK+ +A V+VRGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 59  TQHLPN----VEIVGFSGLLVNFAKEHNANVLVRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           T+ L   E + +++ST+++ +     D++ FVP  V + L
Sbjct: 115 TVFLTPAEENSFISSTIVKEVALHKGDVSQFVPQEVSIQL 154


>gi|115524772|ref|YP_781683.1| phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           BisA53]
 gi|122296026|sp|Q07MY1|COAD_RHOP5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|115518719|gb|ABJ06703.1| Phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           BisA53]
          Length = 165

 Score =  121 bits (303), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 97/162 (59%), Gaps = 1/162 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++ +A++  + L++AIG +  K K   S +ER  +++   
Sbjct: 1   MPRIALYPGSFDPVTNGHLDVVRRAVTLCDRLIVAIGVHPGK-KPLFSTEERLAMVRDVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                ++       +++ L +  A+   A ++VRGLRD TD DYEM++  +N  + P + 
Sbjct: 60  GPIAAEAGCAFDCTTYDNLTITAAQQAGATIMVRGLRDGTDLDYEMQIAGMNETMAPTVQ 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ + A  + R +T+TL+R + ++  D+++FVP  V   LK 
Sbjct: 120 TVFVPASVAVRPITATLVRQIAAMGGDVSAFVPPQVAALLKT 161


>gi|225027128|ref|ZP_03716320.1| hypothetical protein EUBHAL_01384 [Eubacterium hallii DSM 3353]
 gi|224955592|gb|EEG36801.1| hypothetical protein EUBHAL_01384 [Eubacterium hallii DSM 3353]
          Length = 160

 Score =  121 bits (303), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 94/156 (60%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDPIT GH+DII +  +  + ++I +  N  K K   SI+ER ELIK+ + 
Sbjct: 1   MATAVYPGSFDPITLGHLDIIKRTAAVFDKVIIGVLINKAK-KPLFSIEERVELIKE-VT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V ++SF GL +  +  + A VIVRG+R ++DF+YE+ M   N+ L P I T
Sbjct: 59  KNIPN----VEIVSFNGLLIEFSDKMKADVIVRGIRAVSDFEYELMMAQTNKQLNPNIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           +         +V+S++IR L + D DIT FVP+ V 
Sbjct: 115 MFFATSAEYSFVSSSMIRELAAFDGDITPFVPEEVS 150


>gi|108763591|ref|YP_631582.1| phosphopantetheine adenylyltransferase [Myxococcus xanthus DK 1622]
 gi|108467471|gb|ABF92656.1| pantetheine-phosphate adenylyltransferase [Myxococcus xanthus DK
           1622]
          Length = 160

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 97/157 (61%), Gaps = 7/157 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y GSFDP+TNGH+ +I ++L   + L++AI  N  KT  F S +ER  LI++++    
Sbjct: 4   AIYPGSFDPLTNGHLSLIQRSLKMFDRLIVAIAVNPKKTPLF-SEEERLTLIREAV---- 58

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
               +RV V +F GL V+  +  +A VIVRGLR ++DF+YE ++ ++NR L P++ T+ +
Sbjct: 59  --QDDRVEVDAFHGLLVDYVRRRNAGVIVRGLRAVSDFEYEFQLANMNRKLAPDVETVFM 116

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
              E   Y++S L+R + S   D+T  VP  V   LK
Sbjct: 117 MTGEDYFYISSNLVREVASFGGDVTGLVPPNVHEGLK 153


>gi|218702400|ref|YP_002410029.1| phosphopantetheine adenylyltransferase [Escherichia coli IAI39]
 gi|226706695|sp|B7NPE0|COAD_ECO7I RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|218372386|emb|CAR20260.1| pantetheine-phosphate adenylyltransferase [Escherichia coli IAI39]
          Length = 159

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 96/156 (61%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER +L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK-KPMFTLEERVDLAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  THL-----GNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|170766565|ref|ZP_02901018.1| pantetheine-phosphate adenylyltransferase [Escherichia albertii
           TW07627]
 gi|170124003|gb|EDS92934.1| pantetheine-phosphate adenylyltransferase [Escherichia albertii
           TW07627]
          Length = 159

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 95/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   S++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK-KPMFSLEERVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F  L  N A+   A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHL-----SNVEVVGFSDLMANFARKQQATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|210615576|ref|ZP_03290674.1| hypothetical protein CLONEX_02892 [Clostridium nexile DSM 1787]
 gi|210150243|gb|EEA81252.1| hypothetical protein CLONEX_02892 [Clostridium nexile DSM 1787]
          Length = 163

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 64/161 (39%), Positives = 101/161 (62%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDP+T GH+DII ++ +  ++L++ I  N  KT  F S+ ER +++++   
Sbjct: 1   MLRAIYPGSFDPVTLGHLDIIRRSAAIADELIVGILNNKAKTPLF-SVGERVKMLEEVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F P+    V +I FEGL V  AK + A+VIVRGLR +TDF+YE++M+  N  + PEI T
Sbjct: 60  DF-PN----VKIIPFEGLLVEFAKQMDAKVIVRGLRAITDFEYELQMSQTNHKIEPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L       +++ST ++ + S   DIT FVP+ +   +K 
Sbjct: 115 LFLTTSLEFSFLSSTTVKEVASFGGDITQFVPEVIVKKIKE 155


>gi|120556480|ref|YP_960831.1| phosphopantetheine adenylyltransferase [Marinobacter aquaeolei VT8]
 gi|166216558|sp|A1U6M5|COAD_MARAV RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|120326329|gb|ABM20644.1| Phosphopantetheine adenylyltransferase [Marinobacter aquaeolei VT8]
          Length = 160

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 99/155 (63%), Gaps = 7/155 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M K +Y G+FDPITNGH D+I +A    +++V+A+  N  K +  L+++ER EL++++  
Sbjct: 1   MPKVIYPGTFDPITNGHTDLIERAGRMFDEIVVAVAYNP-KKQPLLNLEERCELVRKATA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    VSV  F  L  +  ++ +A VI+RGLR ++DF+YE ++  +NR L PE+ +
Sbjct: 60  H-LPN----VSVTGFSNLLADFVREQNASVILRGLRAVSDFEYEFQLADMNRRLAPEVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L       Y++STLIR + S+  DI+ FV DP 
Sbjct: 115 VFLTPANHLSYISSTLIREIASLGGDISEFV-DPA 148


>gi|110802807|ref|YP_699015.1| phosphopantetheine adenylyltransferase [Clostridium perfringens
           SM101]
 gi|123047307|sp|Q0SS92|COAD_CLOPS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|110683308|gb|ABG86678.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           SM101]
          Length = 164

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 100/166 (60%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY GSFDPIT GH+D+I +A S  + +++A+  N +  KG  SI+ER  LI++ + 
Sbjct: 1   MRVGVYPGSFDPITKGHLDLIERAASKFDKVIVAVLIN-INKKGMFSIEERVNLIEKCVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +     N V V SF GL ++  +   A VI++GLR +TDF+YE +M  +NR L  E+ T
Sbjct: 60  KY-----NNVEVKSFNGLLIDFVRKEKADVIIKGLRSVTDFEYEFQMALMNRELANEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + +    +  Y++S+ I+ + S   +I +FVP  +   L+  +ISL
Sbjct: 115 VFMVTSPNYSYISSSAIKQVASFSGEIKNFVPKEIVEDLEERIISL 160


>gi|116626315|ref|YP_828471.1| pantetheine-phosphate adenylyltransferase [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116229477|gb|ABJ88186.1| pantetheine-phosphate adenylyltransferase [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 172

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 103/157 (65%), Gaps = 6/157 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y GSFDPITNGH+D+I +     + L+++I  N  K   F S++ER+E++++ + H  
Sbjct: 10  AIYPGSFDPITNGHLDLIQRGSRMFDRLIVSILRNDAKEPLF-SLEERTEMLRE-VLHVY 67

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V SF+GL V+ A   SA V++RG+R ++D++YE++M  +NR L P+I T+ +
Sbjct: 68  PN----VEVDSFDGLLVDHAAARSATVLLRGIRAISDYEYELQMALMNRRLGPQIETVFM 123

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            A E+  +++S LI+ + S+  +IT  VP  V + L+
Sbjct: 124 MAHEAYSFISSRLIKEVFSLGGNITGLVPPSVEIRLQ 160


>gi|29427862|sp|Q8VW75|COAD_PASPI RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|16945743|dbj|BAB72023.1| phosphopantetheine adenylyltransferase [Photobacterium damselae
           subsp. piscicida]
          Length = 160

 Score =  120 bits (302), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 98/157 (62%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D+I +A +  + +++ +  N  K K    + ER  L  QS+
Sbjct: 1   MTTRVIYPGTFDPITNGHLDLIERAAAMFDTVIVGVAYNPTK-KPLFDLNERVAL-AQSV 58

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +P+    V ++ F GL VN AK+ +A V+VRGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 59  TQHLPN----VEIVGFSGLLVNFAKEHNANVLVRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           T+ L   E + +++ST+++ +     D++ FVP+ + 
Sbjct: 115 TVFLTPAEENSFISSTIVKEVALHKGDVSQFVPNQIS 151


>gi|208819762|ref|ZP_03260082.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4042]
 gi|208739885|gb|EDZ87567.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4042]
          Length = 180

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 95/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK-KPMFTLEERVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+PD V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPDNV 150


>gi|295689997|ref|YP_003593690.1| pantetheine-phosphate adenylyltransferase [Caulobacter segnis ATCC
           21756]
 gi|295431900|gb|ADG11072.1| pantetheine-phosphate adenylyltransferase [Caulobacter segnis ATCC
           21756]
          Length = 163

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 98/156 (62%), Gaps = 3/156 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+TNGH+DII +A+  V+ LVI +  N  K   F S+ ER  ++++   
Sbjct: 1   MRVGLYPGTFDPVTNGHLDIIGRAVKLVDKLVIGVAVNIGKGPLF-SLDERVAILERETA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    +  ++ V  FE L ++ A+D++AQ+IVRGLR + DF+YE +MT++N+ L  EI T
Sbjct: 60  HLTKIA--QIEVKPFESLLMHFARDVNAQMIVRGLRAVADFEYEFQMTAMNQQLDREIET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + L A    + + S L++ + ++  DI+ FVP  V 
Sbjct: 118 VFLMADPRHQAIASRLVKEIAALGGDISKFVPAGVA 153


>gi|149378332|ref|ZP_01896039.1| phosphopantetheine adenylyltransferase [Marinobacter algicola
           DG893]
 gi|149357390|gb|EDM45905.1| phosphopantetheine adenylyltransferase [Marinobacter algicola
           DG893]
          Length = 160

 Score =  120 bits (301), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 100/160 (62%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M K +Y G+FDPITNGH D+I +A    +++V+AI  N  K+   L+++ER EL++++  
Sbjct: 1   MPKVIYPGTFDPITNGHTDLIERAGRLFDEVVVAIAYNPKKSP-LLTLEERCELVEKATS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    VSV  F  L  +  ++ +A VI+RGLR ++DF+YE ++  +NR L PE+ +
Sbjct: 60  H-LPN----VSVTGFSNLLADFVREQNATVIIRGLRAVSDFEYEFQLADMNRRLAPEVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L       Y++STLIR + S+  D++ FV   V   LK
Sbjct: 115 VFLTPSNHLSYISSTLIREIASLGGDVSEFVDPAVEAALK 154


>gi|225568061|ref|ZP_03777086.1| hypothetical protein CLOHYLEM_04134 [Clostridium hylemonae DSM
           15053]
 gi|225163157|gb|EEG75776.1| hypothetical protein CLOHYLEM_04134 [Clostridium hylemonae DSM
           15053]
          Length = 162

 Score =  120 bits (301), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 97/156 (62%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +AVY GSFDP+T GH+DII ++   V++L+I +  N  KT  F S +ER  ++K+   
Sbjct: 1   MLRAVYPGSFDPVTYGHLDIIERSSKLVDELIIGVLNNKAKTPLF-SAEERVRMLKE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +     +++++ F+GL V  A+ + A +IVRGLR +TDF+YE++M+  N  L PEI T
Sbjct: 57  --VTKGMPKLTIVPFDGLLVEFARRMEATMIVRGLRAITDFEYELQMSQTNHKLEPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + L       Y++ST ++ + +   DI+ FVPD V 
Sbjct: 115 VFLTTSLDYSYLSSTTVKEVAAFGGDISQFVPDFVA 150


>gi|74314132|ref|YP_312551.1| phosphopantetheine adenylyltransferase [Shigella sonnei Ss046]
 gi|123615829|sp|Q3YVZ6|COAD_SHISS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|73857609|gb|AAZ90316.1| putative enzyme of lipopolysaccharide synthesis [Shigella sonnei
           Ss046]
 gi|323166883|gb|EFZ52622.1| pantetheine-phosphate adenylyltransferase [Shigella sonnei 53G]
          Length = 159

 Score =  120 bits (301), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 95/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK-KPMFTLEERVALTQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|163786075|ref|ZP_02180523.1| phosphopantetheine adenylyltransferase [Flavobacteriales bacterium
           ALC-1]
 gi|159877935|gb|EDP71991.1| phosphopantetheine adenylyltransferase [Flavobacteriales bacterium
           ALC-1]
          Length = 152

 Score =  120 bits (301), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 98/157 (62%), Gaps = 7/157 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++A++ GSFDPIT GH DII + +   +++V+AIG N+ K K   S++ER   I++S  
Sbjct: 1   MKRAIFPGSFDPITLGHYDIIKRGIKLFDEVVVAIGVNADK-KYMFSLEERKAFIEKSFE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H       +V V++++GL ++  K+I AQ I+RGLR+  DF++E  +   NR L   I T
Sbjct: 60  H-----EPKVKVVTYKGLTIDFCKEIDAQFILRGLRNPADFEFEKAIAHTNRKLS-NIET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           + L    S+ Y++S+++R +I  D D T  VPD V V
Sbjct: 114 VFLLTAASTSYISSSIVRDVIRNDGDYTKLVPDSVRV 150


>gi|40063708|gb|AAR38489.1| pantetheine-phosphate adenylyltransferase [uncultured marine
           bacterium 583]
          Length = 160

 Score =  120 bits (301), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 101/156 (64%), Gaps = 6/156 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y GSFDPITNGH+D+I +A    ++++IAI  N+ KT   LSI +R E ++ SI    
Sbjct: 5   AIYPGSFDPITNGHIDLIHRACKLFDEVLIAITQNANKTS-LLSIDQRIEAVEASI---- 59

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
             S +   V+ F  L V+ A+D +AQ+I+RGLR ++DF+YE +++ +N+ L P I T+ +
Sbjct: 60  -TSISNTRVLGFNSLLVDFARDHNAQIIIRGLRAVSDFEYEFQLSGMNKRLNPGIETLFM 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
              E    ++S+L+R ++S+  DI+SFVP  V   L
Sbjct: 119 TPSEEFANISSSLVREILSLGGDISSFVPASVETIL 154


>gi|90424087|ref|YP_532457.1| phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           BisB18]
 gi|122476231|sp|Q214P8|COAD_RHOPB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|90106101|gb|ABD88138.1| Phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           BisB18]
          Length = 165

 Score =  120 bits (301), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 96/157 (61%), Gaps = 1/157 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++ +A++  + L++AIG +  K K   S QER E+++   
Sbjct: 1   MPRIALYPGSFDPVTNGHLDVVSRAVALCDRLIVAIGVHPGK-KPLFSTQERLEMVETVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +       +++ L V  A+ + A +++RGLRD TD DYEM++  +N  + P++ 
Sbjct: 60  APVAAAAHCAFDCTTYDNLTVTAAQRVGATIMIRGLRDGTDLDYEMQIAGMNETMAPDVH 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           T+ + A  S R +T+TL+R +  +  D+++FVP  V 
Sbjct: 120 TVFIPAGVSVRPITATLVRQIAQMGGDVSAFVPPQVA 156


>gi|167622076|ref|YP_001672370.1| phosphopantetheine adenylyltransferase [Shewanella halifaxensis
           HAW-EB4]
 gi|189082589|sp|B0TMZ9|COAD_SHEHH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|167352098|gb|ABZ74711.1| pantetheine-phosphate adenylyltransferase [Shewanella halifaxensis
           HAW-EB4]
          Length = 159

 Score =  120 bits (301), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 58/157 (36%), Positives = 97/157 (61%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDP+TNGH D+I +A +  E ++I I  N  K   F ++ ER EL+K   
Sbjct: 1   MHKRAIYPGTFDPVTNGHADLIERAANLFEHVIIGIAANPSKQPRF-TLAERVELLKTVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AK+ +A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----DNVEVVGFSGLLVDFAKEQNASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E + +++STL++ +     D++ FV   V 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHAEVA 151


>gi|270157981|ref|ZP_06186638.1| phosphopantetheine adenylyltransferase [Legionella longbeachae
           D-4968]
 gi|289163753|ref|YP_003453891.1| pantetheine-phosphate adenylyltransferase [Legionella longbeachae
           NSW150]
 gi|269990006|gb|EEZ96260.1| phosphopantetheine adenylyltransferase [Legionella longbeachae
           D-4968]
 gi|288856926|emb|CBJ10740.1| pantetheine-phosphate adenylyltransferase [Legionella longbeachae
           NSW150]
          Length = 171

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 103/162 (63%), Gaps = 7/162 (4%)

Query: 1   MMR-KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           MM+ KA+Y G+FDP+TNGH+DII +A     ++V+ +  N  K + FL ++ R  L+K+S
Sbjct: 7   MMKLKAIYPGTFDPVTNGHVDIITRAAKIFPEIVVGVASNRAK-RPFLPMETRINLLKES 65

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           + H +P     V V+ FE L ++   + +A +I+RGLR ++DF+YE ++  +NR L  +I
Sbjct: 66  LAH-LPG----VCVLGFENLLIDFVLEQNAGIILRGLRAVSDFEYEFQLAGMNRKLSKKI 120

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            TI L   E+  +++STL+R +  +D DI+ FVP  V   LK
Sbjct: 121 ETIFLTPSENLMFISSTLVREIAFLDGDISQFVPACVVRELK 162


>gi|197247364|ref|YP_002148657.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|226709013|sp|B5EXD9|COAD_SALA4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|197211067|gb|ACH48464.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
          Length = 159

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 95/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER  L +++ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPGK-KPMFTLEERVALAQKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+PD V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPDNV 150


>gi|15804175|ref|NP_290214.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           EDL933]
 gi|15833763|ref|NP_312536.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. Sakai]
 gi|16131505|ref|NP_418091.1| pantetheine-phosphate adenylyltransferase [Escherichia coli str.
           K-12 substr. MG1655]
 gi|24114903|ref|NP_709413.1| phosphopantetheine adenylyltransferase [Shigella flexneri 2a str.
           301]
 gi|30065090|ref|NP_839261.1| phosphopantetheine adenylyltransferase [Shigella flexneri 2a str.
           2457T]
 gi|82545997|ref|YP_409944.1| phosphopantetheine adenylyltransferase [Shigella boydii Sb227]
 gi|89110377|ref|AP_004157.1| pantetheine-phosphate adenylyltransferase [Escherichia coli str.
           K-12 substr. W3110]
 gi|110807688|ref|YP_691208.1| phosphopantetheine adenylyltransferase [Shigella flexneri 5 str.
           8401]
 gi|157158987|ref|YP_001465114.1| phosphopantetheine adenylyltransferase [Escherichia coli E24377A]
 gi|157163115|ref|YP_001460433.1| phosphopantetheine adenylyltransferase [Escherichia coli HS]
 gi|168748718|ref|ZP_02773740.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4113]
 gi|168753458|ref|ZP_02778465.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4401]
 gi|168759731|ref|ZP_02784738.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4501]
 gi|168766054|ref|ZP_02791061.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4486]
 gi|168772400|ref|ZP_02797407.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4196]
 gi|168779789|ref|ZP_02804796.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4076]
 gi|168785510|ref|ZP_02810517.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC869]
 gi|170018136|ref|YP_001723090.1| phosphopantetheine adenylyltransferase [Escherichia coli ATCC 8739]
 gi|170083142|ref|YP_001732462.1| pantetheine-phosphate adenylyltransferase [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170682523|ref|YP_001745934.1| phosphopantetheine adenylyltransferase [Escherichia coli SMS-3-5]
 gi|187730134|ref|YP_001882331.1| phosphopantetheine adenylyltransferase [Shigella boydii CDC
           3083-94]
 gi|188491996|ref|ZP_02999266.1| pantetheine-phosphate adenylyltransferase [Escherichia coli 53638]
 gi|191167828|ref|ZP_03029634.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B7A]
 gi|193063853|ref|ZP_03044940.1| pantetheine-phosphate adenylyltransferase [Escherichia coli E22]
 gi|193070368|ref|ZP_03051310.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           E110019]
 gi|194430622|ref|ZP_03063076.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B171]
 gi|194435652|ref|ZP_03067755.1| pantetheine-phosphate adenylyltransferase [Escherichia coli 101-1]
 gi|195936195|ref|ZP_03081577.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. EC4024]
 gi|208809610|ref|ZP_03251947.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4206]
 gi|208814470|ref|ZP_03255799.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4045]
 gi|209395850|ref|YP_002273112.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4115]
 gi|209921105|ref|YP_002295189.1| phosphopantetheine adenylyltransferase [Escherichia coli SE11]
 gi|217326368|ref|ZP_03442452.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. TW14588]
 gi|218556196|ref|YP_002389109.1| phosphopantetheine adenylyltransferase [Escherichia coli IAI1]
 gi|218697355|ref|YP_002405022.1| phosphopantetheine adenylyltransferase [Escherichia coli 55989]
 gi|238902725|ref|YP_002928521.1| pantetheine-phosphate adenylyltransferase [Escherichia coli BW2952]
 gi|253771525|ref|YP_003034356.1| phosphopantetheine adenylyltransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254163562|ref|YP_003046670.1| phosphopantetheine adenylyltransferase [Escherichia coli B str.
           REL606]
 gi|254795589|ref|YP_003080426.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. TW14359]
 gi|256021362|ref|ZP_05435227.1| phosphopantetheine adenylyltransferase [Shigella sp. D9]
 gi|260846601|ref|YP_003224379.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O103:H2
           str. 12009]
 gi|260857971|ref|YP_003231862.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O26:H11
           str. 11368]
 gi|260870364|ref|YP_003236766.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O111:H-
           str. 11128]
 gi|261224183|ref|ZP_05938464.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261254794|ref|ZP_05947327.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. FRIK966]
 gi|291285005|ref|YP_003501823.1| Phosphopantetheine adenylyltransferase [Escherichia coli O55:H7
           str. CB9615]
 gi|293463958|ref|ZP_06664372.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B088]
 gi|297518692|ref|ZP_06937078.1| phosphopantetheine adenylyltransferase [Escherichia coli OP50]
 gi|300815127|ref|ZP_07095352.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           107-1]
 gi|300822404|ref|ZP_07102544.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           119-7]
 gi|300907675|ref|ZP_07125303.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           84-1]
 gi|300919799|ref|ZP_07136274.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           115-1]
 gi|300923418|ref|ZP_07139459.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           182-1]
 gi|300927936|ref|ZP_07143495.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           187-1]
 gi|300939233|ref|ZP_07153913.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           21-1]
 gi|301303867|ref|ZP_07209986.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           124-1]
 gi|301325316|ref|ZP_07218823.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           78-1]
 gi|307314281|ref|ZP_07593889.1| pantetheine-phosphate adenylyltransferase [Escherichia coli W]
 gi|309797625|ref|ZP_07692013.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           145-7]
 gi|331670474|ref|ZP_08371313.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA271]
 gi|331675114|ref|ZP_08375871.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA280]
 gi|331679725|ref|ZP_08380395.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H591]
 gi|331685297|ref|ZP_08385883.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H299]
 gi|62288044|sp|P0A6I6|COAD_ECOLI RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|62288045|sp|P0A6I7|COAD_ECO57 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|62288046|sp|P0A6I8|COAD_SHIFL RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|122957051|sp|Q0SYG2|COAD_SHIF8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123558303|sp|Q31UZ2|COAD_SHIBS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|167009042|sp|A7ZTI5|COAD_ECO24 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|167009043|sp|A8A696|COAD_ECOHS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189082568|sp|B1IZF9|COAD_ECOLC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226706696|sp|B7M4B8|COAD_ECO8A RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226706698|sp|B1LK71|COAD_ECOSM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226709004|sp|B5YWD2|COAD_ECO5E RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226709005|sp|B6I3L1|COAD_ECOSE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488305|sp|B1X968|COAD_ECODH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541045|sp|B2TTU8|COAD_SHIB3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254764153|sp|B7L747|COAD_ECO55 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|259491309|sp|C4ZXM6|COAD_ECOBW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|7767003|pdb|1B6T|A Chain A, Phosphopantetheine Adenylyltransferase In Complex With 3'-
           Dephospho-Coa From Escherichia Coli
 gi|7767004|pdb|1B6T|B Chain B, Phosphopantetheine Adenylyltransferase In Complex With 3'-
           Dephospho-Coa From Escherichia Coli
 gi|18655796|pdb|1GN8|A Chain A, Phosphopantetheine Adenylyltransferase In Complex With
           Mn2+ Atp From Escherichia Coli
 gi|18655797|pdb|1GN8|B Chain B, Phosphopantetheine Adenylyltransferase In Complex With
           Mn2+ Atp From Escherichia Coli
 gi|73535259|pdb|1H1T|A Chain A, Phosphopantetheine Adenylyltransferase In Complex With
           Coenzyme A From Escherichia Coli
 gi|73535260|pdb|1H1T|B Chain B, Phosphopantetheine Adenylyltransferase In Complex With
           Coenzyme A From Escherichia Coli
 gi|12518390|gb|AAG58778.1|AE005591_2 putative enzyme of LPS biosynthesis [Escherichia coli O157:H7 str.
           EDL933]
 gi|146544|gb|AAA03746.1| 18 kD protein [Escherichia coli]
 gi|146557|gb|AAA24044.1| 18 kD protein [Escherichia coli]
 gi|466772|gb|AAB18611.1| 4th start codon [Escherichia coli str. K-12 substr. MG1655]
 gi|1790065|gb|AAC76658.1| pantetheine-phosphate adenylyltransferase [Escherichia coli str.
           K-12 substr. MG1655]
 gi|13363984|dbj|BAB37932.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. Sakai]
 gi|24054145|gb|AAN45120.1| putative enzyme of lipopolysaccharide synthesis [Shigella flexneri
           2a str. 301]
 gi|30043351|gb|AAP19072.1| putative enzyme of lipopolysaccharide synthesis [Shigella flexneri
           2a str. 2457T]
 gi|81247408|gb|ABB68116.1| putative enzyme of lipopolysaccharide synthesis [Shigella boydii
           Sb227]
 gi|85676408|dbj|BAE77658.1| pantetheine-phosphate adenylyltransferase [Escherichia coli str.
           K12 substr. W3110]
 gi|110617236|gb|ABF05903.1| putative enzyme of lipopolysaccharide synthesis [Shigella flexneri
           5 str. 8401]
 gi|157068795|gb|ABV08050.1| pantetheine-phosphate adenylyltransferase [Escherichia coli HS]
 gi|157081017|gb|ABV20725.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           E24377A]
 gi|169753064|gb|ACA75763.1| pantetheine-phosphate adenylyltransferase [Escherichia coli ATCC
           8739]
 gi|169890977|gb|ACB04684.1| pantetheine-phosphate adenylyltransferase [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170520241|gb|ACB18419.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           SMS-3-5]
 gi|187427126|gb|ACD06400.1| pantetheine-phosphate adenylyltransferase [Shigella boydii CDC
           3083-94]
 gi|187771704|gb|EDU35548.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4196]
 gi|188016909|gb|EDU55031.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4113]
 gi|188487195|gb|EDU62298.1| pantetheine-phosphate adenylyltransferase [Escherichia coli 53638]
 gi|189002466|gb|EDU71452.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4076]
 gi|189358865|gb|EDU77284.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4401]
 gi|189364404|gb|EDU82823.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4486]
 gi|189369785|gb|EDU88201.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4501]
 gi|189374680|gb|EDU93096.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC869]
 gi|190902171|gb|EDV61914.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B7A]
 gi|192930568|gb|EDV83175.1| pantetheine-phosphate adenylyltransferase [Escherichia coli E22]
 gi|192956307|gb|EDV86768.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           E110019]
 gi|194411334|gb|EDX27702.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B171]
 gi|194425195|gb|EDX41179.1| pantetheine-phosphate adenylyltransferase [Escherichia coli 101-1]
 gi|208729411|gb|EDZ79012.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4206]
 gi|208735747|gb|EDZ84434.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4045]
 gi|209157250|gb|ACI34683.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. EC4115]
 gi|209754678|gb|ACI75651.1| phosphopantetheine adenylyltransferase [Escherichia coli]
 gi|209754680|gb|ACI75652.1| phosphopantetheine adenylyltransferase [Escherichia coli]
 gi|209754682|gb|ACI75653.1| phosphopantetheine adenylyltransferase [Escherichia coli]
 gi|209754684|gb|ACI75654.1| phosphopantetheine adenylyltransferase [Escherichia coli]
 gi|209754686|gb|ACI75655.1| phosphopantetheine adenylyltransferase [Escherichia coli]
 gi|209914364|dbj|BAG79438.1| phosphopantetheine adenylyltransferase [Escherichia coli SE11]
 gi|217322589|gb|EEC31013.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O157:H7
           str. TW14588]
 gi|218354087|emb|CAV00636.1| pantetheine-phosphate adenylyltransferase [Escherichia coli 55989]
 gi|218362964|emb|CAR00601.1| pantetheine-phosphate adenylyltransferase [Escherichia coli IAI1]
 gi|224613061|dbj|BAH24281.1| phosphopantetheine adenyltransferase [Escherichia coli B]
 gi|238861973|gb|ACR63971.1| pantetheine-phosphate adenylyltransferase [Escherichia coli BW2952]
 gi|242379158|emb|CAQ33960.1| pantetheine-phosphate adenylyltransferase monomer, subunit of
           phosphopantetheine adenylyltransferase [Escherichia coli
           BL21(DE3)]
 gi|253322569|gb|ACT27171.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975463|gb|ACT41134.1| phosphopantetheine adenylyltransferase [Escherichia coli B str.
           REL606]
 gi|253979619|gb|ACT45289.1| phosphopantetheine adenylyltransferase [Escherichia coli BL21(DE3)]
 gi|254594989|gb|ACT74350.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. TW14359]
 gi|257756620|dbj|BAI28122.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O26:H11
           str. 11368]
 gi|257761748|dbj|BAI33245.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O103:H2
           str. 12009]
 gi|257766720|dbj|BAI38215.1| pantetheine-phosphate adenylyltransferase [Escherichia coli O111:H-
           str. 11128]
 gi|260447347|gb|ACX37769.1| pantetheine-phosphate adenylyltransferase [Escherichia coli DH1]
 gi|281602997|gb|ADA75981.1| Phosphopantetheine adenylyltransferase [Shigella flexneri 2002017]
 gi|284923667|emb|CBG36764.1| phosphopantetheine adenylyltransferase [Escherichia coli 042]
 gi|290764878|gb|ADD58839.1| Phosphopantetheine adenylyltransferase [Escherichia coli O55:H7
           str. CB9615]
 gi|291321590|gb|EFE61026.1| pantetheine-phosphate adenylyltransferase [Escherichia coli B088]
 gi|300400611|gb|EFJ84149.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           84-1]
 gi|300413152|gb|EFJ96462.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           115-1]
 gi|300420328|gb|EFK03639.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           182-1]
 gi|300455875|gb|EFK19368.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           21-1]
 gi|300464028|gb|EFK27521.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           187-1]
 gi|300525051|gb|EFK46120.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           119-7]
 gi|300532019|gb|EFK53081.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           107-1]
 gi|300840830|gb|EFK68590.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           124-1]
 gi|300847843|gb|EFK75603.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           78-1]
 gi|306906104|gb|EFN36623.1| pantetheine-phosphate adenylyltransferase [Escherichia coli W]
 gi|308118812|gb|EFO56074.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           145-7]
 gi|313647492|gb|EFS11942.1| pantetheine-phosphate adenylyltransferase [Shigella flexneri 2a
           str. 2457T]
 gi|315062922|gb|ADT77249.1| pantetheine-phosphate adenylyltransferase [Escherichia coli W]
 gi|315138216|dbj|BAJ45375.1| phosphopantetheine adenylyltransferase [Escherichia coli DH1]
 gi|315254020|gb|EFU33988.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           85-1]
 gi|320176307|gb|EFW51367.1| Phosphopantetheine adenylyltransferase [Shigella dysenteriae CDC
           74-1112]
 gi|320186826|gb|EFW61546.1| Phosphopantetheine adenylyltransferase [Shigella flexneri CDC
           796-83]
 gi|320191315|gb|EFW65965.1| Phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. EC1212]
 gi|320639541|gb|EFX09149.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. G5101]
 gi|320644980|gb|EFX14010.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H-
           str. 493-89]
 gi|320650247|gb|EFX18736.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H-
           str. H 2687]
 gi|320655599|gb|EFX23527.1| phosphopantetheine adenylyltransferase [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320661333|gb|EFX28757.1| phosphopantetheine adenylyltransferase [Escherichia coli O55:H7
           str. USDA 5905]
 gi|323155285|gb|EFZ41468.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           EPECa14]
 gi|323160758|gb|EFZ46694.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           E128010]
 gi|323173226|gb|EFZ58855.1| pantetheine-phosphate adenylyltransferase [Escherichia coli LT-68]
 gi|323179396|gb|EFZ64963.1| pantetheine-phosphate adenylyltransferase [Escherichia coli 1180]
 gi|323182662|gb|EFZ68065.1| pantetheine-phosphate adenylyltransferase [Escherichia coli 1357]
 gi|323376485|gb|ADX48753.1| pantetheine-phosphate adenylyltransferase [Escherichia coli KO11]
 gi|323944087|gb|EGB40167.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H120]
 gi|323959882|gb|EGB55530.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H489]
 gi|323971276|gb|EGB66521.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA007]
 gi|324019743|gb|EGB88962.1| pantetheine-phosphate adenylyltransferase [Escherichia coli MS
           117-3]
 gi|324116027|gb|EGC09953.1| pantetheine-phosphate adenylyltransferase [Escherichia coli E1167]
 gi|326337367|gb|EGD61202.1| Phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. 1044]
 gi|326339892|gb|EGD63699.1| Phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. 1125]
 gi|331062536|gb|EGI34456.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA271]
 gi|331068023|gb|EGI39421.1| pantetheine-phosphate adenylyltransferase [Escherichia coli TA280]
 gi|331072897|gb|EGI44222.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H591]
 gi|331077668|gb|EGI48880.1| pantetheine-phosphate adenylyltransferase [Escherichia coli H299]
 gi|332089486|gb|EGI94590.1| pantetheine-phosphate adenylyltransferase [Shigella boydii 3594-74]
 gi|332104948|gb|EGJ08294.1| pantetheine-phosphate adenylyltransferase [Shigella sp. D9]
          Length = 159

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 95/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK-KPMFTLEERVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|192291249|ref|YP_001991854.1| phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           TIE-1]
 gi|229541047|sp|B3QIM6|COAD_RHOPT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|192284998|gb|ACF01379.1| pantetheine-phosphate adenylyltransferase [Rhodopseudomonas
           palustris TIE-1]
          Length = 169

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 97/162 (59%), Gaps = 1/162 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++  A++  + LV+AIG +  K K   + +ER  ++++  
Sbjct: 1   MSRIALYPGSFDPVTNGHLDVVRHAVALCDKLVVAIGIHPGK-KPLFTTEERLAMVERVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +       +++ L V  A+ + A +++RGLRD TD DYEM++  +N  + P I 
Sbjct: 60  GPVAKAAGCDFGCTTYDNLTVTAAEKVGATIMIRGLRDGTDLDYEMQIAGMNETMAPAIH 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ L A    R +T+TL+R + ++  D+++FVP  V   LK+
Sbjct: 120 TVFLPASVGVRPITATLVRQIAAMGGDVSAFVPAEVASALKS 161


>gi|320160932|ref|YP_004174156.1| phosphopantetheine adenylyltransferase [Anaerolinea thermophila
           UNI-1]
 gi|319994785|dbj|BAJ63556.1| phosphopantetheine adenylyltransferase [Anaerolinea thermophila
           UNI-1]
          Length = 171

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 98/161 (60%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A + G+FDPI  GHM+I ++A +  ++L++A+    +K   F S +ER EL+KQ+ F
Sbjct: 1   MVRAFFPGTFDPIHYGHMNIALRASNLFDELIVAVYDRPLKNLLF-SPEERMELVKQAFF 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                   ++ VI + GL V+  ++  AQVIVRGLR  +DF+YE RM   N  L P+I  
Sbjct: 60  -----GQEKIRVIGYRGLTVDACRENGAQVIVRGLRVFSDFEYEFRMALANHRLAPDIEV 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           IAL   E   +++S+ +R + ++  DI+S VP  V + LK+
Sbjct: 115 IALITNEEHTFLSSSTVREIAALGGDISSMVPPHVEIALKD 155


>gi|85710786|ref|ZP_01041847.1| phosphopantetheine adenylyltransferase [Idiomarina baltica OS145]
 gi|85695190|gb|EAQ33127.1| phosphopantetheine adenylyltransferase [Idiomarina baltica OS145]
          Length = 163

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 97/162 (59%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R+A+Y G+FDPITNGH D+I +A S   ++++ +   S   K   S+QER  L +Q  
Sbjct: 1   MHRRAIYPGTFDPITNGHADLIERAASLFSEIIVGV-AESPSKKPLFSLQERVLLAQQ-- 57

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              + +  + V V+ F GL VN AKD  A V++RGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 58  ---VTEKLDNVRVVGFSGLLVNFAKDHDASVLIRGLRAVSDFEYEFQLANMNRRLFPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           ++ L   E + +++STL++ +     D+  FV   V   L+ 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVGEFVDGRVAEALQQ 156


>gi|114327882|ref|YP_745039.1| phosphopantetheine adenylyltransferase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316056|gb|ABI62116.1| phosphopantetheine adenylyltransferase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 183

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 91/153 (59%), Gaps = 1/153 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+R  VY G+FDP+TNGH+D+I +A    + LVI +  N  K   F  ++ER +L++   
Sbjct: 9   MLRTGVYPGTFDPVTNGHLDVITRAARMFDRLVIGVAANIGKNPVF-PLEERVDLVRAET 67

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +   + V+ F  L ++ A+   A +IVRGLR ++DFDYE++M   N  L P+I 
Sbjct: 68  VTLGGKTGTIIEVVPFSSLLIDFARQHGASIIVRGLRAVSDFDYEVQMAGTNYRLAPDIE 127

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           T+ L A E  ++++S  ++ +  +  DI++FVP
Sbjct: 128 TVFLMASERHQFISSRFVKEIARLGGDISTFVP 160


>gi|194431310|ref|ZP_03063603.1| pantetheine-phosphate adenylyltransferase [Shigella dysenteriae
           1012]
 gi|194420765|gb|EDX36841.1| pantetheine-phosphate adenylyltransferase [Shigella dysenteriae
           1012]
 gi|320179970|gb|EFW54912.1| Phosphopantetheine adenylyltransferase [Shigella boydii ATCC 9905]
 gi|332084478|gb|EGI89673.1| pantetheine-phosphate adenylyltransferase [Shigella dysenteriae
           155-74]
          Length = 159

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 95/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK-KPMFTLEERVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPPKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|115375421|ref|ZP_01462682.1| pantetheine-phosphate adenylyltransferase [Stigmatella aurantiaca
           DW4/3-1]
 gi|310821113|ref|YP_003953471.1| pantetheine-phosphate adenylyltransferase [Stigmatella aurantiaca
           DW4/3-1]
 gi|115367548|gb|EAU66522.1| pantetheine-phosphate adenylyltransferase [Stigmatella aurantiaca
           DW4/3-1]
 gi|309394185|gb|ADO71644.1| Pantetheine-phosphate adenylyltransferase [Stigmatella aurantiaca
           DW4/3-1]
          Length = 163

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 94/152 (61%), Gaps = 7/152 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+TNGH+ +I + L   + L++AI  N  KT  F S++ER +LI+++  
Sbjct: 1   MPVAIYPGSFDPLTNGHLSLIQRGLKMFDRLIVAIAVNPKKTPLF-SLEERKQLIREAC- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                   RV V SF+GL V  A+     V++RGLR ++DF++E ++ ++NR L P+I T
Sbjct: 59  -----QDPRVEVDSFQGLLVQYAQRRQVNVLIRGLRAVSDFEFEFQLANMNRKLEPDIET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + +   E   Y++S L+R + S+  D+T  VP
Sbjct: 114 VFMMTGEDYFYISSQLVREVASLGGDVTGLVP 145


>gi|118602386|ref|YP_903601.1| phosphopantetheine adenylyltransferase [Candidatus Ruthia magnifica
           str. Cm (Calyptogena magnifica)]
 gi|118567325|gb|ABL02130.1| Phosphopantetheine adenylyltransferase [Candidatus Ruthia magnifica
           str. Cm (Calyptogena magnifica)]
          Length = 159

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 66/162 (40%), Positives = 103/162 (63%), Gaps = 7/162 (4%)

Query: 1   MMRK-AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           MM+K A+Y GSFDPITNGH+D+I +A    ++++I I  NS K K FLSI +R      +
Sbjct: 1   MMKKIAIYPGSFDPITNGHIDLIKRASKLFDEIIIGITQNS-KKKAFLSIDDRINAANTT 59

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           +     D  N + V+SF  L V+     +AQVI+RGLR ++DF+YE +++S+N+ L P I
Sbjct: 60  L----KDIGN-IKVLSFNTLLVDFVAKQNAQVILRGLRAVSDFEYEFQLSSMNKHLNPNI 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            T+ + + E    ++S+L+R ++++  DI+ FVP  V   LK
Sbjct: 115 ETLFMTSAEKYANISSSLVREILTLGGDISIFVPTSVEALLK 156


>gi|56964142|ref|YP_175873.1| phosphopantetheine adenylyltransferase [Bacillus clausii KSM-K16]
 gi|61212496|sp|Q5WFE8|COAD_BACSK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|56910385|dbj|BAD64912.1| phosphopantetheine adenylyltransferase [Bacillus clausii KSM-K16]
          Length = 159

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 100/162 (61%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++A+ +GSFDP+TNGH+D+  +A +  ++++IAI  N+ K K    + ER  L+++SI 
Sbjct: 1   MKRAICSGSFDPVTNGHIDLFERAGALFDEIIIAILINN-KKKPLFPLAERERLLRESIA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H         ++ SF+GL V+ A++  A  IVRGLR   DF+YE  + ++N+ L P++ T
Sbjct: 60  HI-----KNATIDSFDGLLVDYAREKEATAIVRGLRSNADFEYEKNIATMNKELAPQLDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + L    +  YV+S++++ + S   D++  VP PV   LK +
Sbjct: 115 LFLMTDPNYSYVSSSIVKEVASYSQDVSKLVPQPVAHALKEV 156


>gi|322373582|ref|ZP_08048118.1| pantetheine-phosphate adenylyltransferase [Streptococcus sp. C150]
 gi|321278624|gb|EFX55693.1| pantetheine-phosphate adenylyltransferase [Streptococcus sp. C150]
          Length = 165

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 93/157 (59%), Gaps = 5/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A++TGSFDPITNGHMDII +A    ++L I +  N  K +GF  +  R  ++ + +
Sbjct: 1   MTQIAMFTGSFDPITNGHMDIIARASKLFDELYIGLFYNKNK-QGFWDVATRKRILDEVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F     N   + + + LAV++A+D+    +VRGLR+ TDFDYE  M   N+ L PE+ 
Sbjct: 60  VDF----PNVKVITAHDSLAVDVARDLGVTYLVRGLRNATDFDYEANMDYFNKGLAPELE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           T+ L A      V+S+ +R LI  + DI+S+VP  V 
Sbjct: 116 TVYLIASHEVTPVSSSRVRELIYFEGDISSYVPQAVV 152


>gi|254463334|ref|ZP_05076750.1| pantetheine-phosphate adenylyltransferase [Rhodobacterales
           bacterium HTCC2083]
 gi|206679923|gb|EDZ44410.1| pantetheine-phosphate adenylyltransferase [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 163

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 96/161 (59%), Gaps = 1/161 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII +A + V+ LVI +  N  K   F S++ER E+I+++  
Sbjct: 1   MRTGLYPGTFDPVTLGHIDIIRRACALVDKLVIGVAINRDKGPLF-SLEERVEMIERTCA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   + V  FE L ++ A+D+ AQ+IVRGLR + DF+YE +M  +NR L   I T
Sbjct: 60  ELSAQTGTEIVVHPFENLLIDCARDVGAQIIVRGLRAVADFEYEYQMVGMNRVLDDSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L A+   + + S L++ +  +  D++SFV   V   LK 
Sbjct: 120 VFLMAEAQHQAIASKLVKEIARLGGDVSSFVTPDVKAALKE 160


>gi|291550317|emb|CBL26579.1| pantetheine-phosphate adenylyltransferase, bacterial [Ruminococcus
           torques L2-14]
          Length = 163

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 102/161 (63%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA+Y GSFDP+T GH DII ++   V+ L++ +  N  K   F S++ER +++K+ + 
Sbjct: 1   MLKAIYPGSFDPVTRGHYDIICRSCKIVDKLIVGVLNNKAKMPLF-SVEERVKMLKE-VT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P+    V +I F+GL V+ A+ I A V++RGLR +TDF+YE++M+  N+ + P+I T
Sbjct: 59  KDLPN----VEIIPFDGLLVDFAEQIGADVVIRGLRAITDFEYELQMSQTNQRMKPDIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L       Y++ST +R + +   D++ FVP+ V + L+ 
Sbjct: 115 MFLTTSIEYSYLSSTTVREIAAFGGDVSQFVPEAVEIALRE 155


>gi|91977069|ref|YP_569728.1| phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           BisB5]
 gi|123762732|sp|Q137B2|COAD_RHOPS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|91683525|gb|ABE39827.1| Phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           BisB5]
          Length = 165

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 102/163 (62%), Gaps = 3/163 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++  A++  + LV+AIG +  K K   + +ER  ++K S+
Sbjct: 1   MSRIALYPGSFDPVTNGHLDVVRHAVALCDRLVVAIGIHPGK-KPLFTTEERLMMVK-SV 58

Query: 61  FHFIPDSSN-RVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           F  + +++       +++ L V  A+ + A +++RGLRD TD DYEM++  +N  + P I
Sbjct: 59  FEPVANAAGCTFDCTTYDNLTVTSAQQVGATLMIRGLRDGTDLDYEMQIAGMNETMAPGI 118

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            T+ + A    R +T+TL+R + ++  D+++FVP  V   LK+
Sbjct: 119 HTVFVPASVGVRPITATLVRQIAAMGGDVSAFVPPDVAASLKS 161


>gi|308188652|ref|YP_003932783.1| phosphopantetheine adenylyltransferase [Pantoea vagans C9-1]
 gi|308059162|gb|ADO11334.1| Phosphopantetheine adenylyltransferase [Pantoea vagans C9-1]
          Length = 159

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 95/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+T GH+DI+ +A    + +++AI  +  K K   S+ ER  L  Q +
Sbjct: 1   MTTKAIYPGTFDPVTLGHLDIVTRAAQMFDQVILAIAASPTK-KPMFSLDERVALAGQVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V VI F  L  N A+D  A V+VRGLR ++DF+YEM++  +NR L P + 
Sbjct: 60  AH-LPN----VEVIGFSDLMANFARDQQANVLVRGLRAVSDFEYEMQLAQMNRHLLPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   E   +++S+L++ +     D+++F+P PV
Sbjct: 115 SVFLMPSEGFSFISSSLVKEVARHSGDVSAFLPAPV 150


>gi|238910240|ref|ZP_04654077.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
          Length = 159

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 94/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K    ++ER  L +++ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPGK-KPMFPLEERVALAQKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+PD V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPDNV 150


>gi|183219513|ref|YP_001837509.1| phosphopantetheine adenylyltransferase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|189909655|ref|YP_001961210.1| phosphopantetheine adenylyltransferase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|229500835|sp|B0S9J5|COAD_LEPBA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229500836|sp|B0SJR1|COAD_LEPBP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|167774331|gb|ABZ92632.1| Pantetheine-phosphate adenylyltransferase [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167777935|gb|ABZ96233.1| Phosphopantetheine adenylyltransferase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
          Length = 160

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 99/152 (65%), Gaps = 6/152 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY GSFDP TNGH+DII +A    E+++IA+  NS KT  F S +ER E+I + +FH  
Sbjct: 5   AVYPGSFDPFTNGHLDIIRRAHPLFEEIIIAVAINSKKTSLF-SPEERVEMIGK-VFH-- 60

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
               +++ + +FEGL V+  K+ +++VI+RGLR +TDFDYE  ++ +N+ L PEI T  L
Sbjct: 61  --GWDKIKIDTFEGLTVDYCKEKNSRVILRGLRAVTDFDYEYAISLMNKKLAPEIETYFL 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
            A     +V+ST+++ +      +++ VPD V
Sbjct: 119 MADNEYSFVSSTIVKEVARHGRAVSNQVPDVV 150


>gi|331655266|ref|ZP_08356265.1| pantetheine-phosphate adenylyltransferase [Escherichia coli M718]
 gi|331047281|gb|EGI19359.1| pantetheine-phosphate adenylyltransferase [Escherichia coli M718]
          Length = 194

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 96/156 (61%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER +L +Q+ 
Sbjct: 36  MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK-KPMFTLEERVDLAQQAT 94

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 95  AHL-----GNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 149

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 150 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 185


>gi|262277207|ref|ZP_06055000.1| pantetheine-phosphate adenylyltransferase [alpha proteobacterium
           HIMB114]
 gi|262224310|gb|EEY74769.1| pantetheine-phosphate adenylyltransferase [alpha proteobacterium
           HIMB114]
          Length = 165

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 100/159 (62%), Gaps = 1/159 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y G+FDPIT GH+DII +A   V++L +AI  N+ K K   +++ER +++K++I  
Sbjct: 4   RIALYPGTFDPITFGHLDIIERATKIVDELHVAIATNNEK-KCLFNLKERIDIVKKTINA 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
              +  N++ V SF  L VN  K I+A +I+RGLR + DF+YE +++ +N  L   I TI
Sbjct: 63  LPKNIKNKIKVTSFNMLTVNYCKKINASIIIRGLRVVADFEYEFQLSGMNNKLDKNIQTI 122

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            L A   ++ ++S +++ + S+  ++  F P P  ++LK
Sbjct: 123 FLTADIENQAISSRMVKEIASLKGNVAKFAPRPALIYLK 161


>gi|320201341|gb|EFW75922.1| Phosphopantetheine adenylyltransferase [Escherichia coli EC4100B]
          Length = 159

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 95/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F+ ++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMFI-LEERVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|119356842|ref|YP_911486.1| phosphopantetheine adenylyltransferase [Chlorobium phaeobacteroides
           DSM 266]
 gi|166216534|sp|A1BF85|COAD_CHLPD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|119354191|gb|ABL65062.1| pantetheine-phosphate adenylyltransferase [Chlorobium
           phaeobacteroides DSM 266]
          Length = 167

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 98/152 (64%), Gaps = 5/152 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M RKA+Y G+FDP TNGH+D++ +AL+  +++ + IG NS K K   ++ ER E+I++ +
Sbjct: 1   MKRKAIYPGTFDPFTNGHLDVLDRALNIFDEVEVVIGENSQK-KTLFTVNERLEMIREIV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F P  +  V+V+  +GL  N A+ + A+ IVRG+R + DF+YE +M+ +NR L PE+ 
Sbjct: 60  IEF-PGVT--VAVLH-DGLLANYARQVEARAIVRGVRQVKDFEYEFQMSLLNRHLYPEVT 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           T+ L       YV S++IR +  +  D++ FV
Sbjct: 116 TVFLMPNVKYTYVASSIIREVAMLGGDVSKFV 147


>gi|91791577|ref|YP_561228.1| phosphopantetheine adenylyltransferase [Shewanella denitrificans
           OS217]
 gi|123357225|sp|Q12SS1|COAD_SHEDO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|91713579|gb|ABE53505.1| Coenzyme A biosynthesis protein [Shewanella denitrificans OS217]
          Length = 168

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 100/167 (59%), Gaps = 6/167 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R+A+Y G+FDP+TNGH D+I +A    + ++I I  N  K   F +++ER E +    
Sbjct: 1   MHRRAIYPGTFDPVTNGHADLIERAAKLFKHVIIGIAANPSKQPRF-TLEERVEQLTLVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ A+D  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----DNVEVVGFSGLLVDFARDQKASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           ++ L   E + +++STL++ +     D++ FV   V + LK  + ++
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPQVALALKEKIAAM 161


>gi|29653640|ref|NP_819332.1| phosphopantetheine adenylyltransferase [Coxiella burnetii RSA 493]
 gi|153208656|ref|ZP_01946908.1| pantetheine-phosphate adenylyltransferase [Coxiella burnetii 'MSU
           Goat Q177']
 gi|154706702|ref|YP_001425125.1| phosphopantetheine adenylyltransferase [Coxiella burnetii Dugway
           5J108-111]
 gi|161830002|ref|YP_001596238.1| phosphopantetheine adenylyltransferase [Coxiella burnetii RSA 331]
 gi|165919777|ref|ZP_02219520.1| pantetheine-phosphate adenylyltransferase [Coxiella burnetii RSA
           334]
 gi|212213203|ref|YP_002304139.1| phosphopantetheine adenylyltransferase [Coxiella burnetii
           CbuG_Q212]
 gi|212218123|ref|YP_002304910.1| phosphopantetheine adenylyltransferase [Coxiella burnetii
           CbuK_Q154]
 gi|61212752|sp|Q83EM7|COAD_COXBU RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189082564|sp|A9KCX4|COAD_COXBN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189082565|sp|A9NB23|COAD_COXBR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226709001|sp|B6J5S3|COAD_COXB1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488135|sp|B6J216|COAD_COXB2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|29540902|gb|AAO89846.1| phosphopantetheine adenylyltransferase [Coxiella burnetii RSA 493]
 gi|120575842|gb|EAX32466.1| pantetheine-phosphate adenylyltransferase [Coxiella burnetii 'MSU
           Goat Q177']
 gi|154355988|gb|ABS77450.1| phosphopantetheine adenylyltransferase [Coxiella burnetii Dugway
           5J108-111]
 gi|161761869|gb|ABX77511.1| pantetheine-phosphate adenylyltransferase [Coxiella burnetii RSA
           331]
 gi|165916860|gb|EDR35464.1| pantetheine-phosphate adenylyltransferase [Coxiella burnetii RSA
           334]
 gi|212011613|gb|ACJ18994.1| phosphopantetheine adenylyltransferase [Coxiella burnetii
           CbuG_Q212]
 gi|212012385|gb|ACJ19765.1| phosphopantetheine adenylyltransferase [Coxiella burnetii
           CbuK_Q154]
          Length = 159

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 93/158 (58%), Gaps = 7/158 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y G+FDP+TNGH+DII +AL     +++A    S K    L ++ER  LI   +    
Sbjct: 5   AIYPGTFDPLTNGHVDIIERALPLFNKIIVACAPTSRKDP-HLKLEERVNLIADVL---- 59

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
             +  RV V+   GL V+ AK   A  I+RGLR ++DFDYE ++  +N  L PEI TI L
Sbjct: 60  --TDERVEVLPLTGLLVDFAKTHQANFILRGLRAVSDFDYEFQLAHMNYQLSPEIETIFL 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            A+E   YV+ T++R ++++  D++ FVP  V   L+ 
Sbjct: 118 PAREGYSYVSGTMVREIVTLGGDVSPFVPPLVARHLQK 155


>gi|320105935|ref|YP_004181525.1| pantetheine-phosphate adenylyltransferase [Terriglobus saanensis
           SP1PR4]
 gi|319924456|gb|ADV81531.1| pantetheine-phosphate adenylyltransferase [Terriglobus saanensis
           SP1PR4]
          Length = 180

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 95/159 (59%), Gaps = 5/159 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KA+Y G+FDP TNGH+D+I +    V+ LV+AI  NS K +   +  ER+ ++ + +  F
Sbjct: 5   KAIYPGTFDPPTNGHLDLIERGAKIVDHLVVAILRNSSKAEPLFTTAERAAMLTECVKPF 64

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                  VSV +F+GL V+ AK   A+ ++RG+R ++D++YE +M  +NR L PE+ TI 
Sbjct: 65  -----GNVSVATFDGLLVDFAKQEGARALLRGIRAISDYEYEFQMAMMNRKLAPELETIF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           +   E   YV+S LI+ +  +  D+   +P  V   LK+
Sbjct: 120 MMPAEKYTYVSSRLIKGVYRLGGDVAELIPPLVLERLKH 158


>gi|16762584|ref|NP_458201.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29144073|ref|NP_807415.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56415615|ref|YP_152690.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197364542|ref|YP_002144179.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|213161285|ref|ZP_03346995.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213418643|ref|ZP_03351709.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213425233|ref|ZP_03357983.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213583921|ref|ZP_03365747.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213615650|ref|ZP_03371476.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213647923|ref|ZP_03377976.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213855125|ref|ZP_03383365.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289824125|ref|ZP_06543722.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|29427886|sp|Q8Z2H1|COAD_SALTI RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|81599219|sp|Q5PC10|COAD_SALPA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541041|sp|B5BI08|COAD_SALPK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|25318320|pir||AH0971 pantetheine-phosphate adenylyltransferase (EC 2.7.7.3) - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16504889|emb|CAD03268.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139710|gb|AAO71275.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56129872|gb|AAV79378.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197096019|emb|CAR61606.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 159

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 94/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   ++ ER  L +++ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPGK-KPMFTLNERVALAQKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+PD V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPDNV 150


>gi|16767010|ref|NP_462625.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|167994346|ref|ZP_02575438.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|29427903|sp|Q8ZL48|COAD_SALTY RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|16422293|gb|AAL22584.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|205327774|gb|EDZ14538.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|261248873|emb|CBG26727.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267995986|gb|ACY90871.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301160262|emb|CBW19785.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312914751|dbj|BAJ38725.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321226778|gb|EFX51828.1| Phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|323132085|gb|ADX19515.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
          Length = 159

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 94/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   ++ ER  L +++ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPSK-KPMFTLDERVALAQKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+PD V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPDNV 150


>gi|283787733|ref|YP_003367598.1| phosphopantetheine adenylyltransferase [Citrobacter rodentium
           ICC168]
 gi|282951187|emb|CBG90880.1| phosphopantetheine adenylyltransferase [Citrobacter rodentium
           ICC168]
          Length = 159

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 94/153 (61%), Gaps = 6/153 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDP+TNGH+DII +A    + +++AI  +  K K   S++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPLTNGHIDIITRATQMFDHVILAIAASPGK-KPMFSLEERVALARQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      N V V+ F  L  + A+   A +++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHL-----NNVEVLGFSDLMASFARQQQANILIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           ++ L   +   +++S+L++ +   + D+T F+P
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHEGDVTHFLP 147


>gi|238916966|ref|YP_002930483.1| pantetheine-phosphate adenylyltransferase [Eubacterium eligens ATCC
           27750]
 gi|259491311|sp|C4Z0C3|COAD_EUBE2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|238872326|gb|ACR72036.1| pantetheine-phosphate adenylyltransferase [Eubacterium eligens ATCC
           27750]
          Length = 161

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 97/155 (62%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+KA+Y GSFDP+T GH+DII ++ S V+ L++ +  NS KT  F S++ER  ++++   
Sbjct: 1   MKKAIYPGSFDPVTLGHLDIIRRSASLVDHLIVGVLNNSTKTPLF-SVEERVNMLRE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D SN V V+SF GL V+ A + +  VI+RGLR +TDF+YE+ M+  NR   P I T
Sbjct: 57  -VTKDLSN-VEVLSFSGLLVDFAAEHNVSVIIRGLRAVTDFEYELAMSQTNRVAAPGIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           I L       Y++S++++ +     DI  FVP+ +
Sbjct: 115 IFLTTSLKYAYLSSSIVKEMAMYGGDIHKFVPEEI 149


>gi|320666347|gb|EFX33346.1| phosphopantetheine adenylyltransferase [Escherichia coli O157:H7
           str. LSU-61]
          Length = 159

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 95/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK-KPMFTLEERVVLAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|312863032|ref|ZP_07723270.1| pantetheine-phosphate adenylyltransferase [Streptococcus
           vestibularis F0396]
 gi|311100568|gb|EFQ58773.1| pantetheine-phosphate adenylyltransferase [Streptococcus
           vestibularis F0396]
          Length = 165

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 95/157 (60%), Gaps = 5/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A++TGSFDPITNGHMDII +A    ++L I +  N  K +GF  I+ R  ++++  
Sbjct: 1   MTKIAMFTGSFDPITNGHMDIIARASKLFDELYIGLFYNKNK-QGFWDIETRKRILEE-- 57

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              + D  N   + + + LAV++A+++    +VRGLR+ TDFDYE  M   N+ L PE+ 
Sbjct: 58  --VVADLPNVKVITAHDSLAVDVARELGVTYLVRGLRNATDFDYEANMDYFNKGLAPELE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           T+ L A      V+S+ +R LI  + +I+S+VP  V 
Sbjct: 116 TVYLIASHEVTPVSSSRVRELIYFEGNISSYVPQAVV 152


>gi|312886403|ref|ZP_07746012.1| pantetheine-phosphate adenylyltransferase [Mucilaginibacter paludis
           DSM 18603]
 gi|311301031|gb|EFQ78091.1| pantetheine-phosphate adenylyltransferase [Mucilaginibacter paludis
           DSM 18603]
          Length = 153

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 55/159 (34%), Positives = 101/159 (63%), Gaps = 6/159 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A++ GSFDP+T  H+DI+ ++++  + + I IG NS K KGFLSI++R ++++ ++F
Sbjct: 1   MKIALFPGSFDPVTKAHVDILKRSVALFDKVYIGIGVNSTK-KGFLSIEKREQMLR-AVF 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
              P    +V V+++EGL +N  K I A  ++RG+R ++DF+YE  +  +N  L PEI +
Sbjct: 59  ENEP----KVHVVAYEGLTINFCKQIGAGYMIRGIRTVSDFEYEKAIAQMNHALEPEIES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           I + +K     ++ST++R ++  + +   F+P     +L
Sbjct: 115 IFIVSKPGYSSISSTIVREILRYNGNAEQFIPKEALPYL 153


>gi|316934204|ref|YP_004109186.1| pantetheine-phosphate adenylyltransferase [Rhodopseudomonas
           palustris DX-1]
 gi|315601918|gb|ADU44453.1| pantetheine-phosphate adenylyltransferase [Rhodopseudomonas
           palustris DX-1]
          Length = 169

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 98/162 (60%), Gaps = 1/162 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+R A+Y GSFDP+TNGH+D++  A++  + LV+AIG +  K K   S +ER  ++++  
Sbjct: 1   MVRIALYPGSFDPVTNGHLDVVRHAVALCDKLVVAIGIHPGK-KPLFSTEERLAMVERVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +       +++ L V  A+ + A +++RGLRD +D DYEM++  +N  + P I 
Sbjct: 60  GPVAKAAGCDFGCTTYDNLTVTAAEKVGATIMIRGLRDGSDLDYEMQIAGMNETMAPAIH 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ L A    R +T+TL+R + ++  D+++FVP  V   L++
Sbjct: 120 TVFLPASVGVRPITATLVRQIAAMGGDVSAFVPAEVASALQS 161


>gi|110798570|ref|YP_696415.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           ATCC 13124]
 gi|123344667|sp|Q0TPM5|COAD_CLOP1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|110673217|gb|ABG82204.1| pantetheine-phosphate adenylyltransferase [Clostridium perfringens
           ATCC 13124]
          Length = 164

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 100/166 (60%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY GSFDPIT GH+D+I +A S  + +++A+  N +  KG  SI+ER  LI++ + 
Sbjct: 1   MRVGVYPGSFDPITKGHLDLIERAASKFDKVIVAVLIN-INKKGMFSIEERVNLIEKCVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +     N V V SF GL ++  +   A VI++GLR +TDF+YE +M  +NR L  E+ T
Sbjct: 60  KY-----NNVEVKSFNGLLIDFVRKEKADVIIKGLRSVTDFEYEFQMALMNRELANEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + +    +  Y++S+ I+ + S + +I +FVP  +   L+  + SL
Sbjct: 115 VFMVTSPNYSYISSSAIKQVASFNGEIKNFVPKEIVEDLEERISSL 160


>gi|163748881|ref|ZP_02156133.1| phosphopantetheine adenylyltransferase [Shewanella benthica KT99]
 gi|161331655|gb|EDQ02460.1| phosphopantetheine adenylyltransferase [Shewanella benthica KT99]
          Length = 159

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 94/152 (61%), Gaps = 6/152 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH D+I +A    + +VI I  N  K   F S+++R ELIK   
Sbjct: 1   MHTKAIYPGTFDPVTNGHTDLIERAARLFKHVVIGIAANPSKQPLF-SLEQRVELIKLVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----DNVEVVGFTGLLVDFAKEQQASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           ++ L   E + +++STL++ +     D++ FV
Sbjct: 115 SVFLTPAEENSFISSTLVKEVAHHGGDVSQFV 146


>gi|196231872|ref|ZP_03130728.1| pantetheine-phosphate adenylyltransferase [Chthoniobacter flavus
           Ellin428]
 gi|196223994|gb|EDY18508.1| pantetheine-phosphate adenylyltransferase [Chthoniobacter flavus
           Ellin428]
          Length = 162

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 99/161 (61%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+ +Y GSFDPITNGH+D+I +A +  +++V+A+  N  K +G  S +ER  L++++  
Sbjct: 1   MRRVIYPGSFDPITNGHLDVINRAATLFDEVVVAVAFNDQK-QGLFSAEERVSLLQEA-- 57

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   + +  F+GL ++ A+   A  +VRGLR ++DF++E +M  +NR L P+I T
Sbjct: 58  ---SGTKPNIRIARFDGLLMDFARREQATAVVRGLRAVSDFEFEFQMALMNRKLEPQIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           I L   E   Y++S +++ +  +  D++SFVP  V   L+ 
Sbjct: 115 IFLMPAEKYTYLSSRIVKEIARLGGDVSSFVPVSVAKALRE 155


>gi|161616805|ref|YP_001590770.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167549027|ref|ZP_02342786.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|168232572|ref|ZP_02657630.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168235330|ref|ZP_02660388.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168241904|ref|ZP_02666836.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168260521|ref|ZP_02682494.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168464967|ref|ZP_02698859.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|168818445|ref|ZP_02830445.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194442711|ref|YP_002042975.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194448279|ref|YP_002047757.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194470241|ref|ZP_03076225.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194733976|ref|YP_002116660.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197263631|ref|ZP_03163705.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|198242346|ref|YP_002217686.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200388561|ref|ZP_03215173.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204928500|ref|ZP_03219699.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205354673|ref|YP_002228474.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207858962|ref|YP_002245613.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|189082586|sp|A9MVM9|COAD_SALPB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226709014|sp|B5FM58|COAD_SALDC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226709015|sp|B5R5F8|COAD_SALEP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226709016|sp|B5RGF3|COAD_SALG2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541040|sp|B4TZX6|COAD_SALSV RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541042|sp|B4SXD6|COAD_SALNS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541043|sp|B4T9B9|COAD_SALHS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|161366169|gb|ABX69937.1| hypothetical protein SPAB_04624 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194401374|gb|ACF61596.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194406583|gb|ACF66802.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194456605|gb|EDX45444.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194709478|gb|ACF88699.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|195632296|gb|EDX50780.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197241886|gb|EDY24506.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197291569|gb|EDY30921.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|197936862|gb|ACH74195.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199605659|gb|EDZ04204.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204321933|gb|EDZ07131.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205274454|emb|CAR39486.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205325528|gb|EDZ13367.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205333237|gb|EDZ20001.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205338719|gb|EDZ25483.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205344325|gb|EDZ31089.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|205350157|gb|EDZ36788.1| pantetheine-phosphate adenylyltransferase [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|206710765|emb|CAR35126.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|320088145|emb|CBY97907.1| Phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|322612891|gb|EFY09843.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618956|gb|EFY15843.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625267|gb|EFY22094.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322630066|gb|EFY26839.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634257|gb|EFY30992.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635842|gb|EFY32551.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643020|gb|EFY39597.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322645052|gb|EFY41583.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649848|gb|EFY46271.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653055|gb|EFY49390.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322661126|gb|EFY57354.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322662385|gb|EFY58598.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322667263|gb|EFY63429.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674360|gb|EFY70453.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322678432|gb|EFY74493.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322680938|gb|EFY76972.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322687126|gb|EFY83099.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323195850|gb|EFZ81022.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198233|gb|EFZ83339.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323200851|gb|EFZ85921.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206605|gb|EFZ91563.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323210482|gb|EFZ95368.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323216230|gb|EGA00958.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220453|gb|EGA04907.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225316|gb|EGA09550.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323228430|gb|EGA12561.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323234251|gb|EGA18339.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237236|gb|EGA21303.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244755|gb|EGA28759.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323245870|gb|EGA29860.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323250947|gb|EGA34823.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257305|gb|EGA41004.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262229|gb|EGA45790.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323264560|gb|EGA48064.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323268850|gb|EGA52308.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326625470|gb|EGE31815.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326629812|gb|EGE36155.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 159

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 94/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   ++ ER  L +++ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPGK-KPMFTLDERVALAQKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+PD V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPDNV 150


>gi|124514748|gb|EAY56260.1| phosphopantetheine adenylyltransferase [Leptospirillum rubarum]
 gi|206602457|gb|EDZ38938.1| Phosphopantetheine adenylyltransferase [Leptospirillum sp. Group II
           '5-way CG']
          Length = 166

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 98/160 (61%), Gaps = 5/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           +KAVY G+FDP+T GH+D++ +AL+  ++++IA+  N  K+  F S++ER ELI+Q    
Sbjct: 4   KKAVYPGTFDPVTFGHLDMLNRALTIFDEILIAVAENPRKSPLF-SLEERIELIRQ---- 58

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
             P     V V+ F  L V+  +  + QVI+RG+R ++DFDYE+RM  +N+ L  +I T+
Sbjct: 59  VAPAPPPAVQVVGFHSLLVDFVRKNNCQVILRGVRAVSDFDYELRMALINQTLARDIETV 118

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   E   ++TST+IR +  +  D+   VP  V   LK 
Sbjct: 119 FLMPSEKYMFITSTMIREISELGGDLAMLVPPTVEEALKK 158


>gi|161505739|ref|YP_001572851.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189082585|sp|A9MKP0|COAD_SALAR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|160867086|gb|ABX23709.1| hypothetical protein SARI_03915 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 159

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 96/162 (59%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K   F ++ ER  L +++ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPGKNPMF-TLDERVALAQKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V  F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHL-----SNVEVAGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           ++ L   +   +++S+L++ +     D+T F+PD V   L N
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPDNVHQALMN 156


>gi|296114885|ref|ZP_06833533.1| pantetheine-phosphate adenylyltransferase [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295978591|gb|EFG85321.1| pantetheine-phosphate adenylyltransferase [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 177

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 93/151 (61%), Gaps = 1/151 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           +R   Y G+FDP+TNGH+DII +A   V  LVI +  ++ K +  LS+QER   ++  I 
Sbjct: 13  VRAGFYPGTFDPVTNGHLDIIARASRLVGRLVIGVAKDTTK-QPLLSLQERIACLRTDIA 71

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                 S  + V+ FEGL VN A    A  I RGLR + DFDYE +M+++N  L P+I T
Sbjct: 72  ALGLPPSTVIEVVGFEGLLVNAAHAHGAHAIFRGLRAVADFDYENQMSAMNTHLAPDIET 131

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L A++ ++Y++S L++ +  ++ DIT FV
Sbjct: 132 VFLMARQGNQYISSRLVKEIARLEGDITDFV 162


>gi|62182218|ref|YP_218635.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|224585525|ref|YP_002639324.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|75479874|sp|Q57IA8|COAD_SALCH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254764166|sp|C0Q1W7|COAD_SALPC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|62129851|gb|AAX67554.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|224470053|gb|ACN47883.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|322716706|gb|EFZ08277.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 159

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 94/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   ++ ER  L +++ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPGK-KPMFTLDERVALAQKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLIPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+PD V
Sbjct: 115 SVFLIPSKEWSFISSSLVKEVARHQGDVTHFLPDNV 150


>gi|86749991|ref|YP_486487.1| phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           HaA2]
 gi|123292509|sp|Q2IW34|COAD_RHOP2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|86573019|gb|ABD07576.1| Phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           HaA2]
          Length = 165

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 57/163 (34%), Positives = 101/163 (61%), Gaps = 3/163 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++  A+   + LV+AIG +  K K   + +ER  ++++ +
Sbjct: 1   MSRIALYPGSFDPVTNGHLDVVRHAVELCDRLVVAIGIHPGK-KPLFTTEERLVMVRR-V 58

Query: 61  FHFIPDSSN-RVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           F  + +++       +++ L V  A+ + A +++RGLRD TD DYEM++  +N  + P +
Sbjct: 59  FEPVAEAAGCAFDCTTYDNLTVTAAQQVGASLMIRGLRDGTDLDYEMQIAGMNETMAPGV 118

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            T+ L A    R +T+TL+R + ++  D+++FVP  V   LK+
Sbjct: 119 HTVFLPASVGVRPITATLVRQIAAMGGDVSAFVPPDVAASLKS 161


>gi|298291666|ref|YP_003693605.1| pantetheine-phosphate adenylyltransferase [Starkeya novella DSM
           506]
 gi|296928177|gb|ADH88986.1| pantetheine-phosphate adenylyltransferase [Starkeya novella DSM
           506]
          Length = 169

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 94/159 (59%), Gaps = 1/159 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A Y GSFDP TNGH ++   A   V+ L++ +G +  K+  F +  ER E++ +    
Sbjct: 5   RIAFYPGSFDPPTNGHAEVARAAARLVDKLIVGVGIHPGKSPLF-TASERLEMLHEVFEP 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
            +      +  I+F+ L V+ A+   AQ+++RGLRD TD DYEM+M  +N  L P + T+
Sbjct: 64  IVAAEGASLDCITFDNLVVDAAEAEGAQLLIRGLRDGTDLDYEMQMAGMNAVLKPRVQTV 123

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            L A   +R +T+TL+R + ++  D+++FVP  V V LK
Sbjct: 124 FLPASPIARPITATLVRQIAAMGGDVSAFVPPAVLVRLK 162


>gi|325661178|ref|ZP_08149805.1| phosphopantetheine adenylyltransferase [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|331085067|ref|ZP_08334154.1| phosphopantetheine adenylyltransferase [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|325472685|gb|EGC75896.1| phosphopantetheine adenylyltransferase [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|330408767|gb|EGG88232.1| phosphopantetheine adenylyltransferase [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 163

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 100/156 (64%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDP+T GH+D+I ++    ++L++ +  N  KT  F S++ER  ++++ + 
Sbjct: 1   MLRAIYPGSFDPVTFGHLDMIRRSGQIADELIVGVLNNKAKTPLF-SVEERVRILEE-VT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P+    V V++F+GL V  AK I A+VIVRGLR +TDF+YE++M+  N  L PEI T
Sbjct: 59  KDLPN----VKVMAFDGLLVEFAKQIGAKVIVRGLRAITDFEYELQMSQTNHKLEPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + L       +++ST ++ + +   DIT FVP+ V 
Sbjct: 115 MFLTTSLEYSFLSSTTVKEVAAFGGDITQFVPELVV 150


>gi|304414129|ref|ZP_07395497.1| Phosphopantetheine adenylyltransferase [Candidatus Regiella
           insecticola LSR1]
 gi|304283343|gb|EFL91739.1| Phosphopantetheine adenylyltransferase [Candidatus Regiella
           insecticola LSR1]
          Length = 158

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 96/153 (62%), Gaps = 6/153 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           +A+Y G+FDPITNGH+D+I +A +  E +++AI  ++ K   F +++ER  L ++    F
Sbjct: 2   RAIYPGTFDPITNGHLDVITRAAAMFEQIIVAIAQSAGKQPLF-TLEERVVLAEKVTATF 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                  V VI+F+GL VN A++  A +++RGLR + DF+YE ++  +NR L PE+ T+ 
Sbjct: 61  -----KNVKVITFDGLMVNCAREKGANILIRGLRSVADFEYESQLAKMNRHLMPELETLF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           L   E   +++S L++ +  +  DI SF+P  V
Sbjct: 116 LLPSEKYSFLSSALVKEVALLGGDIASFLPAAV 148


>gi|156972981|ref|YP_001443888.1| phosphopantetheine adenylyltransferase [Vibrio harveyi ATCC
           BAA-1116]
 gi|226706705|sp|A7MSN5|COAD_VIBHB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|156524575|gb|ABU69661.1| hypothetical protein VIBHAR_00659 [Vibrio harveyi ATCC BAA-1116]
          Length = 159

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 95/158 (60%), Gaps = 8/158 (5%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+K +Y G+FDPITNGH+DII +A +  + ++I +  +  K K   S++ER +L+++S  
Sbjct: 1   MKKVIYPGTFDPITNGHLDIITRAANMFDQIIIGVAASPSK-KTLFSLEERVKLVEESTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + VS   F GL V+ A++  A V+VRGLR   DF+YE  +TS+ R L P + +
Sbjct: 60  HL-----SNVSTAGFSGLLVDFAREQEANVLVRGLRTTVDFEYEFGLTSMYRKLLPGVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVF 159
           + L   E   +++ST++R +     D+  FVP   CV+
Sbjct: 115 VFLTPAEEYAFLSSTIVREVAIHGGDVEQFVPK--CVY 150


>gi|127514620|ref|YP_001095817.1| phosphopantetheine adenylyltransferase [Shewanella loihica PV-4]
 gi|166216600|sp|A3QJB0|COAD_SHELP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|126639915|gb|ABO25558.1| pantetheine-phosphate adenylyltransferase [Shewanella loihica PV-4]
          Length = 158

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 99/161 (61%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH D+I +A    + +VI I  N  K   F S++ER +L+K+  
Sbjct: 1   MHTKAIYPGTFDPVTNGHTDLIERAAKLFKQVVIGIAANPSKQPRF-SLEERVKLVKRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AK+ +A V+VRGLR ++DF+YE ++ ++NR L  ++ 
Sbjct: 60  EHL-----DNVEVVGFSGLLVDFAKEQNASVLVRGLRAVSDFEYEFQLANMNRRLSADLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           ++ L   E + +++STL++ +     D++ FV + V   L+
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHEEVAKALQ 155


>gi|218551162|ref|YP_002384953.1| phosphopantetheine adenylyltransferase [Escherichia fergusonii ATCC
           35469]
 gi|226706699|sp|B7LVJ5|COAD_ESCF3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|218358703|emb|CAQ91359.1| pantetheine-phosphate adenylyltransferase [Escherichia fergusonii
           ATCC 35469]
 gi|323965900|gb|EGB61348.1| pantetheine-phosphate adenylyltransferase [Escherichia coli M863]
 gi|323975146|gb|EGB70251.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           TW10509]
 gi|327250760|gb|EGE62462.1| pantetheine-phosphate adenylyltransferase [Escherichia coli
           STEC_7v]
          Length = 159

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 94/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER  L + + 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK-KPMFTLEERVALAQHAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|116628337|ref|YP_820956.1| phosphopantetheine adenylyltransferase [Streptococcus thermophilus
           LMD-9]
 gi|116101614|gb|ABJ66760.1| Phosphopantetheine adenylyltransferase [Streptococcus thermophilus
           LMD-9]
 gi|312278963|gb|ADQ63620.1| Phosphopantetheine adenylyltransferase [Streptococcus thermophilus
           ND03]
          Length = 165

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 93/157 (59%), Gaps = 5/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A++TGSFDPITNGHMDII++A    ++L I +  N  K + F  +  R  ++ +  
Sbjct: 1   MTKIAMFTGSFDPITNGHMDIIVRASKLFDELYIGLFYNKNK-QDFWDVATRKRILDE-- 57

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              + D  N   + + + LAV++A+D+    +VRGLR+ TDFDYE  M   N+ L PE+ 
Sbjct: 58  --VVADFPNVKVITAHDSLAVDVARDLGVTYLVRGLRNATDFDYEANMDYFNKGLAPELE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           T+ L A      V+S+ +R LI  + DI+S+VP  V 
Sbjct: 116 TVYLIASHEVTPVSSSRVRELIYFEGDISSYVPQAVV 152


>gi|14719581|pdb|1QJC|A Chain A, Phosphopantetheine Adenylyltransferase In Complex With
           Ampcpp And 4'-Phosphopantetheine From Escherichia Coli
 gi|14719582|pdb|1QJC|B Chain B, Phosphopantetheine Adenylyltransferase In Complex With
           Ampcpp And 4'-Phosphopantetheine From Escherichia Coli
          Length = 158

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 94/154 (61%), Gaps = 6/154 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER  L +Q+  H
Sbjct: 2   KRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK-KPMFTLEERVALAQQATAH 60

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ ++
Sbjct: 61  L-----GNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELESV 115

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
            L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 116 FLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 149


>gi|170724446|ref|YP_001758472.1| phosphopantetheine adenylyltransferase [Shewanella woodyi ATCC
           51908]
 gi|229541046|sp|B1KL36|COAD_SHEWM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|169809793|gb|ACA84377.1| pantetheine-phosphate adenylyltransferase [Shewanella woodyi ATCC
           51908]
          Length = 158

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 94/152 (61%), Gaps = 6/152 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDP+TNGH D+I +A    + +VI I  N  K   F ++ ER +L+K   
Sbjct: 1   MHKRAIYPGTFDPVTNGHADLIERAAKLFQHVVIGIAANPSKQPRF-TLDERVQLLKLVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AKD  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----DNVEVVGFSGLLVDFAKDQQASVLVRGLRAVSDFEYEFQLANMNRRLDPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           ++ L   E + +++STL++ +     D++ FV
Sbjct: 115 SVFLTPSEENSFISSTLVKEVALHGGDVSQFV 146


>gi|39935667|ref|NP_947943.1| phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           CGA009]
 gi|61212613|sp|Q6N6L4|COAD_RHOPA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|39649520|emb|CAE28042.1| phosphopantetheine adenylyltransferase [Rhodopseudomonas palustris
           CGA009]
          Length = 169

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 97/162 (59%), Gaps = 1/162 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++  A++  + LV+AIG +  K K   + +ER  ++++  
Sbjct: 1   MSRIALYPGSFDPVTNGHLDVVRHAVALCDKLVVAIGIHPGK-KPLFTTEERLAMVERVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +       +++ L V  A+ + A +++RGLRD +D DYEM++  +N  + P I 
Sbjct: 60  GPVAKAAGCDFGCTTYDNLTVTAAEKVGATLMIRGLRDGSDLDYEMQIAGMNETMAPAIH 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ L A    R +T+TL+R + ++  D+++FVP  V   LK+
Sbjct: 120 TVFLPASVGVRPITATLVRQIAAMGGDVSAFVPAEVASALKS 161


>gi|294138882|ref|YP_003554860.1| phosphopantetheine adenylyltransferase [Shewanella violacea DSS12]
 gi|293325351|dbj|BAJ00082.1| phosphopantetheine adenylyltransferase [Shewanella violacea DSS12]
          Length = 159

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 98/164 (59%), Gaps = 7/164 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH D+I +A    + +VI I  N  K   F +++ER ELIK   
Sbjct: 1   MHTKAIYPGTFDPVTNGHTDLIERAAKLFKHVVIGIAANPSKQPKF-TLEERVELIKLVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L  ++ 
Sbjct: 60  AHL-----DNVEVVGFTGLLVDFAKEQQASVLVRGLRAVSDFEYEFQLANMNRRLSADLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV-PDPVCVFLKNI 163
           ++ L   E + +++STL++ +     D++ FV P+     LK +
Sbjct: 115 SVFLTPAEENSFISSTLVKEVAYHGGDVSQFVHPEVSKALLKQV 158


>gi|259047459|ref|ZP_05737860.1| pantetheine-phosphate adenylyltransferase [Granulicatella adiacens
           ATCC 49175]
 gi|259035650|gb|EEW36905.1| pantetheine-phosphate adenylyltransferase [Granulicatella adiacens
           ATCC 49175]
          Length = 177

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 98/155 (63%), Gaps = 5/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKAV  GSFDPITNGH+DII ++    +++++ +  N V+     S+ ER  L+++ I 
Sbjct: 1   MRKAVVAGSFDPITNGHLDIIERSGELFDEVIVVLSHN-VQKNYLFSLDERKSLVEKVIE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P++  RV  +S  GL V  A  + A V+VRG+R+ TDF+YE  + S NR    E+ T
Sbjct: 60  H-VPNA--RVVAVSG-GLTVEAAVQLGASVLVRGVRNATDFEYEATLASHNRVQNGEVET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L +KE  R+V+S++++ L     D++ FVP+ V
Sbjct: 116 VLLLSKEEYRFVSSSMMKELARFGGDVSPFVPEVV 150


>gi|309775745|ref|ZP_07670741.1| pantetheine-phosphate adenylyltransferase [Erysipelotrichaceae
           bacterium 3_1_53]
 gi|308916508|gb|EFP62252.1| pantetheine-phosphate adenylyltransferase [Erysipelotrichaceae
           bacterium 3_1_53]
          Length = 158

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 97/156 (62%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A++ GSFDP+T GH+DII ++    + LV+ I  NS K   F SI+ER   +K +  
Sbjct: 1   MKTAIFPGSFDPVTLGHLDIIERSSRLFDRLVVVILENSDKHATF-SIEERLAFLKANTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V      GL V+ A+   A  IVRG+R + D++YE+ + SVN+ + P++ T
Sbjct: 60  H-LPNVEAAVD----HGLTVDFARHRKACAIVRGVRSVKDYEYELDIASVNQHIAPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + L+A     YV+S++IR L+  D DIT++VPD VC
Sbjct: 115 VLLYASPKYSYVSSSIIRELVKYDQDITAYVPDDVC 150


>gi|254444286|ref|ZP_05057762.1| pantetheine-phosphate adenylyltransferase [Verrucomicrobiae
           bacterium DG1235]
 gi|198258594|gb|EDY82902.1| pantetheine-phosphate adenylyltransferase [Verrucomicrobiae
           bacterium DG1235]
          Length = 189

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 98/161 (60%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           +MR  +Y G+FDPIT+GH+D++ +A    + +++ I  N  K + F + QER  L++ ++
Sbjct: 30  LMRICIYPGTFDPITHGHLDVLQRACRMFDKVIVGIADNPGK-QPFFNTQERVSLLEANL 88

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                  +   S+ +F GL V+ AK+  A  ++RGLR ++DF+YE +M  +NR L P+I 
Sbjct: 89  -----GQTPNASIATFSGLLVDFAKEQQATAVIRGLRAVSDFEYEFQMALMNRHLQPDIE 143

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           TI +  KE   Y +S+L++ + +  ADI+ FVP  V   LK
Sbjct: 144 TILVMTKEGYNYTSSSLVKQVATYGADISHFVPANVDQALK 184


>gi|153853067|ref|ZP_01994476.1| hypothetical protein DORLON_00461 [Dorea longicatena DSM 13814]
 gi|149753853|gb|EDM63784.1| hypothetical protein DORLON_00461 [Dorea longicatena DSM 13814]
          Length = 163

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 97/153 (63%), Gaps = 6/153 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M   +Y GSFDP+T GH+DII ++   V++LV+ +  N  KT  F S++ER +++++ + 
Sbjct: 1   MLTGIYPGSFDPVTYGHLDIIKRSAEMVDELVVGVLNNKAKTPLF-SVEERVKMLEE-VT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V +I FEGL V+ A  ++A++++RGLR +TDF+YE++M   N  L  ++ T
Sbjct: 59  KDIPN----VKIIPFEGLLVDFAHKLNAKIVIRGLRAITDFEYELQMAQTNHKLASDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           I L       Y++ST ++ + +   DI+ FVPD
Sbjct: 115 IFLITNLQYSYLSSTTVKEVAAFGGDISQFVPD 147


>gi|119773252|ref|YP_925992.1| pantetheine-phosphate adenylyltransferase [Shewanella amazonensis
           SB2B]
 gi|119765752|gb|ABL98322.1| Pantetheine-phosphate adenylyltransferase [Shewanella amazonensis
           SB2B]
          Length = 189

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 98/155 (63%), Gaps = 7/155 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDP+TNGH D+I +A +  + +VI +  +  K   F S+++R EL+K+  
Sbjct: 29  MHTRAIYPGTFDPVTNGHADLIERAANLFKHVVIGVAASPSKQPKF-SLEKRVELLKKVT 87

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AKD  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 88  AHL-----DNVEVVGFTGLLVDFAKDQQASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 142

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV-PD 154
           ++ L   E + +++STL++ +     D++ FV PD
Sbjct: 143 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPD 177


>gi|300721239|ref|YP_003710509.1| CMP-deoxy-D-manno-octulosonate-lipid A transferase [Xenorhabdus
           nematophila ATCC 19061]
 gi|297627726|emb|CBJ88252.1| CMP-deoxy-D-manno-octulosonate-lipid A transferase
           (phosphopantetheine adenylyltransferase) [Xenorhabdus
           nematophila ATCC 19061]
          Length = 160

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 96/157 (61%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M RKA+Y G+FDP+T GH+DI+ +A +  + +++AI  NS +     S++ER  L K+  
Sbjct: 1   MKRKAIYPGTFDPVTYGHLDIVTRAANMFDHILLAI-ANSDRKNPMFSLEERVTLAKEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L VN AK   A +++RG+R + DF+YE ++ ++NR    E+ 
Sbjct: 60  AHL-----ENVEVVGFSELMVNFAKKQQATILIRGVRSVADFEYECQLANMNRHFMQELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   ++  +V+S+LI+ +   D DI+SF+P+PV 
Sbjct: 115 SVFLLPSQNLSFVSSSLIKDVARHDGDISSFLPEPVA 151


>gi|164688645|ref|ZP_02212673.1| hypothetical protein CLOBAR_02290 [Clostridium bartlettii DSM
           16795]
 gi|164603058|gb|EDQ96523.1| hypothetical protein CLOBAR_02290 [Clostridium bartlettii DSM
           16795]
          Length = 165

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 97/159 (61%), Gaps = 6/159 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KA++ GSFDPITNGH+DII +A    ++L I +  N  K KG  S +ER ELIK    H 
Sbjct: 7   KAMFAGSFDPITNGHLDIICRASKIFDELQIGVLHNPNK-KGLFSFEERVELIKSCTSHL 65

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + + ++SF+GL V+   +     +VRG+R   D +YE++M  +N+ L P+I TI 
Sbjct: 66  -----DNIRIVSFDGLLVDYCHNNDICTLVRGVRSEADVNYELQMAHMNKELNPDIETIF 120

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           L       +++S+LI+ +++ DAD+ + VP+ V + LKN
Sbjct: 121 LPTNTKYSFISSSLIKEVLAFDADVRNLVPEQVLIALKN 159


>gi|260587792|ref|ZP_05853705.1| pantetheine-phosphate adenylyltransferase [Blautia hansenii DSM
           20583]
 gi|331083794|ref|ZP_08332903.1| pantetheine-phosphate adenylyltransferase [Lachnospiraceae
           bacterium 6_1_63FAA]
 gi|260542057|gb|EEX22626.1| pantetheine-phosphate adenylyltransferase [Blautia hansenii DSM
           20583]
 gi|330403219|gb|EGG82779.1| pantetheine-phosphate adenylyltransferase [Lachnospiraceae
           bacterium 6_1_63FAA]
          Length = 170

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 61/153 (39%), Positives = 98/153 (64%), Gaps = 6/153 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDP T GH+DII +A S  +++V+ +  NS K+  F S++ER  ++ +++ 
Sbjct: 1   MVRAIYPGSFDPATYGHLDIIRRAASLFDEVVVGVLNNSAKSPLF-SVEERVNIL-ENVT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V + +F+GL+VN A+   A+VI+RGLR  TDF+YE++M   NR L  ++ T
Sbjct: 59  EDIPN----VKIQAFDGLSVNFARSCEAKVIIRGLRAFTDFEYELQMAQTNRVLATDVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           + L       Y++ST ++   S  ADI++F PD
Sbjct: 115 MFLTTSLQYAYLSSTTLKEAASFGADISNFAPD 147


>gi|328950854|ref|YP_004368189.1| Phosphopantetheine adenylyltransferase [Marinithermus
           hydrothermalis DSM 14884]
 gi|328451178|gb|AEB12079.1| Phosphopantetheine adenylyltransferase [Marinithermus
           hydrothermalis DSM 14884]
          Length = 163

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/158 (36%), Positives = 94/158 (59%), Gaps = 6/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFL-SIQERSELIKQSIFHF 63
           AVY GSFDP TNGH+D++ +A    + + +A+  N  K   FL S++ER  +I+++  H 
Sbjct: 3   AVYPGSFDPFTNGHLDVVQRASRLFDRVTVAVLVNPRKENRFLFSVEERLAIIREATQHL 62

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                N V V SF GL  +  +   A+VIV+GLR ++DF+YE++M  +NR L PE+ T+ 
Sbjct: 63  -----NNVEVESFSGLLADYMRHKGARVIVKGLRAVSDFEYELQMAHLNRQLNPEVETLF 117

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + A     Y++ST+++ +     D++ FVP      L+
Sbjct: 118 VMAATRWSYISSTMVKEIARYGGDVSRFVPKATAEALE 155


>gi|329768888|ref|ZP_08260316.1| pantetheine-phosphate adenylyltransferase [Gemella sanguinis M325]
 gi|328837251|gb|EGF86888.1| pantetheine-phosphate adenylyltransferase [Gemella sanguinis M325]
          Length = 163

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 63/154 (40%), Positives = 99/154 (64%), Gaps = 7/154 (4%)

Query: 1   MMRK-AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           M RK A+  GSFDPIT GH+DII ++    +++++AI  N  K K   +++ER E+I +S
Sbjct: 1   MKRKIAIVPGSFDPITYGHIDIIKRSTQLFDEVIVAILVNPDK-KYLFTLEEREEMINES 59

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           I  F     N V V SF GL VN AK +++ VIVRGLR ++DF+YEM++T +N+ L   I
Sbjct: 60  IKDF-----NNVKVDSFSGLLVNYAKKVNSTVIVRGLRAVSDFEYEMQLTFMNKALDDNI 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
            T  + A +   +++S++++ +    AD++ FVP
Sbjct: 115 ETFYMMANKQYSFISSSIVKGVSGFGADLSKFVP 148


>gi|148255732|ref|YP_001240317.1| phosphopantetheine adenylyltransferase [Bradyrhizobium sp. BTAi1]
 gi|166216060|sp|A5EJR7|COAD_BRASB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|146407905|gb|ABQ36411.1| Phosphopantetheine adenylyltransferase [Bradyrhizobium sp. BTAi1]
          Length = 164

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 96/161 (59%), Gaps = 1/161 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++ QA+   + L++A+G +  K K   S +ER  ++ + +
Sbjct: 1   MQRIALYPGSFDPVTNGHLDVVRQAVHLCDRLIVAVGVHHGK-KPLFSTEERLAMVHEVL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +       +++ L V  A+   A +++RGLRD TDFDYEM++  +N+ + P I 
Sbjct: 60  EPVAAAAGCGFEASTYDDLTVTAAQKAGAIMMIRGLRDGTDFDYEMQLAGMNQTMVPGIQ 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ + A  + R + +TL+R + ++  D++ FVP  V   LK
Sbjct: 120 TVFVPASVAVRPIAATLVRQIAAMGGDVSHFVPAAVAASLK 160


>gi|255524277|ref|ZP_05391236.1| pantetheine-phosphate adenylyltransferase [Clostridium
           carboxidivorans P7]
 gi|296185396|ref|ZP_06853806.1| pantetheine-phosphate adenylyltransferase [Clostridium
           carboxidivorans P7]
 gi|255512102|gb|EET88383.1| pantetheine-phosphate adenylyltransferase [Clostridium
           carboxidivorans P7]
 gi|296050230|gb|EFG89654.1| pantetheine-phosphate adenylyltransferase [Clostridium
           carboxidivorans P7]
          Length = 160

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 96/155 (61%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR AVY GSFDPITNGH+DII ++    ++LV+ +  N  K KG   I+ER ELIK+++ 
Sbjct: 1   MRTAVYPGSFDPITNGHLDIIKRSSKVFDELVVGVLVNPQK-KGLFDIEERVELIKKAVK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V V SF GL +N  +   A+VIV+GLR ++DF+YE +M+ +N  L P I T
Sbjct: 60  D-IPN----VKVESFSGLLINFLRQKHAKVIVKGLRAVSDFEYEFQMSLMNSKLDPNIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + + A   + +++S+ ++ +      I   VPD V
Sbjct: 115 VFMMASAGNSFLSSSSVKQVAMFGGCIQGLVPDSV 149


>gi|149908606|ref|ZP_01897268.1| phosphopantetheine adenylyltransferase [Moritella sp. PE36]
 gi|149808440|gb|EDM68377.1| phosphopantetheine adenylyltransferase [Moritella sp. PE36]
          Length = 164

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 96/157 (61%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  K +Y G+FDP+TNGH D+I +A    + +++ +  N+ K K F  ++ER +L K   
Sbjct: 1   MTVKVIYPGTFDPVTNGHTDLIERAAKLFDHVIVGVAFNATK-KPFFDLKERVQLAKDVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AK+ +A V++RGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----DNVEVVGFSGLLVDFAKEYNASVLIRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E + +++STL++ +   + D+  FV   VC
Sbjct: 115 SVFLTPSEENSFISSTLVKEVAIHNGDVAQFVDPIVC 151


>gi|126172324|ref|YP_001048473.1| phosphopantetheine adenylyltransferase [Shewanella baltica OS155]
 gi|304411988|ref|ZP_07393598.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           OS183]
 gi|307305883|ref|ZP_07585629.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           BA175]
 gi|166216598|sp|A3CYP1|COAD_SHEB5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|125995529|gb|ABN59604.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           OS155]
 gi|304349538|gb|EFM13946.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           OS183]
 gi|306911376|gb|EFN41802.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           BA175]
          Length = 163

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 58/157 (36%), Positives = 94/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH D+I +A    + +VI I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHADLIERAAKLFKHVVIGIAANPSKQPRF-TLEERVELVNRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----DNVEVVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E + +++STL++ +     D+  FV   V 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVNQFVHSEVA 151


>gi|266623326|ref|ZP_06116261.1| pantetheine-phosphate adenylyltransferase [Clostridium hathewayi
           DSM 13479]
 gi|288864903|gb|EFC97201.1| pantetheine-phosphate adenylyltransferase [Clostridium hathewayi
           DSM 13479]
          Length = 161

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 95/156 (60%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDP+T GH+DII ++    + L+I +  N+ KT  F S+QER  ++K+   
Sbjct: 1   MKTAVYPGSFDPVTLGHLDIIERSARMSDQLIIGVLNNNSKTPLF-SVQERVNMLKE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             I      V V +F GL ++  +D  A V++RGLR +TDF+YE+++   NR + PE+ T
Sbjct: 57  --ITKDLGNVEVKAFAGLLIDFVRDNQADVVIRGLRAVTDFEYELQLAQTNRVIAPEVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I L       Y++S++++ +   D DI++FVP  V 
Sbjct: 115 IFLTTNLKYSYLSSSIVKEIAFYDGDISAFVPASVA 150


>gi|126735622|ref|ZP_01751367.1| pantetheine-phosphate adenylyltransferase [Roseobacter sp. CCS2]
 gi|126714809|gb|EBA11675.1| pantetheine-phosphate adenylyltransferase [Roseobacter sp. CCS2]
          Length = 164

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 93/161 (57%), Gaps = 1/161 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T+GH+DII +A S V+ LVI +  N  K   F +++ER  +I+    
Sbjct: 1   MRVGLYPGTFDPVTHGHLDIIQRACSLVDRLVIGVAINRDKGPMF-TLEERVAMIEAETA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    +   + V  FE L +N A+D+ A VI+RGLR + DF+YE +M  +NR L   I T
Sbjct: 60  HLGAQTGCIIDVHPFENLLINCARDVGASVIIRGLRAVADFEYEYQMVGMNRVLDNSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L A+   + + S L++ +  +  D++ FV   V   LK 
Sbjct: 120 VFLMAEAQHQAIASKLVKEIARLGGDVSKFVTPAVNTALKK 160


>gi|190573791|ref|YP_001971636.1| phosphopantetheine adenylyltransferase [Stenotrophomonas
           maltophilia K279a]
 gi|229541064|sp|B2FLW4|COAD_STRMK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|190011713|emb|CAQ45332.1| putative phosphopantetheine adenylyltransferase [Stenotrophomonas
           maltophilia K279a]
          Length = 169

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 95/161 (59%), Gaps = 6/161 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K    L +++R +L + ++ H
Sbjct: 7   RIAVYPGTFDPITNGHIDLVSRAAPLFEKVVVGVAQSPSKGPA-LPLEQRVQLARGALGH 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V VI F+ L  +  + +   V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  H-----GNVEVIGFDTLLAHFVRSVQGGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            L   E   +++S+L+R +  +  D++ FVP  V   L+ +
Sbjct: 121 FLTPAEQHSFISSSLVREIARLGGDVSGFVPAAVLEALRKV 161


>gi|307133076|ref|YP_003885092.1| phosphopantetheine adenylyltransferase [Dickeya dadantii 3937]
 gi|306530605|gb|ADN00536.1| Phosphopantetheine adenylyltransferase [Dickeya dadantii 3937]
          Length = 159

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 100/165 (60%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDP+TNGH+D++ +A    + L++AI  +  K K   +++ER  L K++ 
Sbjct: 1   MKTRAIYPGTFDPLTNGHLDLLTRAARMFDHLILAIAASPGK-KTLFTLEERVALAKEAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V VI F  L  N A+   A ++VRGLR ++DF+YE+++  +N  L P + 
Sbjct: 60  QH-LPN----VEVIGFTDLMANFARQQQATILVRGLRAVSDFEYELQLAKMNHHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           +I L   E   +++S+L++ +     D++ F+P P+ + L+  ++
Sbjct: 115 SIFLMPSEQWSFISSSLVKEVARHGGDVSHFLPAPIALALQQKLV 159


>gi|293609052|ref|ZP_06691355.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829625|gb|EFF87987.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 163

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 92/154 (59%), Gaps = 6/154 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER EL + S+ H 
Sbjct: 5   RVIYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHKNPLF-SLEERVELAQTSLSHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V  + F+GL VN  K+  A  ++RGLR ++DF+YE ++ ++NR L P    + 
Sbjct: 64  -----SNVEFVGFDGLLVNFFKEQKATAVLRGLRAVSDFEYEFQLANMNRQLDPHFEAVF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           L   E   +++STLIR +  +  D+T FVP  V 
Sbjct: 119 LTPSEQYSFISSTLIREIARLKGDVTKFVPQAVV 152


>gi|260599931|ref|YP_003212502.1| phosphopantetheine adenylyltransferase [Cronobacter turicensis
           z3032]
 gi|260219108|emb|CBA34463.1| Phosphopantetheine adenylyltransferase [Cronobacter turicensis
           z3032]
          Length = 159

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 94/153 (61%), Gaps = 6/153 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH+DII +A S  ++L++A+  +  K K   S+ ER +L +Q+ 
Sbjct: 1   MTTRAIYPGTFDPITNGHLDIITRAASMFDELILAVAASPHK-KTMFSLDERVDLAQQAA 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    VSV  F  L  N A+   A V+VRGLR   DF+YEM++  +NR L P + 
Sbjct: 60  AH-LPN----VSVTGFSDLMANFAQAQQANVLVRGLRTAGDFEYEMQLAHMNRHLMPSLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           ++ L   +   +++S+L++ +     D++ F+P
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHKGDVSHFMP 147


>gi|120596893|ref|YP_961467.1| phosphopantetheine adenylyltransferase [Shewanella sp. W3-18-1]
 gi|166216603|sp|A1RE18|COAD_SHESW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|120556986|gb|ABM22913.1| pantetheine-phosphate adenylyltransferase [Shewanella sp. W3-18-1]
          Length = 163

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 96/160 (60%), Gaps = 6/160 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH+D+I +A    + + I I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHVDLIERAAKLFKHVTIGIAANPSKQPRF-TLEERVELVNRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----DNVEVVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           ++ L   E + +++STL++ +     D++ FV   V   L
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPEVTAAL 154


>gi|260433863|ref|ZP_05787834.1| pantetheine-phosphate adenylyltransferase [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417691|gb|EEX10950.1| pantetheine-phosphate adenylyltransferase [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 163

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 92/161 (57%), Gaps = 1/161 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A   V+ LVI +  N  K   F S++ER  +I+    
Sbjct: 1   MRVGLYPGTFDPITLGHIDIIRRAAMLVDKLVIGVAINRDKGPLF-SLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H    +   +    FE L ++ A+D+ AQ+IVRGLR + DF+YE +M  +NR L   I T
Sbjct: 60  HLTEQTGTEIVAHPFENLLIDCARDVGAQIIVRGLRAVADFEYEFQMVGMNRALDDSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L A+   + + S L++ +  +  D++ FV   V + LK 
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLGGDVSKFVTPQVNIALKE 160


>gi|160877572|ref|YP_001556888.1| phosphopantetheine adenylyltransferase [Shewanella baltica OS195]
 gi|189082588|sp|A9KWX0|COAD_SHEB9 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|160863094|gb|ABX51628.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           OS195]
 gi|315269770|gb|ADT96623.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           OS678]
          Length = 163

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 95/157 (60%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH D+I +A    + ++I I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHADLIERAAKLFKHVIIGIAANPSKQPRF-TLEERVELVNRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----DNVEVVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E + +++STL++ +     D++ FV   V 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHSEVA 151


>gi|146294969|ref|YP_001185393.1| phosphopantetheine adenylyltransferase [Shewanella putrefaciens
           CN-32]
 gi|166216601|sp|A4YCB1|COAD_SHEPC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|145566659|gb|ABP77594.1| pantetheine-phosphate adenylyltransferase [Shewanella putrefaciens
           CN-32]
          Length = 163

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 96/160 (60%), Gaps = 6/160 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH+D+I +A    + + I I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHVDLIERAAKLFKHVTIGIAANPSKQPRF-TLEERVELVNRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----DNVDVVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           ++ L   E + +++STL++ +     D++ FV   V   L
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPEVAAAL 154


>gi|313904063|ref|ZP_07837443.1| pantetheine-phosphate adenylyltransferase [Eubacterium
           cellulosolvens 6]
 gi|313471212|gb|EFR66534.1| pantetheine-phosphate adenylyltransferase [Eubacterium
           cellulosolvens 6]
          Length = 161

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 62/152 (40%), Positives = 96/152 (63%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH+DI+ +A    + ++I +  NS KT  F S+ ER  ++K++  
Sbjct: 1   MSIAVYPGTFDPVTYGHIDIVKRASKLFDTVIIGVLHNSAKTPLF-SVDERVNILKKAT- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V V +FEGL+V+ A++  A VIVRGLR +TDF+YE++M   N+ L P++ T
Sbjct: 59  EDIPN----VQVHAFEGLSVDFARECGANVIVRGLRLITDFEYELQMAQTNKKLAPDVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
             LF      Y++ST ++ + +   DI+ FVP
Sbjct: 115 TFLFTSLQYSYLSSTTVKEVAAFGGDISEFVP 146


>gi|194365328|ref|YP_002027938.1| phosphopantetheine adenylyltransferase [Stenotrophomonas
           maltophilia R551-3]
 gi|254523528|ref|ZP_05135583.1| pantetheine-phosphate adenylyltransferase [Stenotrophomonas sp.
           SKA14]
 gi|229541063|sp|B4SS16|COAD_STRM5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|194348132|gb|ACF51255.1| pantetheine-phosphate adenylyltransferase [Stenotrophomonas
           maltophilia R551-3]
 gi|219721119|gb|EED39644.1| pantetheine-phosphate adenylyltransferase [Stenotrophomonas sp.
           SKA14]
          Length = 169

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K    L +++R +L + ++ H
Sbjct: 7   RIAVYPGTFDPITNGHIDLVSRAAPLFEKVVVGVAQSPSKGPA-LPLEQRVQLARGALGH 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                 + V VI F+ L  +  + +   V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  H-----SNVEVIGFDTLLAHFVRSVQGGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            L   E   +++S+L+R +  +  D++ FVP  V   L+ +
Sbjct: 121 FLTPAEQHSFISSSLVREIARLGGDVSGFVPAAVLEALRKV 161


>gi|166031897|ref|ZP_02234726.1| hypothetical protein DORFOR_01598 [Dorea formicigenerans ATCC
           27755]
 gi|166028350|gb|EDR47107.1| hypothetical protein DORFOR_01598 [Dorea formicigenerans ATCC
           27755]
          Length = 164

 Score =  117 bits (292), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 98/155 (63%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++A+Y GSFDP+T GH+DII ++   V++LVI +  N+ KT  F S++ER +++ +   
Sbjct: 1   MKRAIYPGSFDPVTYGHLDIIRRSAPLVDELVIGVLNNNAKTPLF-SVEERVKMLNE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D +N V V+ F+GL V  AK + A +IVRGLR +TDF+YE++M   N  L P + T
Sbjct: 57  -VTRDMTN-VIVVPFDGLLVEFAKKMDACMIVRGLRAITDFEYELQMAQTNHKLEPSVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L       Y++ST+++ +     DI+ FVPD V
Sbjct: 115 VFLTTSLEYSYLSSTIVKEVAFYHGDISKFVPDVV 149


>gi|148653803|ref|YP_001280896.1| pantetheine-phosphate adenylyltransferase [Psychrobacter sp.
           PRwf-1]
 gi|148572887|gb|ABQ94946.1| pantetheine-phosphate adenylyltransferase [Psychrobacter sp.
           PRwf-1]
          Length = 169

 Score =  117 bits (292), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 60/155 (38%), Positives = 95/155 (61%), Gaps = 8/155 (5%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K VY G+FDPITNGH D++ +A+   +++VIA+     K K   S +ER EL+ +S+F  
Sbjct: 10  KVVYPGTFDPITNGHRDLVKRAVKLFDEVVIAVALGHHK-KPMFSFEERVELV-ESVFED 67

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           +P    +VSV+ FEGL V   ++  A  ++RGLR M+DF+YE ++ ++NR L      + 
Sbjct: 68  LP----QVSVVGFEGLLVEFMREQQATAVLRGLRAMSDFEYEFQLANMNRELDENFEAVF 123

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           L       +++ST+IR +  ++ D+  FV  PVCV
Sbjct: 124 LTPAPEYSFISSTMIREIAKLNGDVDKFV--PVCV 156


>gi|259906763|ref|YP_002647119.1| Phosphopantetheine adenylyltransferase [Erwinia pyrifoliae Ep1/96]
 gi|224962385|emb|CAX53840.1| Phosphopantetheine adenylyltransferase [Erwinia pyrifoliae Ep1/96]
 gi|283476549|emb|CAY72377.1| kdtB [Erwinia pyrifoliae DSM 12163]
          Length = 158

 Score =  117 bits (292), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+DI+ +A    + +V+AI  +  K K   S++ER  L  + +
Sbjct: 1   MSTKAIYPGTFDPMTNGHLDIVTRAARMFDRIVLAIAASPSK-KPMFSLEERVALASEVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V+ F  L  N AK   A V+VRGLR ++DF+YEM++  +NR L P + 
Sbjct: 60  AH-LPN----VDVVGFSDLLANFAKAQQANVLVRGLRAVSDFEYEMQLAQMNRHLLPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           ++ L   E   +++S+L++ +     D+ SF+P  V   LK
Sbjct: 115 SVFLMPSEQYAFISSSLMKEVARHGGDVESFLPTAVYQALK 155


>gi|320546291|ref|ZP_08040611.1| pantetheine-phosphate adenylyltransferase [Streptococcus equinus
           ATCC 9812]
 gi|320449068|gb|EFW89791.1| pantetheine-phosphate adenylyltransferase [Streptococcus equinus
           ATCC 9812]
          Length = 165

 Score =  117 bits (292), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 104/174 (59%), Gaps = 11/174 (6%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M++    TGSFDP+TNGH+DII +A    + L + I  N  K+ G  +I ER ++I++++
Sbjct: 1   MVKIGFVTGSFDPVTNGHLDIIARASKLFDTLYVGILYNQNKS-GLFTIAERKQMIEEAV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            +F    SN   V + + LAV++A+++ A  +VRG+RD  DF+YE  M   N  L  +I 
Sbjct: 60  ANF----SNVKVVTAQDSLAVDVARELHAGYLVRGIRDAKDFEYEASMDFFNHHLANDIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIK 174
           ++ L      RYV+S+ +R L+   ADI++FVP+ V   ++       KYD++K
Sbjct: 116 SVYLLTAPDWRYVSSSRVRELMHFYADISAFVPESVVKKVEE------KYDNLK 163


>gi|113972215|ref|YP_736008.1| phosphopantetheine adenylyltransferase [Shewanella sp. MR-4]
 gi|114049467|ref|YP_740017.1| phosphopantetheine adenylyltransferase [Shewanella sp. MR-7]
 gi|123129979|sp|Q0HDB6|COAD_SHESM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123130914|sp|Q0HPJ5|COAD_SHESR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|113886899|gb|ABI40951.1| pantetheine-phosphate adenylyltransferase [Shewanella sp. MR-4]
 gi|113890909|gb|ABI44960.1| pantetheine-phosphate adenylyltransferase [Shewanella sp. MR-7]
          Length = 163

 Score =  117 bits (292), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 95/157 (60%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH D+I +A    + ++I I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHADLIERAAKLFKHVIIGIAANPSKQPRF-TLEERVELVNRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----DNVEVVGFSGLLVDFAKEQRASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E + +++STL++ +     D++ FV   V 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPEVA 151


>gi|153002827|ref|YP_001368508.1| phosphopantetheine adenylyltransferase [Shewanella baltica OS185]
 gi|217975414|ref|YP_002360165.1| phosphopantetheine adenylyltransferase [Shewanella baltica OS223]
 gi|166216599|sp|A6WUF6|COAD_SHEB8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254764168|sp|B8EDR6|COAD_SHEB2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|151367445|gb|ABS10445.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           OS185]
 gi|217500549|gb|ACK48742.1| pantetheine-phosphate adenylyltransferase [Shewanella baltica
           OS223]
          Length = 163

 Score =  117 bits (292), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 94/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH D+I +A    + ++I I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHADLIERAAKLFKHVIIGIAANPSKQPRF-TLEERVELVNRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----DNVEVVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E + +++STL++ +     D+  FV   V 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVNQFVHSEVA 151


>gi|119713350|gb|ABL97414.1| phosphopantetheine adenylyltransferase [uncultured marine bacterium
           EB80_02D08]
          Length = 160

 Score =  117 bits (292), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 100/161 (62%), Gaps = 7/161 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDPIT GHMDII +     + +V+AI  +  K K   S+++R  L  QSI+
Sbjct: 1   MRVAIYPGSFDPITYGHMDIIDRGCGLFDKIVVAIAKSESK-KPLFSLEDRINL-AQSIY 58

Query: 62  HFIPDSSNRVSVISF-EGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +++V V+ F   L V+LAKD  A  I+RGLR ++DF+YE ++ ++NR L P+I 
Sbjct: 59  K----DNDKVEVVGFPRKLTVDLAKDYGACAIIRGLRAVSDFEYEFQLATMNRSLAPDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +I L  KES  YV+S+LI+ +  +  DI+ FV   V   L+
Sbjct: 115 SIFLTPKESLIYVSSSLIKEISDLKGDISKFVHPTVAQALR 155


>gi|117922522|ref|YP_871714.1| phosphopantetheine adenylyltransferase [Shewanella sp. ANA-3]
 gi|166216602|sp|A0L2N9|COAD_SHESA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|117614854|gb|ABK50308.1| pantetheine-phosphate adenylyltransferase [Shewanella sp. ANA-3]
          Length = 163

 Score =  117 bits (292), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 95/157 (60%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH D+I +A    + ++I I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHADLIERAAKLFKHVIIGIAANPSKQPRF-TLEERVELVNRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----DNVEVVGFSGLLVDFAKEQRASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E + +++STL++ +     D++ FV   V 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPEVA 151


>gi|225874848|ref|YP_002756307.1| pantetheine-phosphate adenylyltransferase [Acidobacterium
           capsulatum ATCC 51196]
 gi|225792806|gb|ACO32896.1| pantetheine-phosphate adenylyltransferase [Acidobacterium
           capsulatum ATCC 51196]
          Length = 162

 Score =  117 bits (292), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 93/164 (56%), Gaps = 6/164 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KA+Y GSFDP+TNGH+D+I +     + LV+AI  NS K   F    ER E++ + +  F
Sbjct: 5   KAIYPGSFDPVTNGHLDLIARGAKMFDHLVVAILRNSTKAPLFTE-AERVEMLTEGVRGF 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                  VSV +F GL V+ A++  A  ++RG+R ++D++YE +M  +NR L PE+ TI 
Sbjct: 64  -----GNVSVATFHGLLVDFAREQKANAVLRGIRAISDYEYEFQMALMNRRLAPEVETIF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           L       +V+S LI+ +  +   +   VPD V   LK  V  L
Sbjct: 119 LMPDAKYSFVSSRLIKQVFELGGSVDGLVPDFVVERLKQRVPHL 162


>gi|148260182|ref|YP_001234309.1| pantetheine-phosphate adenylyltransferase [Acidiphilium cryptum
           JF-5]
 gi|326402876|ref|YP_004282957.1| phosphopantetheine adenylyltransferase [Acidiphilium multivorum
           AIU301]
 gi|166216050|sp|A5FXQ8|COAD_ACICJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|146401863|gb|ABQ30390.1| pantetheine-phosphate adenylyltransferase [Acidiphilium cryptum
           JF-5]
 gi|325049737|dbj|BAJ80075.1| phosphopantetheine adenylyltransferase [Acidiphilium multivorum
           AIU301]
          Length = 169

 Score =  117 bits (292), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 89/149 (59%), Gaps = 1/149 (0%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            +Y G+FDPITNGH+DII +A      LVI +  N+ K   F +  ER E+++  I    
Sbjct: 8   GLYPGTFDPITNGHLDIIGRAAQLCSKLVIGVARNAGKGPLFPTA-ERVEMVRAEIAPIA 66

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
             +   + V +F+ L +  A+ +SAQVIVRGLR ++DFDYE +M  +N  L   I TI L
Sbjct: 67  ERTGTEIDVQAFDSLLIAFAQQVSAQVIVRGLRAVSDFDYEFQMAGMNARLDQRIETIFL 126

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVP 153
            A E  ++++S  ++ +  +  DI+SFVP
Sbjct: 127 MASERHQFISSRFVKEIAQLGGDISSFVP 155


>gi|329896520|ref|ZP_08271578.1| Phosphopantetheine adenylyltransferase [gamma proteobacterium
           IMCC3088]
 gi|328921737|gb|EGG29110.1| Phosphopantetheine adenylyltransferase [gamma proteobacterium
           IMCC3088]
          Length = 161

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 96/152 (63%), Gaps = 6/152 (3%)

Query: 6   VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIP 65
           VY G+FDPITNGH+D+  +A    + +V+ I  +  KT  F S++ER EL +QS+ H +P
Sbjct: 7   VYPGTFDPITNGHVDLTERASRLFKRVVVGIAYSEKKTPMF-SLEERIELCQQSLAH-LP 64

Query: 66  DSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALF 125
           +    V V+ F  L ++  +   A  ++RGLR ++DF+YE+++ ++NR + PE  ++ L 
Sbjct: 65  N----VEVVGFNNLLIDFVRSQGANCVLRGLRAVSDFEYELQLANMNRAMHPEFESVFLT 120

Query: 126 AKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
             E   +++S+L+R +  ++ DIT FVP PV 
Sbjct: 121 PSEHLGFISSSLVREIAVLNGDITPFVPKPVA 152


>gi|319424483|gb|ADV52557.1| pantetheine-phosphate adenylyltransferase [Shewanella putrefaciens
           200]
          Length = 163

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 96/160 (60%), Gaps = 6/160 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH+D+I +A    + + I I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHVDLIERAAKLFKHVTIGIAANPSKQPRF-TLEERVELVNRIT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----DNVDVVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           ++ L   E + +++STL++ +     D++ FV   V   L
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPEVAAAL 154


>gi|212637672|ref|YP_002314197.1| phosphopantetheine adenylyltransferase [Shewanella piezotolerans
           WP3]
 gi|226706703|sp|B8CVD4|COAD_SHEPW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|212559156|gb|ACJ31610.1| Phosphopantetheine adenylyltransferase [Shewanella piezotolerans
           WP3]
          Length = 160

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 93/152 (61%), Gaps = 6/152 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDP+TNGH D+I +A    + +VI I  N  K   F ++ ER EL+K   
Sbjct: 1   MHTRAIYPGTFDPVTNGHADLIERAAKLFKHVVIGIALNPSKKPRF-TLDERIELLKTVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----DNVEVVGFSGLLVDFAKEQQASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           ++ L   E + +++STL++ +     D++ FV
Sbjct: 115 SVFLTPAEENSFISSTLVKEVAHHGGDVSQFV 146


>gi|149279405|ref|ZP_01885536.1| phosphopantetheine adenylyltransferase [Pedobacter sp. BAL39]
 gi|149229931|gb|EDM35319.1| phosphopantetheine adenylyltransferase [Pedobacter sp. BAL39]
          Length = 153

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 100/159 (62%), Gaps = 6/159 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A++ GSFDPIT  H DI+ +AL   + +V+ IG NS K + FLS ++R E+++ ++F
Sbjct: 1   MKIALFPGSFDPITIAHADILSRALPLFDKIVVGIGLNSSK-QNFLSAEQRGEIVR-TVF 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P+    V V  +EGL ++  K I+AQ +VRG+R + DF+YE  +  +N+ + PE+ T
Sbjct: 59  ADMPN----VEVALYEGLTIDFCKKINAQYMVRGIRSVGDFEYERAIAQINQTMMPEMET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           I + +K     ++ST++R ++    D++ F+P     FL
Sbjct: 115 IFILSKPEYSAISSTIVRDILRNHGDVSPFLPKAALRFL 153


>gi|24376156|ref|NP_720200.1| phosphopantetheine adenylyltransferase [Shewanella oneidensis MR-1]
 gi|29427746|sp|Q8E8I0|COAD_SHEON RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|24351199|gb|AAN57643.1|AE015900_3 phosphopantetheine adenylyltransferase [Shewanella oneidensis MR-1]
          Length = 163

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 95/157 (60%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH D+I +A    + ++I I  N  K   F +++ER EL+ +  
Sbjct: 1   MHTRAIYPGTFDPITNGHADLIERAAKLFKHVIIGIAANPSKQPRF-TLEERVELVNRVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----DNVEVVGFSGLLVDFAKEQRASVLVRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E + +++STL++ +     D++ FV   V 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPEVA 151


>gi|261341757|ref|ZP_05969615.1| hypothetical protein ENTCAN_08236 [Enterobacter cancerogenus ATCC
           35316]
 gi|288316125|gb|EFC55063.1| pantetheine-phosphate adenylyltransferase [Enterobacter
           cancerogenus ATCC 35316]
          Length = 159

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/156 (36%), Positives = 94/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPITNGH+DII +A S  + +++AI  +  K K    + ER  L   +I
Sbjct: 1   MSTKAIYPGTFDPITNGHLDIITRAASMFDKVILAIAASPSK-KPMFDLNERVALATDAI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V+ F  L  N A+   A +++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  SH-LPN----VEVVGFSDLMANFARAQQANILIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|262280054|ref|ZP_06057839.1| phosphopantetheine adenylyltransferase [Acinetobacter calcoaceticus
           RUH2202]
 gi|262260405|gb|EEY79138.1| phosphopantetheine adenylyltransferase [Acinetobacter calcoaceticus
           RUH2202]
          Length = 163

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 92/154 (59%), Gaps = 6/154 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER EL + S+ H 
Sbjct: 5   RVIYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHKNPLF-SLEERVELAQSSLSHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V  + F+GL VN  K+  A  ++RGLR ++DF+YE ++ ++NR L P    + 
Sbjct: 64  -----SNVEFVGFDGLLVNFFKEQKATAVLRGLRAVSDFEYEFQLANMNRQLDPYFEAVF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           L   E   +++STLIR +  +  D+T FVP  V 
Sbjct: 119 LTPSEQYSFISSTLIREIARLKGDVTKFVPQAVV 152


>gi|197301677|ref|ZP_03166747.1| hypothetical protein RUMLAC_00403 [Ruminococcus lactaris ATCC
           29176]
 gi|197299117|gb|EDY33647.1| hypothetical protein RUMLAC_00403 [Ruminococcus lactaris ATCC
           29176]
          Length = 164

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 100/161 (62%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDP+T GH DII ++   V++L++ +  N  K   F S++ER +++K+ + 
Sbjct: 1   MLRAIYPGSFDPVTYGHYDIICRSCKIVDELIVGVLNNKAKMPLF-SVEERVKMLKE-VT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P+    V +I F+GL V+ A+ + A +++RGLR +TDF+YE++M+  N  L P + T
Sbjct: 59  KDLPN----VRIIPFDGLLVDFAERMDADMVIRGLRAITDFEYELQMSQTNHKLSPNVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L       Y++ST +R + +   D+T FVP  V V L+ 
Sbjct: 115 MFLTTSIEYSYLSSTTVREIAAFGGDVTQFVPQAVAVELEK 155


>gi|117924734|ref|YP_865351.1| phosphopantetheine adenylyltransferase [Magnetococcus sp. MC-1]
 gi|117608490|gb|ABK43945.1| Phosphopantetheine adenylyltransferase [Magnetococcus sp. MC-1]
          Length = 164

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/164 (35%), Positives = 102/164 (62%), Gaps = 6/164 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y G+FDP+T GH+DII +A    + LV+ +  N ++ +   +++ER  L++QS+  
Sbjct: 5   RTAIYPGTFDPVTLGHVDIIRRASKLFDRLVVGVAVN-MRKQPLFAVEERVRLLEQSLAD 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                 + V+V+  +GL V  A+ + A  IVRGLR +TDFDYE +M ++NR L P+I T+
Sbjct: 64  L-----HNVTVLPMDGLLVRSARQVGACAIVRGLRVVTDFDYEFQMGTMNRKLAPDIETV 118

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            L A + + +++S++++ +  +  DIT FVP  V   L+  ++ 
Sbjct: 119 FLMADDINTFLSSSMVKEVAIMGGDITPFVPAVVAEPLRQALLQ 162


>gi|149201937|ref|ZP_01878911.1| Coenzyme A biosynthesis protein [Roseovarius sp. TM1035]
 gi|149144985|gb|EDM33014.1| Coenzyme A biosynthesis protein [Roseovarius sp. TM1035]
          Length = 163

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/155 (38%), Positives = 89/155 (57%), Gaps = 1/155 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A   V+ LV+ +  N  K   F S++ER E+I+    
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRAAVLVDRLVLGVAINRDKGPLF-SLEERVEMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L +N A D+ AQVIVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  KLSAQTGTEIVAHPFENLLINCAHDVGAQVIVRGLRAVADFEYEFQMVGMNRALDNSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L A  + + + S L++ +  +  D+T FV  PV
Sbjct: 120 VFLMADANHQAIASKLVKEIARLGGDVTKFVTPPV 154


>gi|295095220|emb|CBK84310.1| Phosphopantetheine adenylyltransferase [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 159

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 91/153 (59%), Gaps = 6/153 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPITNGH+DII +A    + +++AI  +  K K    + ER +L   +I
Sbjct: 1   MSTKAIYPGTFDPITNGHLDIITRAACMFDKVILAIAASPSK-KPMFDLNERVQLATDAI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  SHL-----SNVEVVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           ++ L   +   +++S+L++ +     D+T F+P
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHHGDVTHFLP 147


>gi|319892122|ref|YP_004148997.1| Phosphopantetheine adenylyltransferase [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317161818|gb|ADV05361.1| Phosphopantetheine adenylyltransferase [Staphylococcus
           pseudintermedius HKU10-03]
 gi|323464767|gb|ADX76920.1| pantetheine-phosphate adenylyltransferase [Staphylococcus
           pseudintermedius ED99]
          Length = 163

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/153 (39%), Positives = 101/153 (66%), Gaps = 6/153 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KAV  GSFDPIT GH+DI+ ++    ++L + +  NS K KG  +++ER ELI++S+ H 
Sbjct: 5   KAVIPGSFDPITKGHIDIVERSADRFDELHVCVLRNSSK-KGTFTVEERLELIEKSVAH- 62

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           +P+    V V SF GL V+   +I A  I+RGLR ++DF+YE+R+TS+N+ L  ++ T+ 
Sbjct: 63  LPN----VYVHSFSGLLVDFCDEIGATTIIRGLRAVSDFEYELRITSMNKKLNDKVETLY 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + +     +++S++++ +   DADI+ FVP  V
Sbjct: 119 MMSSTDYSFISSSMVKEVAQYDADISEFVPKHV 151


>gi|226951206|ref|ZP_03821670.1| phosphopantetheine adenylyltransferase [Acinetobacter sp. ATCC
           27244]
 gi|294649584|ref|ZP_06727003.1| antetheine-phosphate adenylyltransferase [Acinetobacter
           haemolyticus ATCC 19194]
 gi|226838036|gb|EEH70419.1| phosphopantetheine adenylyltransferase [Acinetobacter sp. ATCC
           27244]
 gi|292824523|gb|EFF83307.1| antetheine-phosphate adenylyltransferase [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 163

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 93/150 (62%), Gaps = 6/150 (4%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER EL K S+ H 
Sbjct: 5   RVIYPGTFDPITNGHVDLVARASKMFDEVVVAIAIGHHKNPVF-SLEERVELAKISLSHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V  + F+GL VN  ++  A  ++RGLR ++DF+YE ++ ++NR L P+  ++ 
Sbjct: 64  -----DNVEFVGFDGLLVNFFREQRATAVLRGLRAISDFEYEFQLANMNRQLDPQFESVF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVP 153
           L   E   +++STL+R +  +  D+T FVP
Sbjct: 119 LTPSEQYSFISSTLVREIARLKGDVTKFVP 148


>gi|301059167|ref|ZP_07200107.1| pantetheine-phosphate adenylyltransferase [delta proteobacterium
           NaphS2]
 gi|300446715|gb|EFK10540.1| pantetheine-phosphate adenylyltransferase [delta proteobacterium
           NaphS2]
          Length = 165

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 98/157 (62%), Gaps = 6/157 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G FDP+TNGH+ I+ +AL+  + L+IAI  N+ K     SI+ER E+I++++    
Sbjct: 6   AVYPGFFDPVTNGHLSIVSRALNIFDKLIIAI-LNNPKKVPLFSIEERIEMIQKAV---- 60

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
            D ++R+ V +F+GL V+ A    A V++RGLR ++DF+YE +M  +NR L  ++ +I L
Sbjct: 61  -DQNSRIEVDTFDGLLVDYAVHKKANVVLRGLRALSDFEYEFQMALMNRKLNRDVQSIFL 119

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
                  Y++ST+I+   S   D++  VPD V   LK
Sbjct: 120 MTDYKWFYISSTIIKEAASFGGDVSGLVPDIVNQNLK 156


>gi|223934956|ref|ZP_03626875.1| pantetheine-phosphate adenylyltransferase [bacterium Ellin514]
 gi|223896409|gb|EEF62851.1| pantetheine-phosphate adenylyltransferase [bacterium Ellin514]
          Length = 162

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 102/159 (64%), Gaps = 6/159 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y GSFDP+TNGH+D+I +A    + +++A+  N  K+  F ++ ER +L+ Q + 
Sbjct: 1   MRTVIYPGSFDPLTNGHLDVIQRATKLFDRVIVAVAKNESKSPLF-TLSERLDLVSQCVK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V   +F+GL V+ A+  SAQ I+RGLR ++DF++E ++  +NR L   + T
Sbjct: 60  H-LPN----VEADTFDGLLVDYAEKQSAQAIIRGLRAVSDFEFEFQLALMNRKLNERVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           I +  K++  +++S +++ +  +  +I++FVP PV V L
Sbjct: 115 IFMMPKDTYTFLSSRIVKEIARLGGNISTFVPSPVQVAL 153


>gi|153834844|ref|ZP_01987511.1| pantetheine-phosphate adenylyltransferase [Vibrio harveyi HY01]
 gi|148868715|gb|EDL67792.1| pantetheine-phosphate adenylyltransferase [Vibrio harveyi HY01]
          Length = 159

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/163 (36%), Positives = 95/163 (58%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+K +Y G+FDPITNGH+DII +A +  + ++I +  +  K K   S++ER +L++ S  
Sbjct: 1   MKKVIYPGTFDPITNGHLDIITRAANMFDQIIIGVAASPSK-KTLFSLEERVKLVEASTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + VS   F GL V+ A++  A V+VRGLR   DF+YE  +TS+ R L P + +
Sbjct: 60  HL-----SNVSTAGFSGLLVDFAREQEANVLVRGLRTTVDFEYEFGLTSMYRKLLPGVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L   E   +++ST++R +     D+  FVP  V   +K  V
Sbjct: 115 VFLTPAEEYAFLSSTIVREVAIHGGDVEQFVPKCVHTAIKTKV 157


>gi|310765973|gb|ADP10923.1| Phosphopantetheine adenylyltransferase [Erwinia sp. Ejp617]
          Length = 158

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+DI+ +A    + +V+AI  +  K K   S++ER  L  + +
Sbjct: 1   MSTKAIYPGTFDPMTNGHLDIVTRAARIFDRIVLAIAASPSK-KPMFSLEERVALASEVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V+ F  L  N AK   A V+VRGLR ++DF+YEM++  +NR L P + 
Sbjct: 60  AH-LPN----VDVVGFSDLLANFAKAQQANVLVRGLRAVSDFEYEMQLAQMNRHLLPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           ++ L   E   +++S+L++ +     D+ SF+P  V   LK
Sbjct: 115 SVFLMPSEQYAFISSSLMKEVARHGGDVESFLPTAVYRALK 155


>gi|313672614|ref|YP_004050725.1| phosphopantetheine adenylyltransferase [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939370|gb|ADR18562.1| Phosphopantetheine adenylyltransferase [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 162

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 99/158 (62%), Gaps = 6/158 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KA+Y G+FDP+TNGH+DII +     + LV+AI  N  K K   SI++R E+ K+S+   
Sbjct: 2   KALYPGTFDPMTNGHLDIIERGSKMFKHLVVAIAENKRK-KPLFSIEDRVEMAKESL--- 57

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
              S   VSV+ F  L ++  K+ +  +I+RGLR ++DF++E+++  +NR + PE  T+ 
Sbjct: 58  --KSLENVSVVPFSNLLIHFMKENNINIILRGLRAVSDFEFELQLALMNRKMYPECETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           L       +++S++IR + S+  D++ FVP PV + +K
Sbjct: 116 LMPSSKYIFLSSSMIREIASLGGDVSCFVPYPVYLKIK 153


>gi|325289861|ref|YP_004266042.1| Phosphopantetheine adenylyltransferase [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324965262|gb|ADY56041.1| Phosphopantetheine adenylyltransferase [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 158

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 93/155 (60%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR AVY G+FDP+T GHMDI+ +A    + ++I +  NS K   F S++ER EL+K    
Sbjct: 1   MRIAVYPGTFDPVTLGHMDILHRAAQLFDKIIIGVAANSNKETLF-SLEERQELLK---- 55

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H I + SN V V  F GL V  A+   A  ++RGLR ++DF+YE ++  +N+ L P++ T
Sbjct: 56  HEIKEMSN-VEVCPFSGLTVEFARQCGAVALIRGLRAISDFEYEFQLALMNKKLAPDMET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L  K    +++S+ I+   S+   I+ FVP  V
Sbjct: 115 VFLMTKSEYSFISSSAIKWAASLKGSISEFVPPNV 149


>gi|85703686|ref|ZP_01034790.1| pantetheine-phosphate adenylyltransferase [Roseovarius sp. 217]
 gi|85672614|gb|EAQ27471.1| pantetheine-phosphate adenylyltransferase [Roseovarius sp. 217]
          Length = 167

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/155 (38%), Positives = 89/155 (57%), Gaps = 1/155 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A   V+ LV+ +  N  K   F S++ER E+I+    
Sbjct: 5   MRIGLYPGTFDPITLGHIDIIRRAAVLVDRLVLGVAINRDKGPLF-SLEERVEMIETECA 63

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L +N A D+ AQVIVRGLR + DF+YE +M  +NR L   + T
Sbjct: 64  KLSAQTGTEIVAHPFENLLINCAHDVGAQVIVRGLRAVADFEYEFQMVGMNRALDNSVET 123

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L A  + + + S L++ +  +  D+T FV  PV
Sbjct: 124 VFLMADANHQAIASKLVKEIARLGGDVTKFVTPPV 158


>gi|255531370|ref|YP_003091742.1| pantetheine-phosphate adenylyltransferase [Pedobacter heparinus DSM
           2366]
 gi|255344354|gb|ACU03680.1| pantetheine-phosphate adenylyltransferase [Pedobacter heparinus DSM
           2366]
          Length = 153

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/153 (38%), Positives = 98/153 (64%), Gaps = 6/153 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A++ GSFDPIT  H+DI+ +AL   + +V+ IG NS K + FLS Q+R E++K ++F
Sbjct: 1   MKIALFPGSFDPITIAHVDILKRALPLFDKIVVGIGLNSSK-QSFLSAQKREEIVK-TVF 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP     V V  +EGL V+  K I+A+ +VRG+R + DF+YE  +  +N+ + PE+ T
Sbjct: 59  EGIP----AVDVQLYEGLTVDFCKKINARYMVRGIRSVGDFEYERAIAQINQTMMPEMET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           I + +K     ++ST++R ++    D++ F+P 
Sbjct: 115 IFILSKPEYSAISSTIVRDILRNHGDVSKFLPQ 147


>gi|162148107|ref|YP_001602568.1| putative phosphopantetheine adenylyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209542721|ref|YP_002274950.1| pantetheine-phosphate adenylyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786684|emb|CAP56267.1| putative phosphopantetheine adenylyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530398|gb|ACI50335.1| pantetheine-phosphate adenylyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 169

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 89/151 (58%), Gaps = 1/151 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R   Y G+FDP+TNGH+DI+ +A   V+ LV+ +  N+ K +  + + ER   ++     
Sbjct: 7   RTGFYPGTFDPMTNGHLDIVERAARLVDRLVVGVAENTGK-QPLMPLDERVACVQAETRA 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +   + V+ F  L V +A+   A VIVRGLR + DFDYE++M  +N  L P+I T+
Sbjct: 66  VAQRNGTTIDVVGFGNLLVEVARSHGATVIVRGLRAVVDFDYEVQMFGMNHHLAPDIETV 125

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVP 153
            L A E ++Y++S L++ +  +  DIT FVP
Sbjct: 126 FLMATERNQYISSRLVKEVARLGGDITGFVP 156


>gi|269467805|gb|EEZ79560.1| phosphopantetheine adenylyltransferase [uncultured SUP05 cluster
           bacterium]
          Length = 158

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/162 (37%), Positives = 100/162 (61%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y GSFDPITNGH+D+I +A    + ++I I  NS K   FL+I +R    K ++
Sbjct: 1   MKKVAIYPGSFDPITNGHIDLIRRASKLFDKVIIGITQNS-KKPSFLNIDQRLVAAKTAL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   + + ++SF  L V+ A   +AQVI+RGLR ++DF+YE +++ +N+ L P I 
Sbjct: 60  KEI-----DNIEILSFNTLLVDFASAQNAQVILRGLRAVSDFEYEFQLSGMNKHLNPNIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ +   E    ++S+L+R ++S+  DI++FVP  V   LK+
Sbjct: 115 TLFMTPAEQYANISSSLVREILSLGGDISAFVPKSVEKLLKD 156


>gi|86138811|ref|ZP_01057383.1| pantetheine-phosphate adenylyltransferase [Roseobacter sp. MED193]
 gi|85824458|gb|EAQ44661.1| pantetheine-phosphate adenylyltransferase [Roseobacter sp. MED193]
          Length = 165

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 93/161 (57%), Gaps = 1/161 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F S++ER  +I+    
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRASALVDKLVIGVAINRDKGPMF-SLEERVAMIEVECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   + V  FE L +N A D+ AQ+IVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  KLTEQTGTEIVVHPFENLLINCAHDVGAQIIVRGLRAVADFEYEYQMVGMNRVLDSSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L A+   + + S L++ +  +D D++SFV   V   L+ 
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLDGDVSSFVTPRVLEELRK 160


>gi|254490545|ref|ZP_05103731.1| pantetheine-phosphate adenylyltransferase [Methylophaga thiooxidans
           DMS010]
 gi|224464289|gb|EEF80552.1| pantetheine-phosphate adenylyltransferase [Methylophaga thiooxydans
           DMS010]
          Length = 162

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/162 (37%), Positives = 101/162 (62%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y G+FDPIT GH+D+I +A +  + +++AI  N  K   F S+ ER  L KQ++
Sbjct: 1   MSTTAIYPGTFDPITYGHIDLINRAATLFDKVIVAIAINPGKQPMF-SLDERVTLAKQTV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                D    V V  FEGL VN A ++ A VI+RGLR ++DF+YE+++ ++NR + P++ 
Sbjct: 60  -----DELTNVEVRGFEGLLVNEALNMGANVIIRGLRAVSDFEYELQLATMNRRMQPKVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ L   E+  +V+S+L++ +  +  D++ FV   V + LK+
Sbjct: 115 TLFLTPAENLSFVSSSLVKEIAVLGGDVSEFVAPCVQMALKH 156


>gi|225868981|ref|YP_002744929.1| phosphopantetheine adenylyltransferase [Streptococcus equi subsp.
           zooepidemicus]
 gi|259491323|sp|C0MD70|COAD_STRS7 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|225702257|emb|CAX00016.1| phosphopantetheine adenylyltransferase [Streptococcus equi subsp.
           zooepidemicus]
          Length = 166

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 97/153 (63%), Gaps = 7/153 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            +YTGSFDP+TNGHMD+I +A    E + + I  N+   +GF + + R++++++++   +
Sbjct: 6   GLYTGSFDPVTNGHMDMIKRASHLFEHVYVGI-FNNPNKQGFFTFELRAQMLREAVC-AL 63

Query: 65  PDSSNRVSVISFE-GLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           P+    V+V+S E GLAV+LA+++S   ++RGLR+  DFDYE  +   N  L PEI TI 
Sbjct: 64  PN----VTVVSAEHGLAVDLARELSVTHLIRGLRNTADFDYEAGLEYFNHRLAPEIETIY 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           L A    + ++S+ IR LI+  A IT  VP  V
Sbjct: 120 LMATHDLQPISSSRIRELIAFRAPITGLVPQAV 152


>gi|331007674|ref|ZP_08330810.1| Phosphopantetheine adenylyltransferase [gamma proteobacterium
           IMCC1989]
 gi|330418517|gb|EGG93047.1| Phosphopantetheine adenylyltransferase [gamma proteobacterium
           IMCC1989]
          Length = 159

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 96/160 (60%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+K VY G+FDPITNGH+D++ +A    + +VIA+  +S K   F  +QER +L +  + 
Sbjct: 1   MKKVVYPGTFDPITNGHVDLVERACRLFDHVVIAVADSSSKNPLF-DLQERVDLCRDVLQ 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + V V  F  L  +  ++  AQ ++RGLR ++DF+YE ++ ++NR L P + +
Sbjct: 60  HL-----DNVEVKGFNVLLAHFVEEQGAQAVIRGLRAVSDFEYEFQLANMNRALLPHMES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           I L   E   Y++S+LIR + S++ D+  FVP  V   LK
Sbjct: 115 IFLTPAEHLSYLSSSLIREIASLNGDVKQFVPAAVEAALK 154


>gi|325919644|ref|ZP_08181653.1| Phosphopantetheine adenylyltransferase [Xanthomonas gardneri ATCC
           19865]
 gi|325549892|gb|EGD20737.1| Phosphopantetheine adenylyltransferase [Xanthomonas gardneri ATCC
           19865]
          Length = 168

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K    L ++ R EL ++++  
Sbjct: 7   RTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPA-LPLERRVELAQEAL-- 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +   V V  F+ L  +  +D+ A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 64  ---AAHANVEVRGFDTLLAHFVRDMGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            L   E   +++S+L+R +  +  D++ FVP  V   L+ +
Sbjct: 121 FLTPAEQYSFISSSLVREIARLGGDVSGFVPASVVEALRQV 161


>gi|262373256|ref|ZP_06066535.1| pantetheine-phosphate adenylyltransferase [Acinetobacter junii
           SH205]
 gi|262313281|gb|EEY94366.1| pantetheine-phosphate adenylyltransferase [Acinetobacter junii
           SH205]
          Length = 163

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 91/150 (60%), Gaps = 6/150 (4%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER EL K S+ H 
Sbjct: 5   RVIYPGTFDPITNGHVDLVARASKMFDEVVVAIAIGHHKNPVF-SLEERVELAKASLSHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                  V  + F+GL VN  ++  A  ++RGLR ++DF+YE ++ ++NR L P   ++ 
Sbjct: 64  -----TNVEFVGFDGLLVNFFREQRATAVLRGLRAISDFEYEFQLANMNRQLDPHFESVF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVP 153
           L   E   +++STL+R +  +  D+T FVP
Sbjct: 119 LTPSEQYSFISSTLVREIARLKGDVTKFVP 148


>gi|68171712|ref|ZP_00545068.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related
           [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658395|ref|YP_507539.1| pantetheine-phosphate adenylyltransferase [Ehrlichia chaffeensis
           str. Arkansas]
 gi|67998868|gb|EAM85564.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related
           [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599852|gb|ABD45321.1| pantetheine-phosphate adenylyltransferase [Ehrlichia chaffeensis
           str. Arkansas]
          Length = 165

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 101/161 (62%), Gaps = 5/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y G+FDPIT GH+DII +A + V+ LVI +  +  K K   S + R+ELI+    
Sbjct: 1   MKIGIYPGTFDPITFGHIDIIKRAYNLVDKLVIGVARSCTK-KTIFSAEVRAELIQ---- 55

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H I      V+ + F+GL V  AK+ +A VI+RGLR ++DFDYE +M+ VN  L  +I T
Sbjct: 56  HEIKLLGMAVNTVIFDGLLVYFAKENNASVIIRGLRAVSDFDYEFQMSWVNYKLTSQIET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           I L A E +++++S+ ++ +  ++ D++ FVP  V   LKN
Sbjct: 116 IFLPASEDTQFISSSFVKEIARLNGDVSVFVPVNVQECLKN 156


>gi|292486570|ref|YP_003529438.1| phosphopantetheine adenylyltransferase [Erwinia amylovora CFBP1430]
 gi|292897808|ref|YP_003537177.1| phosphopantetheine adenylyltransferase [Erwinia amylovora ATCC
           49946]
 gi|291197656|emb|CBJ44751.1| phosphopantetheine adenylyltransferase [Erwinia amylovora ATCC
           49946]
 gi|291551985|emb|CBA19022.1| Phosphopantetheine adenylyltransferase [Erwinia amylovora CFBP1430]
 gi|312170631|emb|CBX78894.1| Phosphopantetheine adenylyltransferase [Erwinia amylovora ATCC
           BAA-2158]
          Length = 158

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+DI+ +A    + +V+AI  +  K K   +++ER  L  + +
Sbjct: 1   MSTKAIYPGTFDPMTNGHLDIVTRAALMFDRIVLAIAASPSK-KPMFTLEERVALAGEVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V+ F  L  N AK   A V+VRGLR ++DF+YEM++  +NR L P + 
Sbjct: 60  AH-LPN----VEVVGFSDLLANFAKAQQANVLVRGLRAVSDFEYEMQLAQMNRHLLPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           ++ L   E   +V+S+L++ +     D+ SF+P  V   LK
Sbjct: 115 SVFLMPSEQYSFVSSSLMKEVARHGGDVESFLPTAVYQALK 155


>gi|114570422|ref|YP_757102.1| phosphopantetheine adenylyltransferase [Maricaulis maris MCS10]
 gi|114340884|gb|ABI66164.1| pantetheine-phosphate adenylyltransferase [Maricaulis maris MCS10]
          Length = 162

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 97/152 (63%), Gaps = 3/152 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y G+FDP+TNGH+DII +A+  V+ LVI +  N  K   F S+ ER +++++ +
Sbjct: 1   MTRTALYPGTFDPLTNGHIDIIGRAVKLVDHLVIGVAINEAKHPLF-SLDERVDMVREEV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F      ++ V  F+GL ++ A++I AQ IVRGLR ++DF+YE +M ++N+ L  +I 
Sbjct: 60  APFA--DGAQIEVRPFDGLLMHFAEEIGAQSIVRGLRAVSDFEYEFQMVAMNQQLNDDIE 117

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           T+ L A    + + S L++ +  +  +I++FV
Sbjct: 118 TVFLMADPRHQAIASRLVKEIAKLGGNISAFV 149


>gi|157149251|ref|YP_001456570.1| phosphopantetheine adenylyltransferase [Citrobacter koseri ATCC
           BAA-895]
 gi|166216535|sp|A8ARM1|COAD_CITK8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|157086456|gb|ABV16134.1| hypothetical protein CKO_05091 [Citrobacter koseri ATCC BAA-895]
          Length = 159

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 94/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER  L +Q+ 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK-KPMFTLEERVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A+   A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHL-----GNVEVMGFSDLMANFARIQQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|307265581|ref|ZP_07547135.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|306919379|gb|EFN49599.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           wiegelii Rt8.B1]
          Length = 159

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH+DII +     + L++A+  N +K K   SI+ER EL+K ++ 
Sbjct: 1   MKTAIYPGSFDPVTYGHIDIIKRGALLFDKLIVAVLLNPIK-KPLFSIEERMELLK-AVT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V +  F+GL V+ AK + A VI+RGLR ++DF+YE +M  +N+ L P I T
Sbjct: 59  KNIPN----VQIDYFDGLLVDYAKKVRAGVIIRGLRMVSDFEYEFQMALINKKLDPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L   E   Y +S+ ++ +       + FVP+ V   LK 
Sbjct: 115 VFLMTNEQYSYFSSSAVKEIAQFRGGFSKFVPEIVAQKLKE 155


>gi|253577773|ref|ZP_04855045.1| pantetheine-phosphate adenylyltransferase [Ruminococcus sp.
           5_1_39B_FAA]
 gi|251850091|gb|EES78049.1| pantetheine-phosphate adenylyltransferase [Ruminococcus sp.
           5_1_39BFAA]
          Length = 164

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 96/152 (63%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDP T GH+D+I +A    + +++ +  NS K+  F S+QER  +++++  
Sbjct: 1   MKIAVYPGSFDPATYGHLDVIRRAAVSFDKVIVGVLHNSSKSPLF-SVQERVNILEKAT- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P+    V V  FEGL+VN A++  AQVI+RGLR +TDF+YE++M   NR L P++ T
Sbjct: 59  RDVPN----VEVKPFEGLSVNFARENHAQVIIRGLRAVTDFEYELQMAQTNRVLAPDVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + L       Y++ST+++ +     D++ F P
Sbjct: 115 VFLTTSLEYAYLSSTILKEVAHFGGDLSKFAP 146


>gi|304399013|ref|ZP_07380882.1| pantetheine-phosphate adenylyltransferase [Pantoea sp. aB]
 gi|304353473|gb|EFM17851.1| pantetheine-phosphate adenylyltransferase [Pantoea sp. aB]
          Length = 159

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 96/156 (61%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+T GH+DI+ +A    +++++A+  +  K K   S+ ER  L  + +
Sbjct: 1   MTTKAIYPGTFDPVTLGHVDIVTRAAQMFDEVILAVAASPSK-KPMFSLDERVALTGEVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V+ F  L  N A+D  A V++RGLR ++DF+YEM++  +NR L P + 
Sbjct: 60  AH-LPN----VEVVGFSDLMANFARDQQANVLIRGLRAVSDFEYEMQLAQMNRHLLPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   E   +++S+L++ +     D+++F+P PV
Sbjct: 115 SVFLMPSEGFSFISSSLVKEVARHKGDVSAFLPAPV 150


>gi|307244253|ref|ZP_07526368.1| pantetheine-phosphate adenylyltransferase [Peptostreptococcus
           stomatis DSM 17678]
 gi|306492403|gb|EFM64441.1| pantetheine-phosphate adenylyltransferase [Peptostreptococcus
           stomatis DSM 17678]
          Length = 160

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 100/158 (63%), Gaps = 6/158 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KA++ G+FDPITNGH+DII +A    E L + +  N  K   F S++ER +LIK+SI H 
Sbjct: 6   KAIFAGTFDPITNGHIDIIERAAKMFEHLQVGLLINPNKNTLF-SMEERMDLIKESIKHL 64

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + VSVISF+GL ++  K     V+VRG+R + D +YE++M  +N+ L  ++ T+ 
Sbjct: 65  -----DNVSVISFDGLLIDYCKKNDISVLVRGVRTIADMEYELQMAHMNKELNDKLETVI 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           L   ++  +++S+LI+ ++  DAD+++ VP  V   LK
Sbjct: 120 LPTSKTYSFISSSLIKEVLHFDADVSNLVPRCVIEKLK 157


>gi|163746628|ref|ZP_02153985.1| Coenzyme A biosynthesis protein [Oceanibulbus indolifex HEL-45]
 gi|161379742|gb|EDQ04154.1| Coenzyme A biosynthesis protein [Oceanibulbus indolifex HEL-45]
          Length = 165

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/151 (39%), Positives = 92/151 (60%), Gaps = 1/151 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y G+FDPIT GH+DII +A   V+ LVI +  N  K   F S++ER  LI+    
Sbjct: 1   MRIALYPGTFDPITLGHIDIIRRAARMVDRLVIGVAINRDKGPLF-SLEERVALIEAECV 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   + V  FE L ++ A+D+ AQ IVRGLR ++DF+YE +M  +NR L   I T
Sbjct: 60  QLAKETGVEIIVHPFENLLIDCARDVGAQTIVRGLRAVSDFEYEFQMVGMNRQLDDTIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L A+ + + + S L++ +  +D D++ FV
Sbjct: 120 VFLMAEATHQAIASKLVKEIARLDGDVSKFV 150


>gi|291522175|emb|CBK80468.1| pantetheine-phosphate adenylyltransferase, bacterial [Coprococcus
           catus GD/7]
          Length = 167

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 94/152 (61%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDP+T GH+DII ++   V+ L+I +  NS KT  F S++ER  ++K+ + 
Sbjct: 1   MRTAIYPGSFDPVTYGHIDIIKRSAKMVDKLIIGVLSNSSKTPLF-SVEERVNMLKE-VT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V V SF GL ++ A   +A++IVRGLR +TDF+YE++    NR + P + T
Sbjct: 59  KDIPN----VEVTSFAGLLIDFADACNAKIIVRGLRAVTDFEYELQWAQANRAVRPHLDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + L       Y++S+ +R L     D++ FVP
Sbjct: 115 LFLVTNVEYSYLSSSAVRELARYHGDVSLFVP 146


>gi|332171773|gb|AEE21027.1| pantetheine-phosphate adenylyltransferase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 160

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 94/161 (58%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KAVY G+FDPITNGH D+I +A +    +++ I  N  K K   S+QER ELIK+  
Sbjct: 1   MHTKAVYPGTFDPITNGHADLIERAANMFAHVIVGIAANPSK-KPLFSLQERVELIKKVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V VI FEGL  + A    A V++RGLR ++DF+YE ++ ++NR L P + 
Sbjct: 60  AH-LPN----VEVIGFEGLLADFADSQGATVLIRGLRAVSDFEYEFQLANMNRRLNPNLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +I L   E + +++STL++ +      +  F    V   LK
Sbjct: 115 SIFLTPAEENSFISSTLVKEVALHRGKVDQFCHPAVQAALK 155


>gi|33861441|ref|NP_893002.1| putative pantetheine-phosphate adenylyltransferase [Prochlorococcus
           marinus subsp. pastoris str. CCMP1986]
 gi|61212717|sp|Q7V1I7|COAD_PROMP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|33634018|emb|CAE19343.1| putative pantetheine-phosphate adenylyltransferase [Prochlorococcus
           marinus subsp. pastoris str. CCMP1986]
          Length = 159

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 100/159 (62%), Gaps = 6/159 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K +Y G+FDP+TNGH+D+I +A     ++V+A+  N+ K   F ++ +R   IK ++ H 
Sbjct: 2   KILYPGTFDPLTNGHLDLIQRAEKLFGNVVVAVLENTSKKPTF-NLNKRLVQIKNAVSHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + +SVIS+EGL V+ AK+++A +I+RGLR M+DF+YE+++   N+ L  EI TI 
Sbjct: 61  -----SNISVISYEGLTVDCAKEVNANLILRGLRAMSDFEYELQIAHTNKSLNTEIETIF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           L    +  +++S+L++ +     +I   VPD V   LKN
Sbjct: 116 LSTNTNYSFLSSSLVKEVAKFGGEIDHMVPDSVERDLKN 154


>gi|149181730|ref|ZP_01860222.1| phosphopantetheine adenylyltransferase [Bacillus sp. SG-1]
 gi|148850578|gb|EDL64736.1| phosphopantetheine adenylyltransferase [Bacillus sp. SG-1]
          Length = 172

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 64/157 (40%), Positives = 98/157 (62%), Gaps = 6/157 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AV  GSFDPIT GH+DII +     + L I +  NS K K   S++ER ELI++ +   I
Sbjct: 17  AVCPGSFDPITYGHLDIITRGAKVFDKLYITVLNNSSK-KPMFSVEERMELIRE-VTKDI 74

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V SF+GL ++ AK ++A  I+RGLR ++DF+YEM++TS+NR L   I T  +
Sbjct: 75  PN----VVVDSFQGLLMDYAKSVNANAILRGLRAVSDFEYEMQITSMNRVLDESIETFFI 130

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
                  +++S++++ +   DADI+  VP PV + L+
Sbjct: 131 MTNNQYSFLSSSIVKEVAKYDADISELVPKPVEIALQ 167


>gi|21231828|ref|NP_637745.1| phosphopantetheine adenylyltransferase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768046|ref|YP_242808.1| phosphopantetheine adenylyltransferase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|29427840|sp|Q8P857|COAD_XANCP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|81305977|sp|Q4UVY5|COAD_XANC8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|21113543|gb|AAM41669.1| lipopolysaccharide synthesis enzyme [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573378|gb|AAY48788.1| lipopolysaccharide synthesis enzyme [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 168

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K    L ++ R EL ++++  
Sbjct: 7   RTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPA-LPLERRVELAQEAL-- 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +   V V  F+ L  +  +D+ A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 64  ---AAHANVEVRGFDTLLAHFVRDMGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            L   E   +++S+L+R +  +  D++ FVP  V   L+ +
Sbjct: 121 FLTPAEQYSFISSSLVREIARLGGDVSGFVPASVVDALRQV 161


>gi|301167847|emb|CBW27432.1| phosphopantetheine adenylyltransferase [Bacteriovorax marinus SJ]
          Length = 157

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 98/160 (61%), Gaps = 6/160 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KAVY G+FDP TNGH DI+ +AL+  +++ + +  +  KT  F S ++R +++++  
Sbjct: 1   MKKKAVYAGTFDPFTNGHDDILKRALNLFDEVTVLVAVSPSKTPLF-SAEQRVKMLEE-- 57

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            HF  D+  RV   S+ GL V+ AK  +   I+RGLR   DF+ E +M S+N  L PEI 
Sbjct: 58  -HFKDDTQVRVD--SWSGLLVDYAKKNNINTIIRGLRPTGDFEVEFQMASMNNKLYPEIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           T+ L  +  + Y++S+LI+ +   D D++ FVP  +  +L
Sbjct: 115 TVFLMTEGQNYYISSSLIKEIYKHDGDVSEFVPAVINKWL 154


>gi|291166897|gb|EFE28943.1| pantetheine-phosphate adenylyltransferase [Filifactor alocis ATCC
           35896]
          Length = 164

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 92/153 (60%), Gaps = 6/153 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +AVY GSFDPITNGH+D+I +    VE + +AI  N+ K +G  S++ER ELI  ++ 
Sbjct: 1   MNRAVYPGSFDPITNGHIDVIERVAGMVEHVTVAILINA-KKQGLFSLEERKELILDAVK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + V V+ F GL  +  +D    VIVRGLR ++D++YE++M  +NR L P+  T
Sbjct: 60  HL-----DNVEVVCFSGLLADYCRDNHIDVIVRGLRAVSDYEYEIQMAQMNRKLYPKAET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           I L       Y++S+L++ +      ++  +P+
Sbjct: 115 IFLMTNPIYAYLSSSLVKEVAGFSGCVSDLIPE 147


>gi|92117311|ref|YP_577040.1| phosphopantetheine adenylyltransferase [Nitrobacter hamburgensis
           X14]
 gi|122417963|sp|Q1QMG7|COAD_NITHX RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|91800205|gb|ABE62580.1| Coenzyme A biosynthesis protein [Nitrobacter hamburgensis X14]
          Length = 165

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/163 (34%), Positives = 98/163 (60%), Gaps = 3/163 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++  A+   + L++AIG +  KT  F +  ER  +++ S+
Sbjct: 1   MSRVALYPGSFDPVTNGHVDVVRHAVVLCDQLIVAIGVHPGKTPLFPA-GERLAMVR-SV 58

Query: 61  FHFIPDSSN-RVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           F  + + +       +++ L V  A+   A +++RGLRD TD DYEM++  +N  + P +
Sbjct: 59  FAPVAEKAGCAFDCTTYDDLTVAAAQKAGATILIRGLRDGTDLDYEMQIAGMNETMAPGV 118

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            T+ + A    R +T+TL+R + ++  D+++FVP  V   LK 
Sbjct: 119 HTVFVPASPGVRPITATLVRQIAAMGGDVSAFVPQSVASSLKT 161


>gi|149920738|ref|ZP_01909202.1| phosphopantetheine adenylyltransferase [Plesiocystis pacifica
           SIR-1]
 gi|149818391|gb|EDM77842.1| phosphopantetheine adenylyltransferase [Plesiocystis pacifica
           SIR-1]
          Length = 176

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 93/153 (60%), Gaps = 6/153 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY GSFDPIT GH +I+ +A    +++V+A+G + VK +GF S ++R ELI++   H I
Sbjct: 10  AVYPGSFDPITLGHTEILERAAQLFDEVVVAVGHHPVK-RGFFSYEQRVELIREVTAH-I 67

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V    F GL ++  +++ A+VIVRGLR   DF+ E +M   NR L P++ T+ L
Sbjct: 68  PN----VRAAHFSGLMIDFCREVGARVIVRGLRAAGDFEPEFQMALANRELEPKVETVFL 123

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
             +   ++++S+LIR + S       FVP  V 
Sbjct: 124 IPEPQKQFISSSLIREIASHGGPFQRFVPGAVS 156


>gi|325697041|gb|EGD38928.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           SK160]
          Length = 164

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 97/160 (60%), Gaps = 7/160 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+T GH+D+I +A    + L + I  N  K+ GF +I+ R  ++K+++ H  
Sbjct: 6   GLFTGSFDPMTKGHVDLIERASRLFDKLYVGIFYNREKS-GFFTIEAREHMVKEALEHL- 63

Query: 65  PDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V VI+ +  LAV +A+ + AQ  VRGLR+  D DYE  M   N+ L  EI TI 
Sbjct: 64  ----DNVEVITSQNELAVTVARRLGAQAFVRGLRNSQDLDYEANMNFFNQELAGEIETIF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L +K + ++++S+ IR LI+   DIT++VP  V   L+ I
Sbjct: 120 LLSKPAYQHISSSRIRELIAFQQDITAYVPQSVIKELERI 159


>gi|20807930|ref|NP_623101.1| phosphopantetheine adenylyltransferase [Thermoanaerobacter
           tengcongensis MB4]
 gi|29427846|sp|Q8R9U9|COAD_THETN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|20516499|gb|AAM24705.1| Phosphopantetheine adenylyltransferase [Thermoanaerobacter
           tengcongensis MB4]
          Length = 160

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 62/156 (39%), Positives = 95/156 (60%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDP+T GH+DII +  +  + L++A+  N  K +   SIQER EL+K+ + 
Sbjct: 1   MRVAIYPGSFDPVTYGHIDIIKRGANLFDKLIVAVLLNPAK-RPLFSIQERIELLKE-VT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V V  F+GL V  AK ++A  I++GLR ++DF+YE +M  VN+ L P + T
Sbjct: 59  KDIPN----VEVDYFDGLLVEYAKKVNASAIIKGLRMVSDFEYEFQMALVNKKLNPSVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I L       Y++S+L++ +      ++ FVPD V 
Sbjct: 115 IFLMTSPKYGYLSSSLVKEIAQFGGCLSEFVPDIVA 150


>gi|56459382|ref|YP_154663.1| phosphopantetheine adenylyltransferase [Idiomarina loihiensis L2TR]
 gi|61212490|sp|Q5QUN6|COAD_IDILO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|56178392|gb|AAV81114.1| Phosphopantetheine adenylyltransferase [Idiomarina loihiensis L2TR]
          Length = 166

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 95/151 (62%), Gaps = 6/151 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R+A+Y G+FDPITNGH D+I +A +   ++V+ I   S   K   S++ER  L +Q  
Sbjct: 1   MHRRAIYPGTFDPITNGHADLIERAANLFSEIVVGI-AESPSKKPLFSLEERVLLAQQ-- 57

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              + ++ + V+V+ F GL VN AK+  A V++RGLR ++DF+YE ++ ++NR L P + 
Sbjct: 58  ---VTENLDNVTVVGFSGLLVNFAKEYEATVLIRGLRAVSDFEYEFQLANMNRRLAPNLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSF 151
           ++ L   E + +++S+L++ +     D++ F
Sbjct: 115 SVFLTPAEENSFISSSLVKEVALHGGDVSGF 145


>gi|148976959|ref|ZP_01813614.1| phosphopantetheine adenylyltransferase [Vibrionales bacterium
           SWAT-3]
 gi|145963833|gb|EDK29093.1| phosphopantetheine adenylyltransferase [Vibrionales bacterium
           SWAT-3]
          Length = 160

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 93/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M    +Y G+FDP+TNGH+DII++A S  + + + +  +  K K    + ER EL++ ++
Sbjct: 1   MTTHVIYPGTFDPVTNGHLDIIVRAASMFDHITVGVAASPSK-KTMFKLDERVELLRDAV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    VSV  F GL V+ AK+  A V+VRGLR   DF+YE  +TS+ R L P + 
Sbjct: 60  SH-LPN----VSVEGFSGLLVDFAKEQKANVLVRGLRTTMDFEYEFGLTSMYRKLLPGLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E   +++ST++R +     DI+ FVP  V 
Sbjct: 115 SVFLTPSEEYAFLSSTIVREVAIHGGDISQFVPQKVA 151


>gi|83952656|ref|ZP_00961386.1| pantetheine-phosphate adenylyltransferase [Roseovarius nubinhibens
           ISM]
 gi|83835791|gb|EAP75090.1| pantetheine-phosphate adenylyltransferase [Roseovarius nubinhibens
           ISM]
          Length = 163

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 92/161 (57%), Gaps = 1/161 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A   V+ LVI +  N  K   F +++ER ++I++   
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRAAVMVDRLVIGVAINRDKGPLF-TLEERVDMIERECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   + V  FE L ++ AKD+ AQVIVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  KLSEQTGAEIIVHPFENLLIDCAKDVGAQVIVRGLRAVADFEYEFQMVGMNRALDDSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L A    + + S L++ +  +  D+  FV  PV   L+ 
Sbjct: 120 VFLMADAGHQAIASKLVKEIARLGGDVRKFVTPPVNAALRE 160


>gi|254449089|ref|ZP_05062541.1| pantetheine-phosphate adenylyltransferase [gamma proteobacterium
           HTCC5015]
 gi|198261281|gb|EDY85574.1| pantetheine-phosphate adenylyltransferase [gamma proteobacterium
           HTCC5015]
          Length = 161

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/147 (40%), Positives = 95/147 (64%), Gaps = 6/147 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y GSFDPITNGH D++ +A    + ++ AIG NS K +   S++ER  L +Q +  F 
Sbjct: 5   AIYPGSFDPITNGHADLVRRACQVFDKVIFAIGVNS-KKQPLFSLEERVALAQQVLADF- 62

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+SF+ L V+ A ++ AQVIVRGLR ++D+++E+++ S NR L  +I T+ L
Sbjct: 63  PN----VEVMSFDNLMVDFAAEVGAQVIVRGLRAVSDYEFELQLASTNRRLNNQIDTVFL 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSF 151
              E   +V+STL++ +     D++SF
Sbjct: 119 TPSEEHSFVSSTLVKEVARHRGDVSSF 145


>gi|169796970|ref|YP_001714763.1| phosphopantetheine adenylyltransferase [Acinetobacter baumannii
           AYE]
 gi|184157118|ref|YP_001845457.1| phosphopantetheine adenylyltransferase [Acinetobacter baumannii
           ACICU]
 gi|260555739|ref|ZP_05827959.1| pantetheine-phosphate adenylyltransferase [Acinetobacter baumannii
           ATCC 19606]
 gi|294839938|ref|ZP_06784621.1| phosphopantetheine adenylyltransferase [Acinetobacter sp. 6013113]
 gi|301346831|ref|ZP_07227572.1| phosphopantetheine adenylyltransferase [Acinetobacter baumannii
           AB056]
 gi|229488109|sp|B2HUN5|COAD_ACIBC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488111|sp|B0V8I3|COAD_ACIBY RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|169149897|emb|CAM87790.1| phosphopantetheine adenylyltransferase [Acinetobacter baumannii
           AYE]
 gi|183208712|gb|ACC56110.1| Phosphopantetheine adenylyltransferase [Acinetobacter baumannii
           ACICU]
 gi|260410650|gb|EEX03948.1| pantetheine-phosphate adenylyltransferase [Acinetobacter baumannii
           ATCC 19606]
          Length = 163

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 91/154 (59%), Gaps = 6/154 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER  L + S+ H 
Sbjct: 5   RVIYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHKNPLF-SLEERVALAQSSLGHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V  + F+GL VN  K+  A  ++RGLR ++DF+YE ++ ++NR L P    + 
Sbjct: 64  -----SNVEFVGFDGLLVNFFKEQKATAVLRGLRAVSDFEYEFQLANMNRQLDPHFEAVF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           L   E   +++STLIR +  +  D+T FVP  V 
Sbjct: 119 LTPSEQYSFISSTLIREIARLKGDVTKFVPQAVV 152


>gi|84684722|ref|ZP_01012622.1| pantetheine-phosphate adenylyltransferase [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667057|gb|EAQ13527.1| pantetheine-phosphate adenylyltransferase [Rhodobacterales
           bacterium HTCC2654]
          Length = 165

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 60/154 (38%), Positives = 91/154 (59%), Gaps = 2/154 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F +++ER E+++    
Sbjct: 1   MRVALYPGTFDPITIGHIDIIKRACALVDRLVIGVAINRDKGPMF-TLEERVEMVEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L +N A D+ A +IVRGLR +TDF+YE +M  +NR L   I T
Sbjct: 60  ALSEQTGTEIVAHPFENLLINCAYDVGASIIVRGLRAVTDFEYEYQMVGMNRALDASIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV-PD 154
           + L A    + + S L++ +  +D D++ FV PD
Sbjct: 120 VFLMADLKHQAIASKLVKEIARLDGDVSKFVTPD 153


>gi|193214911|ref|YP_001996110.1| phosphopantetheine adenylyltransferase [Chloroherpeton thalassium
           ATCC 35110]
 gi|193088388|gb|ACF13663.1| pantetheine-phosphate adenylyltransferase [Chloroherpeton
           thalassium ATCC 35110]
          Length = 168

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 97/160 (60%), Gaps = 5/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           +R+A+Y G+FDPITNGH+D++ +ALS  +++ + +  N+ K K   + +ER E+I++++ 
Sbjct: 3   IRRAIYPGTFDPITNGHIDVLERALSIFDEITVVVAVNNQK-KPLFTAEERMEMIQEAVA 61

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +   S  +V ++  EGL    A    A  I+RGLR   DF+YE ++  +NR L PEI T
Sbjct: 62  GY---SGVKVEILQ-EGLLAEYAHRKEAVAIIRGLRQFIDFEYEFQIALMNRNLYPEITT 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L   E   Y+ S++IR +  +  DI++ VP  V   LK
Sbjct: 118 VFLMPNEKYTYLASSIIREVSRLGGDISNLVPPCVLSRLK 157


>gi|157363322|ref|YP_001470089.1| phosphopantetheine adenylyltransferase [Thermotoga lettingae TMO]
 gi|167009048|sp|A8F4E1|COAD_THELT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|157313926|gb|ABV33025.1| pantetheine-phosphate adenylyltransferase [Thermotoga lettingae
           TMO]
          Length = 164

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 94/160 (58%), Gaps = 6/160 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KAVY GSFDPIT GH+DI+ +AL   E+L I +  N  K+  F +++ER E+I   +   
Sbjct: 2   KAVYPGSFDPITYGHLDIVNRALKIFEELWIVVMSNPRKSPVF-TVEERVEMISDLV--- 57

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                  V V S++GL V+  +  + +V++RGLR +TDF YE+ M   N+ +C E  T+ 
Sbjct: 58  --KKEPNVHVDSYQGLLVDYLRSRNIKVVIRGLRAVTDFQYELEMAIANKSMCKEFETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L   E   +++S L+R + S+  D+T +VP  V   L+ +
Sbjct: 116 LMTDERFSFLSSGLVREVASMGGDVTKWVPPNVAEALEKL 155


>gi|324111528|gb|EGC05509.1| pantetheine-phosphate adenylyltransferase [Escherichia fergusonii
           B253]
 gi|325499441|gb|EGC97300.1| phosphopantetheine adenylyltransferase [Escherichia fergusonii
           ECD227]
          Length = 159

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 94/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   +++ER  L + + 
Sbjct: 1   MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSK-KPMFTLEERVALAQHAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            +        V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  ANL-----GNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+T F+P+ V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENV 150


>gi|117620670|ref|YP_854699.1| phosphopantetheine adenylyltransferase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|166216052|sp|A0KEN4|COAD_AERHH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|117562077|gb|ABK39025.1| pantetheine-phosphate adenylyltransferase [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 160

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  K +Y G+FDP+TNGH D+I +A    +++V+ +  NS   +    + ER +L +Q  
Sbjct: 1   MTNKVIYPGTFDPVTNGHTDLIGRAAKLFDEVVVGV-ANSPSKRPLFDLDERVQLARQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V+ F GL V+ A++  A V++RGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 60  AH-LPN----VKVVGFSGLLVDFAREQQANVLIRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           ++ L   E + +++STL++ +     DI  FV   V   +K
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDIRQFVDPAVAAAIK 155


>gi|154504975|ref|ZP_02041713.1| hypothetical protein RUMGNA_02485 [Ruminococcus gnavus ATCC 29149]
 gi|153794858|gb|EDN77278.1| hypothetical protein RUMGNA_02485 [Ruminococcus gnavus ATCC 29149]
          Length = 163

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 57/156 (36%), Positives = 100/156 (64%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDP+T GH+DII ++   V++LV+ +  N+ K   F S++ER ++++++  
Sbjct: 1   MLRAIYPGSFDPVTYGHLDIIRRSCKIVDELVVGVLNNNAKMPLF-SVEERVKMLEEAT- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D +N V ++ F GL ++ A+ + A VI+RGLR +TDF+YE++M+  N  L P++ T
Sbjct: 59  ---KDLTN-VRIVPFHGLLIDFARQMDAFVIIRGLRAITDFEYELQMSQTNHKLEPDLET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + L       Y++ST +R + +   D++ FVP+ V 
Sbjct: 115 MFLTTSIEYSYLSSTTVREIAAYGGDVSQFVPEAVA 150


>gi|296100498|ref|YP_003610644.1| phosphopantetheine adenylyltransferase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295054957|gb|ADF59695.1| phosphopantetheine adenylyltransferase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 159

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 92/153 (60%), Gaps = 6/153 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPITNGH+DII +A    + +++AI  +  K K    + ER  L  ++I
Sbjct: 1   MSTKAIYPGTFDPITNGHLDIITRAACMFDKVILAIAASPSK-KPMFDLNERVALATEAI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V+ F  L  N A+   A +++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  AH-LPN----VEVVGFSDLMANFARAQQATILIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           ++ L   +   +++STL++ +     D+T F+P
Sbjct: 115 SVFLMPSKEWSFISSTLVKEVARHHGDVTHFLP 147


>gi|228476266|ref|ZP_04060968.1| pantetheine-phosphate adenylyltransferase [Staphylococcus hominis
           SK119]
 gi|228269669|gb|EEK11171.1| pantetheine-phosphate adenylyltransferase [Staphylococcus hominis
           SK119]
          Length = 161

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 100/158 (63%), Gaps = 6/158 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KAV  GSFDPIT GH+DII ++    ++L + I  NS K  G  SI+ER ELI++S+ H 
Sbjct: 5   KAVIPGSFDPITYGHLDIIERSSDRFDELHVCILKNSSKA-GTFSIEERMELIRESVKH- 62

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           +P+    V V +F GL V+    I A+ I+RGLR ++DF+YE+R+TS+N+ L   + T+ 
Sbjct: 63  LPN----VKVHNFNGLLVDFCDKIGAKTIIRGLRAVSDFEYELRLTSMNKKLNSNVETMY 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +    +  +++S++++ +    ADI+ FVP  V   LK
Sbjct: 119 MMTSTNYSFISSSVVKEVAQYKADISDFVPSHVERALK 156


>gi|9971914|gb|AAG10476.1|AF279106_38 predicted phosphopantetheine adenylyltransferase [uncultured marine
           gamma proteobacterium EBAC31A08]
          Length = 195

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 95/152 (62%), Gaps = 7/152 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDPITNGH DII +     + +V+AI  +  K   F S+++R  L  QSIF
Sbjct: 1   MKVAIYPGSFDPITNGHTDIIDRGCGLFDKVVVAIAKSESKNPLF-SLEDRINL-AQSIF 58

Query: 62  HFIPDSSNRVSVISF-EGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 + +V V+ F   L V+LAKD  A  I+RGLR ++DF+YE ++ ++NR L P I 
Sbjct: 59  K----GNEKVEVVGFPRKLTVDLAKDYGACAIIRGLRAVSDFEYEFQLATMNRSLAPNIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           +I L  KES  YV+S+LI+ +  +  DI+ FV
Sbjct: 115 SIFLTPKESLIYVSSSLIKEISDLKGDISKFV 146


>gi|145590103|ref|YP_001156700.1| phosphopantetheine adenylyltransferase [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|189082579|sp|A4T072|COAD_POLSQ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|145048509|gb|ABP35136.1| Phosphopantetheine adenylyltransferase [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 165

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 101/169 (59%), Gaps = 6/169 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP T GH D++ +A S   +L++ +  +S   + F  +QER ++ K+ + 
Sbjct: 1   MTVAVYPGTFDPFTRGHEDLVRRASSIFSELIVGV-ADSRSKRPFFGLQERIDIAKEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+     + V V+ F GL  + A++ +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HY-----HNVKVVGFSGLLKDFAREHNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKY 170
           + L   +  ++++ T +R + S+  D++ FV   V  +L   + S  ++
Sbjct: 115 LFLTPSDQYQFISGTFVREIASMGGDVSKFVFPSVEKWLVQKIASGTQH 163


>gi|75675991|ref|YP_318412.1| phosphopantetheine adenylyltransferase [Nitrobacter winogradskyi
           Nb-255]
 gi|123613303|sp|Q3SRN1|COAD_NITWN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|74420861|gb|ABA05060.1| Phosphopantetheine adenylyltransferase [Nitrobacter winogradskyi
           Nb-255]
          Length = 165

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 99/163 (60%), Gaps = 3/163 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++  A++  + L++A+G +  KT  F S  +R  + + S+
Sbjct: 1   MPRVALYPGSFDPVTNGHLDVVRHAVALCDRLIVAVGVHPGKTPVF-SADDRLAMAR-SV 58

Query: 61  FHFIP-DSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           F  +  ++      ++++ L V  A  + A ++VRGLRD TD DYEM++  +N  + P++
Sbjct: 59  FEPVAVEAGCAFDCVTYDDLTVAAAHKVGATILVRGLRDGTDLDYEMQIAGMNETMAPDV 118

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            T+ + A    R +T+TL+R + ++  D++ FVP  V   L+ 
Sbjct: 119 HTVFVPASPGVRPITATLVRQIATMGGDVSPFVPQLVASRLRT 161


>gi|15837582|ref|NP_298270.1| phosphopantetheine adenylyltransferase [Xylella fastidiosa 9a5c]
 gi|14194526|sp|Q9PEP8|COAD_XYLFA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|9105912|gb|AAF83790.1|AE003936_4 lipopolysaccharide synthesis enzyme [Xylella fastidiosa 9a5c]
          Length = 162

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 93/160 (58%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K    L +Q+R  L ++++  
Sbjct: 7   RIAVYPGTFDPITNGHIDLVSRAAPLFESIVVGVAQSPSKGPS-LPLQQRVALAREALCQ 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V VI F+ L  +  + + A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  -----HENVQVIGFDTLLAHFVRHVGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   E   +++S+L+R +  +  D++ F P  V   L+ 
Sbjct: 121 FLTPAEQHSFISSSLVREIARLGGDVSGFAPAAVVAALRQ 160


>gi|322835038|ref|YP_004215065.1| pantetheine-phosphate adenylyltransferase [Rahnella sp. Y9602]
 gi|321170239|gb|ADW75938.1| pantetheine-phosphate adenylyltransferase [Rahnella sp. Y9602]
          Length = 160

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 91/154 (59%), Gaps = 6/154 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+DI+ +A    + +++AI  +  K K   S+ ER  L  Q  
Sbjct: 1   MSTKAIYPGTFDPMTNGHLDIVTRAALMFDQVILAIAASPSK-KPMFSLDERVALATQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V VI F  L  N AK+  A V+VRGLR ++DF+YEM++ ++NR L P + 
Sbjct: 60  SHL-----DNVEVIGFSDLMANFAKNQGANVLVRGLRAVSDFEYEMQLANMNRHLLPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           ++ +   +   +++S+L++ +     DIT F+P 
Sbjct: 115 SVFMMPSKEWSFISSSLVKEVARHGGDITPFLPQ 148


>gi|254498626|ref|ZP_05111345.1| truncated phosphopantetheine adenylyltransferase [Legionella
           drancourtii LLAP12]
 gi|254352166|gb|EET10982.1| truncated phosphopantetheine adenylyltransferase [Legionella
           drancourtii LLAP12]
          Length = 164

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 99/153 (64%), Gaps = 6/153 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+DII +A     +L++A+  N+ K +   S++ R   +++++
Sbjct: 1   MKTKAIYPGTFDPVTNGHVDIIGRAAKIFPELIVAVASNNAK-RPLFSLETRIRFLEEAV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P     V V+ F+ L ++  ++  A+VI+RGLR ++DF+YE ++  +NR L  ++ 
Sbjct: 60  AH-LPG----VRVMGFDNLLIDFVQEQKAEVILRGLRAVSDFEYEFQLAGMNRKLYKDVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           T+ L   E+  +++STL+R +  ++ DI+ FVP
Sbjct: 115 TLFLTPSENLMFISSTLVREIALLNGDISQFVP 147


>gi|85716507|ref|ZP_01047478.1| phosphopantetheine adenylyltransferase [Nitrobacter sp. Nb-311A]
 gi|85696696|gb|EAQ34583.1| phosphopantetheine adenylyltransferase [Nitrobacter sp. Nb-311A]
          Length = 165

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 95/162 (58%), Gaps = 1/162 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++  A+   + L++A+G +  KT  F S +ER  + +   
Sbjct: 1   MPRVALYPGSFDPVTNGHVDVVRHAIVLCDRLIVAVGVHPGKTPLF-SAEERVVMARGVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                ++       +++ L V  A+   A ++VRGLRD TD DYEM++  +N  + P++ 
Sbjct: 60  APVAAEAGCAFDCATYDSLTVVAAQKAGATILVRGLRDGTDLDYEMQIAGMNETMAPDVH 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ + A    R +T+TL+R + ++  D+++FVP  V   LK 
Sbjct: 120 TVFVPASPGVRPITATLVRQIATMGGDVSAFVPHLVASKLKT 161


>gi|262273492|ref|ZP_06051306.1| phosphopantetheine adenylyltransferase [Grimontia hollisae CIP
           101886]
 gi|262222470|gb|EEY73781.1| phosphopantetheine adenylyltransferase [Grimontia hollisae CIP
           101886]
          Length = 164

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/149 (37%), Positives = 91/149 (61%), Gaps = 6/149 (4%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D++ +A S  +D+V+ I  +  K K    + ER EL K      
Sbjct: 8   RVIYPGTFDPITNGHVDLVERAASMFDDVVVGIAASPSK-KPLFELDERVELAKA----- 61

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           + D  + VSV+ F GL V+ AK   A ++VRGLR ++DF+YE ++ ++NR L PE+ ++ 
Sbjct: 62  VTDHLDNVSVVGFSGLLVDFAKQYQANILVRGLRAVSDFEYEFQLANMNRRLMPELESVF 121

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFV 152
           L   E + +++STL++ +     D   FV
Sbjct: 122 LTPSEENSFISSTLVKEVALHGGDTRGFV 150


>gi|260553987|ref|ZP_05826252.1| phosphopantetheine adenylyltransferase [Acinetobacter sp. RUH2624]
 gi|260404873|gb|EEW98378.1| phosphopantetheine adenylyltransferase [Acinetobacter sp. RUH2624]
          Length = 163

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 91/153 (59%), Gaps = 6/153 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER  L + S+ H 
Sbjct: 5   RVIYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHKNPLF-SLEERVALAQSSLGHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V  + F+GL VN  K+  A  ++RGLR ++DF+YE ++ ++NR L P    + 
Sbjct: 64  -----SNVEFVGFDGLLVNFFKEQKATAVLRGLRAVSDFEYEFQLANMNRQLDPHFEAVF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           L   E   +++STLIR +  +  D+T FVP  V
Sbjct: 119 LTPSEQYSFISSTLIREIARLKGDVTKFVPQAV 151


>gi|56697063|ref|YP_167426.1| phosphopantetheine adenylyltransferase [Ruegeria pomeroyi DSS-3]
 gi|81558488|sp|Q5LRC9|COAD_SILPO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|56678800|gb|AAV95466.1| pantetheine-phosphate adenylyltransferase [Ruegeria pomeroyi DSS-3]
          Length = 165

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 93/161 (57%), Gaps = 1/161 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F +++ER  +I+    
Sbjct: 1   MRVALYPGTFDPITLGHVDIIRRAAALVDKLVIGVAINRDKGPLF-TLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   +    FE L ++ A+D+ AQ+IVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  ALSAETGTEIVAHPFENLLIDCARDVGAQIIVRGLRAVADFEYEFQMVGMNRALDDSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L A    + + S L++ +  +  D++ FVP  V   LK 
Sbjct: 120 VFLMADARRQAIASKLVKEIARLGGDVSKFVPPRVNDALKE 160


>gi|144899943|emb|CAM76807.1| Coenzyme A biosynthesis protein:Cytidyltransferase
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 169

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 97/164 (59%), Gaps = 1/164 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  +Y G+FDPITNGH+DI+ +A   V+ L++A+  N+ K     S+ ER  L++  +  
Sbjct: 4   RIGLYPGTFDPITNGHLDIVTRAAKVVDKLIVAVAINAGKGP-LYSLDERVALVEAEVAE 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                +  + V +F+ L V+ A+D  A++I+RGLR ++DF+YE +M  +N  L P+I T+
Sbjct: 63  VAKQHNVIIEVRAFDNLLVDFARDCGARIIIRGLRAVSDFEYEFQMAGMNARLSPQIETL 122

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
            L A E  ++++S  ++ +  +  DI+SFV   V   L    IS
Sbjct: 123 FLMASERCQFISSRFVKEIGRLGGDISSFVSPRVRASLDEKFIS 166


>gi|255689860|ref|ZP_05413535.1| pantetheine-phosphate adenylyltransferase [Bacteroides finegoldii
           DSM 17565]
 gi|260624465|gb|EEX47336.1| pantetheine-phosphate adenylyltransferase [Bacteroides finegoldii
           DSM 17565]
          Length = 151

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 100/157 (63%), Gaps = 7/157 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKA++ G+FDP T GH  ++ +AL+F++++VI IG N  K   +  I++R ++I++   
Sbjct: 1   MRKAIFPGTFDPFTIGHYSVVKRALTFMDEIVIGIGINENKNT-YFPIEKREQMIRE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +     R+ V+S+  L ++ A+++ A+ IVRG+R + DF+YE  +  +NR L   I T
Sbjct: 57  --LYKDEPRIQVMSYNCLTIDFAQEVGAKFIVRGIRTVKDFEYEETIADINRKLAG-IET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           I LF +     V+ST++R L++ + DI+ F+P+ + +
Sbjct: 114 ILLFTEPEQTCVSSTIVRELLTYNKDISQFIPEGMVI 150


>gi|71275663|ref|ZP_00651948.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related [Xylella
           fastidiosa Dixon]
 gi|71897793|ref|ZP_00680019.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related [Xylella
           fastidiosa Ann-1]
 gi|71901152|ref|ZP_00683257.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related [Xylella
           fastidiosa Ann-1]
 gi|170729518|ref|YP_001774951.1| phosphopantetheine adenylyltransferase [Xylella fastidiosa M12]
 gi|229541059|sp|B0U1Z4|COAD_XYLFM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|71163554|gb|EAO13271.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related [Xylella
           fastidiosa Dixon]
 gi|71729074|gb|EAO31200.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related [Xylella
           fastidiosa Ann-1]
 gi|71732348|gb|EAO34402.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related [Xylella
           fastidiosa Ann-1]
 gi|167964311|gb|ACA11321.1| Pantetheine-phosphate adenylyltransferase [Xylella fastidiosa M12]
          Length = 162

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 93/160 (58%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K    L +Q+R  L ++++  
Sbjct: 7   RIAVYPGTFDPITNGHIDLVSRAAPLFESIVVGVAQSPSKGPS-LPLQQRVTLAREALCQ 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V VI F+ L  +  + + A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  -----HENVQVIGFDTLLAHFVRHVGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   E   +++S+L+R +  +  D++ F P  V   L+ 
Sbjct: 121 FLTPAEQHSFISSSLVREIARLGGDVSGFAPAAVVAALRQ 160


>gi|291545921|emb|CBL19029.1| pantetheine-phosphate adenylyltransferase, bacterial [Ruminococcus
           sp. SR1/5]
          Length = 164

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 97/152 (63%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP T GH+DII +A    + +++ +  NS K+  F S++ER +++ ++  
Sbjct: 1   MITAVYPGSFDPATYGHLDIIKRASISFDRVIVGVLHNSAKSPLF-SVEERVKILTKATK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V V +FEGL+VN A++  AQVIVRGLR +TDF+YE++M   NR L P++ T
Sbjct: 60  D-IPN----VEVKAFEGLSVNFARENHAQVIVRGLRAVTDFEYELQMAQTNRVLAPDVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + L       Y++ST+++ + +   D++ F P
Sbjct: 115 VFLTTSLEYAYLSSTIMKEVANFGGDLSKFAP 146


>gi|296113922|ref|YP_003627860.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           RH4]
 gi|295921616|gb|ADG61967.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           RH4]
 gi|326559361|gb|EGE09788.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           7169]
 gi|326562485|gb|EGE12803.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           46P47B1]
 gi|326564263|gb|EGE14493.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           103P14B1]
 gi|326568297|gb|EGE18379.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           BC8]
 gi|326569998|gb|EGE20045.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           BC1]
 gi|326570079|gb|EGE20125.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           BC7]
 gi|326572934|gb|EGE22919.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           CO72]
 gi|326573820|gb|EGE23773.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           O35E]
 gi|326574760|gb|EGE24696.1| pantetheine-phosphate adenylyltransferase [Moraxella catarrhalis
           101P30B1]
          Length = 164

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 93/156 (59%), Gaps = 6/156 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           RK +Y G+FDPITNGH+D++ +AL   +++VIA+     K K      ER  L++Q    
Sbjct: 6   RKVLYPGTFDPITNGHIDLVTRALKLFDEVVIAVAFAHHK-KPIFDFDERVALVEQYF-- 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               ++ +VSV+ FEGL V  AK+     ++RGLR ++DF+YE  + ++NR L  +   +
Sbjct: 63  ---GNNPKVSVVGFEGLLVEFAKEQGVSAVLRGLRAVSDFEYEFGLANMNRSLDDDFEAV 119

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
            L   +   +++STL+R +  +  D++ FVP+ V +
Sbjct: 120 FLTPSQEYSFISSTLVREVAKLGGDVSKFVPESVLI 155


>gi|146300371|ref|YP_001194962.1| pantetheine-phosphate adenylyltransferase [Flavobacterium
           johnsoniae UW101]
 gi|189082569|sp|A5FGN1|COAD_FLAJ1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|146154789|gb|ABQ05643.1| pantetheine-phosphate adenylyltransferase [Flavobacterium
           johnsoniae UW101]
          Length = 152

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 96/157 (61%), Gaps = 7/157 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKA++ GSFDPIT GH DII + +   +++VIAIG N+ K K   S++ER   I+++  
Sbjct: 1   MRKAIFPGSFDPITLGHEDIIKRGIPLFDEIVIAIGVNAEK-KYMFSLEERKRFIEETF- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                   +VSVI++EGL ++LAK   A  I+RGLR+  DF++E  +   NR L  +I T
Sbjct: 59  ----KDEPKVSVITYEGLTIDLAKKQKAHFILRGLRNPADFEFEKAIAHTNRKLS-KIET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           + L    S+ +++S+++R ++    +    VPD V V
Sbjct: 114 VFLLTAASTSFISSSIVRDVLRHGGEYEMLVPDAVRV 150


>gi|169634070|ref|YP_001707806.1| phosphopantetheine adenylyltransferase [Acinetobacter baumannii
           SDF]
 gi|229488110|sp|B0VTH7|COAD_ACIBS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|169152862|emb|CAP01892.1| phosphopantetheine adenylyltransferase [Acinetobacter baumannii]
          Length = 163

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 90/152 (59%), Gaps = 6/152 (3%)

Query: 6   VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIP 65
           +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER  L + S+ H   
Sbjct: 7   IYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHKNPLF-SLEERVALAQSSLGHL-- 63

Query: 66  DSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALF 125
              + V  + F+GL VN  K+  A  ++RGLR ++DF+YE ++ ++NR L P    + L 
Sbjct: 64  ---SNVEFVGFDGLLVNFFKEQKATAVLRGLRAVSDFEYEFQLANMNRQLDPHFEAVFLT 120

Query: 126 AKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
             E   +++STLIR +  +  D+T FVP  V 
Sbjct: 121 PSEQYSFISSTLIREIARLKGDVTKFVPQAVV 152


>gi|326800547|ref|YP_004318366.1| phosphopantetheine adenylyltransferase [Sphingobacterium sp. 21]
 gi|326551311|gb|ADZ79696.1| Phosphopantetheine adenylyltransferase [Sphingobacterium sp. 21]
          Length = 155

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 93/158 (58%), Gaps = 6/158 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AV+ GSFDPITN HMDII++A+   +++ IAIG NS KT   LS   R  ++ ++IF 
Sbjct: 4   RVAVFPGSFDPITNAHMDIILRAIPLFDEIHIAIGLNSSKTP-LLSSDMRKTIL-EAIFK 61

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
             P     V V S+ GL VN  K++ A  I+RGLR+  DFD+E  +   NR L P I T+
Sbjct: 62  GKPS----VHVSSYTGLTVNYCKEVGASYILRGLRNAADFDFENAIAQNNRQLEPTIETV 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
            LFA     +++ST++R ++     I   VP  V  ++
Sbjct: 118 LLFASPGFGHISSTIVRDILKHRGSIKHLVPKEVLNYI 155


>gi|61212689|sp|Q7MY37|COAD_PHOLL RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
          Length = 160

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 94/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+T GH+DI+ +A    + ++ AI  NS +     ++ ER  L K+  
Sbjct: 1   MKTKAIYPGTFDPVTYGHIDIVTRAADMFDHVLFAI-ANSARKNPMFTLDERITLAKEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V VI F  L  N AK   A +++RGLR ++DF+YE ++ ++NR   PE+ 
Sbjct: 60  SHL-----DNVEVIGFCELMANFAKKQQANILIRGLRSVSDFEYEWQLANMNRHFMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   ++  +++S+LI+ +   D DI+SF+P+P+ 
Sbjct: 115 SVFLLPSQNLSFLSSSLIKDVALHDGDISSFLPEPIA 151


>gi|145301058|ref|YP_001143899.1| phosphopantetheine adenylyltransferase [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|166216053|sp|A4STC9|COAD_AERS4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|142853830|gb|ABO92151.1| pantetheine-phosphate adenylyltransferase [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|224995191|gb|ACN76678.1| CoaD [Aeromonas salmonicida]
          Length = 160

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 58/157 (36%), Positives = 95/157 (60%), Gaps = 7/157 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  K +Y G+FDPITNGH D+I +A    +++V+ +  NS   +    + ER  L +Q  
Sbjct: 1   MTNKVIYPGTFDPITNGHTDLIGRAARLFDEVVVGV-ANSPSKRPLFDLAERVLLARQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V+ F GL V+ AK+  A V++RGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 60  AH-LPN----VKVVGFSGLLVDFAKEQQANVLIRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E + +++STL++ +     DI  FV DP+ 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDIRQFV-DPIV 150


>gi|260654804|ref|ZP_05860292.1| pantetheine-phosphate adenylyltransferase [Jonquetella anthropi
           E3_33 E1]
 gi|260630519|gb|EEX48713.1| pantetheine-phosphate adenylyltransferase [Jonquetella anthropi
           E3_33 E1]
          Length = 170

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 96/159 (60%), Gaps = 6/159 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           +A+Y GSFDPITNGH+ I  +A +  E+L ++I  N  K   F SI+ER E+ ++++ H 
Sbjct: 6   RAIYPGSFDPITNGHVFIAERAAALFEELYVSILVNPQKKSAF-SIEERQEMAQEALSH- 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           +P+    V V +FEGL V+  + I  +V+VRGLR ++DF+YE +M  +NR L PEI T+ 
Sbjct: 64  LPN----VRVNAFEGLLVDFMRQIQCRVVVRGLRALSDFEYEFQMAQMNRQLAPEIETLF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           +  +    Y++S  ++ +      + + VP  V   L+ 
Sbjct: 120 IVTEARYSYLSSHAVKDVFRFGGAVQNMVPPGVYRRLRE 158


>gi|28198198|ref|NP_778512.1| phosphopantetheine adenylyltransferase [Xylella fastidiosa
           Temecula1]
 gi|182680833|ref|YP_001828993.1| phosphopantetheine adenylyltransferase [Xylella fastidiosa M23]
 gi|31563025|sp|Q87EM8|COAD_XYLFT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541055|sp|B2I7J1|COAD_XYLF2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|28056268|gb|AAO28161.1| phosphopantetheine adenyltransferase [Xylella fastidiosa Temecula1]
 gi|182630943|gb|ACB91719.1| pantetheine-phosphate adenylyltransferase [Xylella fastidiosa M23]
 gi|307579301|gb|ADN63270.1| phosphopantetheine adenylyltransferase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 162

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 93/160 (58%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K    L +Q+R  L ++++  
Sbjct: 7   RIAVYPGTFDPITNGHIDLVSRAAPLFESVVVGVAQSPSKGPS-LPLQQRVTLAREALCQ 65

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V VI F+ L  +  + + A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 66  -----HENVQVIGFDTLLAHFVRHVGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   E   +++S+L+R +  +  D++ F P  V   L+ 
Sbjct: 121 FLTPAEQHSFISSSLVREIARLGGDVSGFAPAAVVAALRQ 160


>gi|153949256|ref|YP_001399066.1| phosphopantetheine adenylyltransferase [Yersinia pseudotuberculosis
           IP 31758]
 gi|170026358|ref|YP_001722863.1| phosphopantetheine adenylyltransferase [Yersinia pseudotuberculosis
           YPIII]
 gi|186893396|ref|YP_001870508.1| phosphopantetheine adenylyltransferase [Yersinia pseudotuberculosis
           PB1/+]
 gi|167009049|sp|A7FCT8|COAD_YERP3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541056|sp|B2JYN7|COAD_YERPB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541057|sp|B1JQW9|COAD_YERPY RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|152960751|gb|ABS48212.1| pantetheine-phosphate adenylyltransferase [Yersinia
           pseudotuberculosis IP 31758]
 gi|169752892|gb|ACA70410.1| pantetheine-phosphate adenylyltransferase [Yersinia
           pseudotuberculosis YPIII]
 gi|186696422|gb|ACC87051.1| pantetheine-phosphate adenylyltransferase [Yersinia
           pseudotuberculosis PB1/+]
          Length = 159

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 94/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ KA+Y G+FDPITNGH+D++ +A +    +++AI  +S K K   ++ ER  L K+  
Sbjct: 1   MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSK-KPMFTLDERVALAKK-- 57

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +      V V+ F  L    AK  +A ++VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 58  ---VTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E   +++S+L++ +     DIT F+P PV 
Sbjct: 115 SVFLMPSEKWSFISSSLVKEVARHGGDITPFLPKPVT 151


>gi|114565076|ref|YP_752590.1| phosphopantetheine adenylyltransferase [Shewanella frigidimarina
           NCIMB 400]
 gi|122298325|sp|Q07W63|COAD_SHEFN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|114336369|gb|ABI73751.1| pantetheine-phosphate adenylyltransferase [Shewanella frigidimarina
           NCIMB 400]
          Length = 168

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 94/161 (58%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R+A+Y G+FDP+TNGH D+I +A    + ++I I  N  K   F S++ER   +    
Sbjct: 1   MHRRAIYPGTFDPVTNGHADLIERAARLFKHVIIGIASNPSKQPRF-SLEERVAQVNLVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F GL V+ AK+  A V++RGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 60  AHL-----KNVEVVGFTGLLVDFAKEQHASVLIRGLRAVSDFEYEFQLANMNRRLSPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           ++ L   E + +++STL++ +     D++ FV   +   LK
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPQIAAALK 155


>gi|253991834|ref|YP_003043190.1| phosphopantetheine adenylyltransferase [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253783284|emb|CAQ86449.1| phosphopantetheine adenylyltransferase [Photorhabdus asymbiotica]
          Length = 160

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 93/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+T GH+DI+ +A    + ++ AI  NS +     ++ ER  + K+  
Sbjct: 1   MKTKAIYPGTFDPVTYGHIDIVTRAAGMFDHVLFAI-ANSARKNPVFTLDERVAMAKEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F  L  N AK   A +++RGLR ++DF+YE ++ ++NR   PE+ 
Sbjct: 60  SHL-----DNVEVVGFCELMANFAKKQQANILIRGLRSVSDFEYEWQLANMNRHFMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   ++  +V+S+LI+ +   D DI+SF+P+P  
Sbjct: 115 SVFLLPSQNLSFVSSSLIKDVARHDGDISSFLPEPAA 151


>gi|254467055|ref|ZP_05080466.1| pantetheine-phosphate adenylyltransferase [Rhodobacterales
           bacterium Y4I]
 gi|206687963|gb|EDZ48445.1| pantetheine-phosphate adenylyltransferase [Rhodobacterales
           bacterium Y4I]
          Length = 166

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 88/151 (58%), Gaps = 1/151 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH DII +A + V+ LVI +  N  K   F  ++ER  +I+    
Sbjct: 1   MRVGLYPGTFDPITIGHTDIIRRASALVDKLVIGVAINRDKGPLF-PLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   +    FE L +N A+D+ AQ+IVRGLR + DF+YE +M  +NR L   I T
Sbjct: 60  KLSEETGTEIVAHPFENLLINCARDVGAQIIVRGLRAVADFEYEFQMVGMNRVLDSSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L A+   + V S L++ +  +D D++ FV
Sbjct: 120 VFLMAEARHQAVASKLVKEIARLDGDVSKFV 150


>gi|284055782|pdb|3L92|A Chain A, Phosphopantetheine Adenylyltransferase From Yersinia
           Pestis Complexed With Coenzyme A.
 gi|284055783|pdb|3L93|A Chain A, Phosphopantetheine Adenylyltransferase From Yersinia
           Pestis
          Length = 162

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 94/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ KA+Y G+FDPITNGH+D++ +A +    +++AI  +S K K   ++ ER  L K+  
Sbjct: 4   MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSK-KPMFTLDERVALAKK-- 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +      V V+ F  L    AK  +A ++VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 61  ---VTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLE 117

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E   +++S+L++ +     DIT F+P PV 
Sbjct: 118 SVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVT 154


>gi|153814838|ref|ZP_01967506.1| hypothetical protein RUMTOR_01053 [Ruminococcus torques ATCC 27756]
 gi|317500354|ref|ZP_07958579.1| phosphopantetheine adenylyltransferase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331089637|ref|ZP_08338536.1| pantetheine-phosphate adenylyltransferase [Lachnospiraceae
           bacterium 3_1_46FAA]
 gi|145847869|gb|EDK24787.1| hypothetical protein RUMTOR_01053 [Ruminococcus torques ATCC 27756]
 gi|316898295|gb|EFV20341.1| phosphopantetheine adenylyltransferase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330405005|gb|EGG84543.1| pantetheine-phosphate adenylyltransferase [Lachnospiraceae
           bacterium 3_1_46FAA]
          Length = 165

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 100/160 (62%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDP+T GH+DI+ ++   V++L++ +  N  K   F S++ER +++K+   
Sbjct: 1   MLRAIYPGSFDPVTYGHIDIMRRSCKIVDELIVGVLSNKAKIPLF-SVEERVKMLKE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +    + + ++ F+GL V  A  ++A +++RGLR +TDF+YE++M+  N+ L P I T
Sbjct: 57  --VTKDLDNIRIVPFDGLLVEFASRMNAGLVIRGLRAITDFEYELQMSQTNQKLDPNIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L       Y++ST +R + +   D+T FVP+ V + L+
Sbjct: 115 MFLTTSIEYSYLSSTTVREIAAFGGDLTQFVPEAVALELE 154


>gi|37528665|ref|NP_932010.1| phosphopantetheine adenylyltransferase [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36788104|emb|CAE17228.1| phosphopantetheine adenylyltransferase (Pantetheine-phosphate
           adenylyltransferase) (PPAT) (dephospho-CoA
           pyrophosphorylase) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 161

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 94/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+T GH+DI+ +A    + ++ AI  NS +     ++ ER  L K+  
Sbjct: 2   MKTKAIYPGTFDPVTYGHIDIVTRAADMFDHVLFAI-ANSARKNPMFTLDERITLAKEVT 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V VI F  L  N AK   A +++RGLR ++DF+YE ++ ++NR   PE+ 
Sbjct: 61  SHL-----DNVEVIGFCELMANFAKKQQANILIRGLRSVSDFEYEWQLANMNRHFMPELE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   ++  +++S+LI+ +   D DI+SF+P+P+ 
Sbjct: 116 SVFLLPSQNLSFLSSSLIKDVALHDGDISSFLPEPIA 152


>gi|22124008|ref|NP_667431.1| phosphopantetheine adenylyltransferase [Yersinia pestis KIM 10]
 gi|45439919|ref|NP_991458.1| phosphopantetheine adenylyltransferase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108809480|ref|YP_653396.1| phosphopantetheine adenylyltransferase [Yersinia pestis Antiqua]
 gi|108813957|ref|YP_649724.1| phosphopantetheine adenylyltransferase [Yersinia pestis Nepal516]
 gi|145601092|ref|YP_001165168.1| phosphopantetheine adenylyltransferase [Yersinia pestis Pestoides
           F]
 gi|150260883|ref|ZP_01917611.1| phosphopantetheine adenylyltransferase [Yersinia pestis CA88-4125]
 gi|162421465|ref|YP_001604699.1| phosphopantetheine adenylyltransferase [Yersinia pestis Angola]
 gi|165926191|ref|ZP_02222023.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165936149|ref|ZP_02224718.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011500|ref|ZP_02232398.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166213697|ref|ZP_02239732.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167419199|ref|ZP_02310952.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167426659|ref|ZP_02318412.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167469343|ref|ZP_02334047.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis FV-1]
 gi|218927274|ref|YP_002345149.1| phosphopantetheine adenylyltransferase [Yersinia pestis CO92]
 gi|229836166|ref|ZP_04456334.1| phosphopantetheine adenylyltransferase [Yersinia pestis Pestoides
           A]
 gi|229839902|ref|ZP_04460061.1| phosphopantetheine adenylyltransferase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229841984|ref|ZP_04462139.1| phosphopantetheine adenylyltransferase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229904487|ref|ZP_04519598.1| phosphopantetheine adenylyltransferase [Yersinia pestis Nepal516]
 gi|270488486|ref|ZP_06205560.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis KIM D27]
 gi|294502158|ref|YP_003566220.1| phosphopantetheine adenylyltransferase [Yersinia pestis Z176003]
 gi|29427901|sp|Q8ZJN9|COAD_YERPE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|122979352|sp|Q1C271|COAD_YERPA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|122979882|sp|Q1CD06|COAD_YERPN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216619|sp|A4TSD3|COAD_YERPP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541058|sp|A9R678|COAD_YERPG RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|21956750|gb|AAM83682.1|AE013609_7 putative enzyme of lipopolysaccharide synthesis [Yersinia pestis
           KIM 10]
 gi|45434774|gb|AAS60335.1| phosphopantetheine adenylyltransferase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108777605|gb|ABG20124.1| Phosphopantetheine adenylyltransferase [Yersinia pestis Nepal516]
 gi|108781393|gb|ABG15451.1| Phosphopantetheine adenylyltransferase [Yersinia pestis Antiqua]
 gi|115345885|emb|CAL18743.1| phosphopantetheine adenylyltransferase [Yersinia pestis CO92]
 gi|145212788|gb|ABP42195.1| Phosphopantetheine adenylyltransferase [Yersinia pestis Pestoides
           F]
 gi|149290291|gb|EDM40368.1| phosphopantetheine adenylyltransferase [Yersinia pestis CA88-4125]
 gi|162354280|gb|ABX88228.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis Angola]
 gi|165915763|gb|EDR34371.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165922051|gb|EDR39228.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165989646|gb|EDR41947.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166205099|gb|EDR49579.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166963193|gb|EDR59214.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167054348|gb|EDR64165.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|229678605|gb|EEO74710.1| phosphopantetheine adenylyltransferase [Yersinia pestis Nepal516]
 gi|229690294|gb|EEO82348.1| phosphopantetheine adenylyltransferase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229696268|gb|EEO86315.1| phosphopantetheine adenylyltransferase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229706614|gb|EEO92620.1| phosphopantetheine adenylyltransferase [Yersinia pestis Pestoides
           A]
 gi|262360237|gb|ACY56958.1| phosphopantetheine adenylyltransferase [Yersinia pestis D106004]
 gi|262364184|gb|ACY60741.1| phosphopantetheine adenylyltransferase [Yersinia pestis D182038]
 gi|270336990|gb|EFA47767.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis KIM D27]
 gi|294352617|gb|ADE62958.1| phosphopantetheine adenylyltransferase [Yersinia pestis Z176003]
 gi|320013407|gb|ADV96978.1| phosphopantetheine adenylyltransferase [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 159

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 94/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ KA+Y G+FDPITNGH+D++ +A +    +++AI  +S K K   ++ ER  L K+  
Sbjct: 1   MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSK-KPMFTLDERVALAKK-- 57

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +      V V+ F  L    AK  +A ++VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 58  ---VTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E   +++S+L++ +     DIT F+P PV 
Sbjct: 115 SVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVT 151


>gi|325915120|ref|ZP_08177446.1| Phosphopantetheine adenylyltransferase [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325538642|gb|EGD10312.1| Phosphopantetheine adenylyltransferase [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 168

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 97/161 (60%), Gaps = 6/161 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K    L +++R  L ++++  
Sbjct: 7   RTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPA-LPLEKRVALAQEAL-- 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +   V V  F+ L  +  +D++A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 64  ---AAHTNVEVRGFDTLLAHFVRDMNAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            L   E   +++S+L+R +  +  D++ FVP  V   L+ +
Sbjct: 121 FLTPAEQYSFISSSLVREIARLGGDVSGFVPASVVEALRQV 161


>gi|224372858|ref|YP_002607230.1| pantetheine-phosphate adenylyltransferase [Nautilia profundicola
           AmH]
 gi|254764162|sp|B9L9C2|COAD_NAUPA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|223589545|gb|ACM93281.1| pantetheine-phosphate adenylyltransferase [Nautilia profundicola
           AmH]
          Length = 154

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 100/156 (64%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+DII +A    + +++A+  N  K K   S+++R EL+K++ 
Sbjct: 1   MYTKAIYPGTFDPVTNGHLDIIKRACKMFDKIIVAVADNKDK-KTMFSLEKRVELMKKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P    ++ V SF  L V+ A++   ++I+RGLR ++DF+YE++M   N+ L  EI 
Sbjct: 60  SH-LP----KIEVESFNSLLVDFAREKECKIIIRGLRAVSDFEYELQMGYANKSLDSEID 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           TI L     + +++S+++R ++  + D++  +P+ +
Sbjct: 115 TIYLMPNLENAFISSSVVRSILKYNGDVSHLIPNEI 150


>gi|188991177|ref|YP_001903187.1| phosphopantetheine adenylyltransferase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|229541053|sp|B0RRP8|COAD_XANCB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|167732937|emb|CAP51133.1| Pantetheine-phosphate adenylyltransferase [Xanthomonas campestris
           pv. campestris]
          Length = 168

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K    L ++ R EL ++++  
Sbjct: 7   RIAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPA-LPLERRVELAQEAL-- 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +   V V  F+ L  +  +D+ A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 64  ---AAHANVEVRGFDTLLAHFVRDMGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            L   E   +++S+L+R +  +  D++ FVP  V   L+ +
Sbjct: 121 FLTPAEQYSFISSSLVREIARLGGDVSGFVPASVVDALRQV 161


>gi|289665569|ref|ZP_06487150.1| phosphopantetheine adenylyltransferase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 168

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K    LS++ R  L ++++  
Sbjct: 7   RTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPA-LSLERRVALAQEAL-- 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +   V V  F+ L  +  +++ A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 64  ---AAHTNVEVRGFDTLLAHFVREMGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            L   E   +++S+L+R +  +  D++ FVP  V   L+ +
Sbjct: 121 FLTPAEQYSFISSSLVREIARLGGDVSGFVPASVVEALRQV 161


>gi|114768824|ref|ZP_01446450.1| pantetheine-phosphate adenylyltransferase [alpha proteobacterium
           HTCC2255]
 gi|114549741|gb|EAU52622.1| pantetheine-phosphate adenylyltransferase [alpha proteobacterium
           HTCC2255]
          Length = 165

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 98/160 (61%), Gaps = 2/160 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A   V+ LVI +  N  K   F S++ER E+I++++ 
Sbjct: 1   MRIGLYPGTFDPITRGHLDIIKRACVLVDKLVIGVAINRDKNPLF-SLEERVEMIERNLS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F  + +N + V  FE L ++ A ++ AQ+I+RGLR ++DF+YE ++  +NR +   I T
Sbjct: 60  KFEHNETN-IIVEPFENLLIDKATEVGAQIIIRGLRAVSDFEYEYQLVGMNRAMNDNIET 118

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
             L A+   + + S L++ +  ++ D++ FV   V   LK
Sbjct: 119 TFLMAEAKHQAIASRLVKEIARLNGDVSKFVTPGVETSLK 158


>gi|78048265|ref|YP_364440.1| phosphopantetheine adenylyltransferase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325927068|ref|ZP_08188338.1| Phosphopantetheine adenylyltransferase [Xanthomonas perforans
           91-118]
 gi|123584739|sp|Q3BS23|COAD_XANC5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|78036695|emb|CAJ24386.1| Pantetheine-phosphate adenylyltransferase [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|325542567|gb|EGD14039.1| Phosphopantetheine adenylyltransferase [Xanthomonas perforans
           91-118]
          Length = 168

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K    LS++ R  L ++++  
Sbjct: 7   RTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPA-LSLERRVALAQEAL-- 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +   V V  F+ L  +  +++ A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 64  ---AAHTNVEVRGFDTLLAHFVREMGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            L   E   +++S+L+R +  +  D++ FVP  V   L+ +
Sbjct: 121 FLTPAEQYSFISSSLVREIARLGGDVSGFVPASVVEALRQV 161


>gi|227539696|ref|ZP_03969745.1| pantetheine-phosphate adenylyltransferase [Sphingobacterium
           spiritivorum ATCC 33300]
 gi|227240338|gb|EEI90353.1| pantetheine-phosphate adenylyltransferase [Sphingobacterium
           spiritivorum ATCC 33300]
          Length = 159

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 99/161 (61%), Gaps = 5/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AV+ GSFDP+T  H DI+++AL   + +++A+G NS K +G LS  +R  ++ Q +F
Sbjct: 1   MKVAVFPGSFDPVTLAHQDIVLRALELFDRIIVAVGTNSTK-QGLLSTDDRVAIL-QEVF 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               + S+RV V +++GL V+  +   A  I+RGLR+  DF++E  +   N+ L PEI T
Sbjct: 59  ---AEVSDRVEVTTYKGLTVDYCRQAGANYILRGLRNTNDFEFEYAIAQNNKHLAPEIDT 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           I L +     +++ST++R +     DI+S VP  V  ++++
Sbjct: 116 IFLMSTSGLGHISSTIVRDVTLHKGDISSMVPAAVIAYMES 156


>gi|192359123|ref|YP_001983956.1| pantetheine-phosphate adenylyltransferase [Cellvibrio japonicus
           Ueda107]
 gi|190685288|gb|ACE82966.1| pantetheine-phosphate adenylyltransferase [Cellvibrio japonicus
           Ueda107]
          Length = 176

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 104/161 (64%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPITNGH+D++ +A    +++++A+  ++ K   F S+ +R +L ++++ 
Sbjct: 17  MRTVLYPGTFDPITNGHIDLVERACRLFDNVIVAVAASTRKNPLF-SLDQRVQLAQETLS 75

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V+V+ F+ L V+  K  +AQ ++RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 76  H-LPN----VTVVGFDILLVDFVKQQNAQAVLRGLRAVSDFEYEFQLANMNRALAPDMES 130

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           I L   E   +++S+++R +  +  D++ FV  PV   L+ 
Sbjct: 131 IFLTPAEHLSFISSSIVREIAMLGGDVSKFVAPPVEAALRQ 171


>gi|163755783|ref|ZP_02162901.1| phosphopantetheine adenylyltransferase [Kordia algicida OT-1]
 gi|161324304|gb|EDP95635.1| phosphopantetheine adenylyltransferase [Kordia algicida OT-1]
          Length = 150

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 96/157 (61%), Gaps = 7/157 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++A++ GSFDPIT GH DII + +   +++++AIG NS K K   S++ER + I+ S  
Sbjct: 1   MKRAIFPGSFDPITLGHYDIIQRGIKLFDEVIVAIGVNSAK-KYMFSLEERKKFIEDSF- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                   +V+V+++EGL V+  +  +   I+RGLR+  DF++E  +   NR L P + T
Sbjct: 59  ----KDEPKVTVVTYEGLTVDFCEKHNVDFILRGLRNPADFEFEKAIAHTNRDLAP-VET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           I L    S+ Y++S+++R +I  + D T  VPD V V
Sbjct: 114 IFLLTAASTSYISSSIVREVIRHNGDYTLLVPDSVRV 150


>gi|209519638|ref|ZP_03268428.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp. H160]
 gi|209499924|gb|EDZ99989.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp. H160]
          Length = 169

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 58/163 (35%), Positives = 101/163 (61%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F ++QER  +  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRAKKPFFTLQERLAIAHEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+SF+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VQVMSFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              +  ++++ T++R +  +  D++ FV   V  +LK  V SL
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLKEKVASL 160


>gi|302670817|ref|YP_003830777.1| pantetheine-phosphate adenylyltransferase CoaD [Butyrivibrio
           proteoclasticus B316]
 gi|302395290|gb|ADL34195.1| pantetheine-phosphate adenylyltransferase CoaD [Butyrivibrio
           proteoclasticus B316]
          Length = 164

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 102/162 (62%), Gaps = 7/162 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDP+T GH+DII +A    + +++A+ CNS KT  F ++ ER ++I++S  
Sbjct: 1   MKTAVYPGSFDPVTYGHLDIIRRASRMFDTVIVAVMCNSAKTPLF-TLDERVKMIRES-- 57

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCP-EIA 120
             + D  N V + SF+GL +N  K+ +  ++VRGLR +TDF+YE+++   NR L   E+ 
Sbjct: 58  --VKDLDN-VVIESFDGLLINYCKEKNIHIVVRGLRAITDFEYELQIAQTNRELSHNEVD 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ L       Y++S++++ + S + DIT  VPD V   L N
Sbjct: 115 TVFLTTNLKYSYLSSSVVKEIASYNGDITPCVPDFVAEELYN 156


>gi|295675396|ref|YP_003603920.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp.
           CCGE1002]
 gi|295435239|gb|ADG14409.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp.
           CCGE1002]
          Length = 169

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 58/163 (35%), Positives = 101/163 (61%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F ++QER  +  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRAKKPFFTLQERLAIAHEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+SF+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VQVMSFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              +  ++++ T++R +  +  D++ FV   V  +LK  V SL
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLKEKVASL 160


>gi|45644627|gb|AAS73015.1| predicted phosphopantetheine adenylyltransferase [uncultured marine
           gamma proteobacterium EBAC20E09]
          Length = 160

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 66/161 (40%), Positives = 100/161 (62%), Gaps = 7/161 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDPIT GHMDII +A    + ++IA+  +  K K   ++++R +L K    
Sbjct: 1   MRVAIYPGSFDPITYGHMDIIDRASGLFDKIIIAVAKSEAK-KPLFTLEDRMKLAKT--- 56

Query: 62  HFIPDSSNRVSVISF-EGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             I   + +V V+ F   L V++AK+ SA  I+RGLR ++DF+YE ++ ++NR L P+I 
Sbjct: 57  --IYGDNEKVDVVGFPRQLTVDVAKEHSACAIIRGLRAVSDFEYEFQLATMNRSLAPDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +I L  KES  YV+S+LI+ +  +  DI+ FV   V   LK
Sbjct: 115 SIFLTPKESLIYVSSSLIKEICDLKGDISKFVHPSVEQALK 155


>gi|167402125|ref|ZP_02307602.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167048500|gb|EDR59908.1| pantetheine-phosphate adenylyltransferase [Yersinia pestis biovar
           Antiqua str. UG05-0454]
          Length = 172

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 94/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ KA+Y G+FDPITNGH+D++ +A +    +++AI  +S K K   ++ ER  L K+  
Sbjct: 14  MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSK-KPMFTLDERVALAKK-- 70

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +      V V+ F  L    AK  +A ++VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 71  ---VTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLE 127

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E   +++S+L++ +     DIT F+P PV 
Sbjct: 128 SVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVT 164


>gi|163814171|ref|ZP_02205563.1| hypothetical protein COPEUT_00325 [Coprococcus eutactus ATCC 27759]
 gi|158450620|gb|EDP27615.1| hypothetical protein COPEUT_00325 [Coprococcus eutactus ATCC 27759]
          Length = 162

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 98/160 (61%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDP+T GH+DII ++    ++L + +  N+ KT  F S+ ER  ++K ++ 
Sbjct: 1   MSRAIYPGSFDPVTLGHLDIIKRSAEMFDELTVGVLNNTAKTPLF-SLDERVNMLK-NVV 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V V+ F GL V+ A+    +VIVRGLR +TDF+YE+++   NR + P+I T
Sbjct: 59  SDIPN----VKVVGFGGLLVDYARQNDIKVIVRGLRAVTDFEYELQIAQSNRKVAPDIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L       Y++S++++   S   D+  FVP+P+   LK
Sbjct: 115 VFLTTNIQYSYLSSSIVKEYASFGVDVKDFVPEPIQDILK 154


>gi|23098906|ref|NP_692372.1| phosphopantetheine adenyltransferase [Oceanobacillus iheyensis
           HTE831]
 gi|29427764|sp|Q8ER64|COAD_OCEIH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|22777133|dbj|BAC13407.1| phosphopantetheine adenyltransferase (pantetheine-phosphate
           adenylyltransferase) [Oceanobacillus iheyensis HTE831]
          Length = 161

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 102/161 (63%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+  GSFDPITNGH+DII +  +  E++++ +  N  K+  F S+ ER EL++ SI
Sbjct: 1   MGKLAICPGSFDPITNGHLDIIQRGANVFEEVIVTVFNNQSKSPLF-SVTERIELLEDSI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H IP+    VSV S   L ++ A++  A  ++RGLR ++DF+YEM++TS+NR L  +I 
Sbjct: 60  KH-IPN----VSVDSSSRLLMDYAREKKAHAVIRGLRAVSDFEYEMQITSMNRKLNEDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ +       +++S++++ +   D +I+  VP+PV   LK
Sbjct: 115 TLFMMTNNQYSFLSSSMVKEIAKYDGNISGLVPEPVEKALK 155


>gi|293364743|ref|ZP_06611460.1| pantetheine-phosphate adenylyltransferase [Streptococcus oralis
           ATCC 35037]
 gi|307702990|ref|ZP_07639937.1| pantetheine-phosphate adenylyltransferase [Streptococcus oralis
           ATCC 35037]
 gi|291316193|gb|EFE56629.1| pantetheine-phosphate adenylyltransferase [Streptococcus oralis
           ATCC 35037]
 gi|307623383|gb|EFO02373.1| pantetheine-phosphate adenylyltransferase [Streptococcus oralis
           ATCC 35037]
          Length = 162

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 94/158 (59%), Gaps = 5/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+TNGH+DII +A    + L + +  N  K +GFL ++ R   +K+++ H  
Sbjct: 6   GLFTGSFDPMTNGHLDIIERASKLFDKLYVGVFYNPHK-QGFLPVENRKRAVKKAVAHL- 63

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
              +N   + S + L V++A+ + A+ +VRGLR+ TD  YE      N  L PEI TI L
Sbjct: 64  ---ANVEVLASHDQLVVDVARRLGAKTLVRGLRNATDLQYESSFDYYNHQLAPEIETIYL 120

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           ++++   Y++S+ +R L+    +I  +VP+ V   L++
Sbjct: 121 YSRQEHLYISSSAVRELLKFGQEIQQYVPNSVVEELEH 158


>gi|160884653|ref|ZP_02065656.1| hypothetical protein BACOVA_02642 [Bacteroides ovatus ATCC 8483]
 gi|156109688|gb|EDO11433.1| hypothetical protein BACOVA_02642 [Bacteroides ovatus ATCC 8483]
          Length = 152

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 98/152 (64%), Gaps = 7/152 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKA++ G+FDP T GH  ++ +AL+F++++VI IG N  K   +  I++R E+I++   
Sbjct: 1   MRKAIFPGTFDPFTIGHYSVVERALTFMDEIVIGIGINENKNT-YFPIEKREEMIRE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +     R+ V+S++ L ++ A+++ A+ IVRG+R + DF+YE  +  +NR L   I T
Sbjct: 57  --LYKDEPRIQVMSYDCLTIDFAQEVEARFIVRGIRTVKDFEYEETIADINRKLAG-IET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           I LF +     V+ST++R L++ + DI+ F+P
Sbjct: 114 ILLFTEPELTCVSSTIVRELLTYNKDISQFIP 145


>gi|152972480|ref|YP_001337626.1| phosphopantetheine adenylyltransferase [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238897075|ref|YP_002921821.1| phosphopantetheine adenylyltransferase [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262040683|ref|ZP_06013921.1| pantetheine-phosphate adenylyltransferase [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|329996930|ref|ZP_08302627.1| pantetheine-phosphate adenylyltransferase [Klebsiella sp. MS 92-3]
 gi|8469202|sp|Q9XC89|COAD_KLEPN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216554|sp|A6TFM5|COAD_KLEP7 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|5006992|gb|AAD37773.1|AF146532_13 KdtB [Klebsiella pneumoniae]
 gi|150957329|gb|ABR79359.1| phosphopantetheine adenylyltransferase [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238549403|dbj|BAH65754.1| phosphopantetheine adenylyltransferase [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|259042047|gb|EEW43080.1| pantetheine-phosphate adenylyltransferase [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|328539220|gb|EGF65249.1| pantetheine-phosphate adenylyltransferase [Klebsiella sp. MS 92-3]
          Length = 159

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 94/162 (58%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPITNGH+DI+ +A S  + +V+AI  +  K K   S+ ER  L +Q+ 
Sbjct: 1   MSTKAIYPGTFDPITNGHIDIVTRAASMFDKVVLAIAASPSK-KPMFSLDERIALAEQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +      V VI F  L  N A+   A +++RGLR + DF+YEM++  +NR L P + 
Sbjct: 60  AHLV-----NVEVIGFSDLMANFARAQQANILIRGLRAVADFEYEMQLAHMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           ++ L   +   +++S+L++ +     D++ F+P  V   L N
Sbjct: 115 SVFLMPCKEWSFISSSLVKEVARHQGDVSHFLPANVHQALLN 156


>gi|302386345|ref|YP_003822167.1| pantetheine-phosphate adenylyltransferase [Clostridium
           saccharolyticum WM1]
 gi|302196973|gb|ADL04544.1| pantetheine-phosphate adenylyltransferase [Clostridium
           saccharolyticum WM1]
          Length = 162

 Score =  114 bits (284), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 95/152 (62%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKAVY GSFDP+T GH+DII ++    + L+I +  N  KT  F S++ER  ++K S+ 
Sbjct: 1   MRKAVYPGSFDPVTFGHLDIIERSARMSDHLIIGVLNNYSKTPLF-SVEERVNMLK-SLT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P+    V VI+F GL V+  +   A  ++RGLR +TDF+YE+++   NR + PEI T
Sbjct: 59  KDLPN----VEVIAFGGLLVDFVRANQADAVIRGLRAVTDFEYELQIAQTNRVMAPEIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + L       Y++S++++ + S   +I +FVP
Sbjct: 115 VFLTTNLKYSYLSSSIVKEIASYGGEINTFVP 146


>gi|123440467|ref|YP_001004461.1| phosphopantetheine adenylyltransferase [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|166216618|sp|A1JHR9|COAD_YERE8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|122087428|emb|CAL10209.1| phosphopantetheine adenylyltransferase [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 159

 Score =  114 bits (284), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 93/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ KA+Y G+FDPITNGH+D++ +A      +++AI  +S K K   ++ ER  L KQ  
Sbjct: 1   MITKAIYPGTFDPITNGHLDLVTRASEMFSHVILAIADSSSK-KPMFTLAERVILAKQ-- 57

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +      V V+ F  L    AK  +A ++VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 58  ---VTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E   +++S+L++ +     DIT F+P PV 
Sbjct: 115 SVFLMPSEKWSFISSSLVKEVARHGGDITPFLPAPVT 151


>gi|21243259|ref|NP_642841.1| phosphopantetheine adenylyltransferase [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|294624504|ref|ZP_06703185.1| phosphopantetheine adenylyltransferase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294664782|ref|ZP_06730107.1| phosphopantetheine adenylyltransferase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|29427841|sp|Q8PJK5|COAD_XANAC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|21108793|gb|AAM37377.1| lipopolysaccharide synthesis enzyme [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|292601197|gb|EFF45253.1| phosphopantetheine adenylyltransferase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292605439|gb|EFF48765.1| phosphopantetheine adenylyltransferase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 168

 Score =  114 bits (284), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K    LS++ R  L ++++  
Sbjct: 7   RTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPA-LSLERRVALAQEAL-- 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +   V V  F+ L  +  +++ A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 64  ---AAHANVEVRGFDTLLAHFVREMGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            L   E   +++S+L+R +  +  D++ FVP  V   L+ +
Sbjct: 121 FLTPAEQYSFISSSLVREIARLGGDVSGFVPASVVEALRQV 161


>gi|330814110|ref|YP_004358349.1| phosphopantetheine adenylyltransferase [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487205|gb|AEA81610.1| phosphopantetheine adenylyltransferase [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 163

 Score =  114 bits (284), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 96/160 (60%), Gaps = 5/160 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  +Y G+FDPIT GH+DII +A   V+ L ++I  +  K K   S +ER +++K+S+
Sbjct: 1   MKKIGIYPGTFDPITLGHLDIIKRASQIVDTLYVSIALSKNK-KTLFSAEERVQIVKKSL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                +S   V +ISF  L V+L K I A +I RGLR +TDF+YE ++  +N  L  +I 
Sbjct: 60  ----GNSFKNVKIISFNTLTVSLCKKIKASLIFRGLRVVTDFEYEFQLAGMNNRLNKKIQ 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           TI L A+  ++ ++S +++ +  +  D+  F P P  V+L
Sbjct: 116 TIFLMAEIENQLISSNMVKEIAELGGDVRKFAPKPAIVYL 155


>gi|238754766|ref|ZP_04616118.1| Phosphopantetheine adenylyltransferase [Yersinia ruckeri ATCC
           29473]
 gi|238707074|gb|EEP99439.1| Phosphopantetheine adenylyltransferase [Yersinia ruckeri ATCC
           29473]
          Length = 158

 Score =  114 bits (284), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 53/157 (33%), Positives = 92/157 (58%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           MM KA+Y G+FDP+TNGH+D++ +A +    +++AI  +S   K   ++ ER  L  +  
Sbjct: 1   MMTKAIYPGTFDPMTNGHLDLVTRASAMFGHVILAI-ADSAHKKPMFTLDERVTLASEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V VI F  L  + A+   A ++VRGLR ++DF+YE ++ ++NR L P + 
Sbjct: 60  AHL-----DNVEVIGFSELMASFAQQHQANILVRGLRSVSDFEYEWQLANMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E   +++S+L++ +     DIT F+P P+ 
Sbjct: 115 SVFLLPSEKWSFISSSLVKEVARHGGDITPFLPAPIT 151


>gi|109896384|ref|YP_659639.1| phosphopantetheine adenylyltransferase [Pseudoalteromonas atlantica
           T6c]
 gi|123171926|sp|Q15ZV3|COAD_PSEA6 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|109698665|gb|ABG38585.1| pantetheine-phosphate adenylyltransferase [Pseudoalteromonas
           atlantica T6c]
          Length = 160

 Score =  114 bits (284), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 94/161 (58%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KAVY G+FDPITNGH D+I +A +    +++ I  N  K K   S+QER +LIK+  
Sbjct: 1   MHTKAVYPGTFDPITNGHADLIERAANMFAHVIVGIAANPSK-KPLFSLQERVDLIKEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V VI FEGL  + A    A V++RGLR ++DF+YE ++ ++NR L P + 
Sbjct: 60  EH-LPN----VEVIGFEGLLADFADSQGATVLIRGLRAVSDFEYEFQLANMNRRLNPNLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +I L   E + +++STL++ +      +  F    V   LK
Sbjct: 115 SIFLTPAEENSFISSTLVKEVALHRGKVDQFCHPAVQAALK 155


>gi|332159690|ref|YP_004296267.1| phosphopantetheine adenylyltransferase [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|318603789|emb|CBY25287.1| phosphopantetheine adenylyltransferase [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|325663920|gb|ADZ40564.1| phosphopantetheine adenylyltransferase [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330859993|emb|CBX70321.1| phosphopantetheine adenylyltransferase [Yersinia enterocolitica
           W22703]
          Length = 159

 Score =  114 bits (284), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 92/157 (58%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ KA+Y G+FDPITNGH+D++ +A      +++AI  +S K K   ++ ER  L KQ  
Sbjct: 1   MITKAIYPGTFDPITNGHLDLVTRASEMFSHVILAIADSSSK-KPMFTLAERVVLAKQ-- 57

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +      V V+ F  L    AK   A ++VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 58  ---VTAQLKNVEVLGFSELMAEFAKKHDANILVRGLRSVSDFEYEWQLANMNRHLMPKLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E   +++S+L++ +     DIT F+P PV 
Sbjct: 115 SVFLMPSEKWSFISSSLVKEVARHGGDITPFLPAPVT 151


>gi|237712688|ref|ZP_04543169.1| phosphopantetheine adenylyltransferase [Bacteroides sp. D1]
 gi|237721892|ref|ZP_04552373.1| phosphopantetheine adenylyltransferase [Bacteroides sp. 2_2_4]
 gi|262405893|ref|ZP_06082443.1| pantetheine-phosphate adenylyltransferase [Bacteroides sp. 2_1_22]
 gi|293372367|ref|ZP_06618751.1| pantetheine-phosphate adenylyltransferase [Bacteroides ovatus SD
           CMC 3f]
 gi|294647851|ref|ZP_06725403.1| pantetheine-phosphate adenylyltransferase [Bacteroides ovatus SD CC
           2a]
 gi|294806248|ref|ZP_06765095.1| pantetheine-phosphate adenylyltransferase [Bacteroides
           xylanisolvens SD CC 1b]
 gi|298479893|ref|ZP_06998092.1| pantetheine-phosphate adenylyltransferase [Bacteroides sp. D22]
 gi|229447266|gb|EEO53057.1| phosphopantetheine adenylyltransferase [Bacteroides sp. D1]
 gi|229448761|gb|EEO54552.1| phosphopantetheine adenylyltransferase [Bacteroides sp. 2_2_4]
 gi|262356768|gb|EEZ05858.1| pantetheine-phosphate adenylyltransferase [Bacteroides sp. 2_1_22]
 gi|292632550|gb|EFF51144.1| pantetheine-phosphate adenylyltransferase [Bacteroides ovatus SD
           CMC 3f]
 gi|292636759|gb|EFF55225.1| pantetheine-phosphate adenylyltransferase [Bacteroides ovatus SD CC
           2a]
 gi|294446504|gb|EFG15124.1| pantetheine-phosphate adenylyltransferase [Bacteroides
           xylanisolvens SD CC 1b]
 gi|295085681|emb|CBK67204.1| Phosphopantetheine adenylyltransferase [Bacteroides xylanisolvens
           XB1A]
 gi|298273702|gb|EFI15264.1| pantetheine-phosphate adenylyltransferase [Bacteroides sp. D22]
          Length = 151

 Score =  114 bits (284), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 98/152 (64%), Gaps = 7/152 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKA++ G+FDP T GH  ++ +AL+F++++VI IG N  K   +  I++R E+I++   
Sbjct: 1   MRKAIFPGTFDPFTIGHYSVVERALTFMDEIVIGIGINENKNT-YFPIEKREEMIRE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +     R+ V+S++ L ++ A+++ A+ IVRG+R + DF+YE  +  +NR L   I T
Sbjct: 57  --LYKDEPRIKVMSYDCLTIDFAQEVGARFIVRGIRTVKDFEYEETIADINRKLAG-IET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           I LF +     V+ST++R L++ + DI+ F+P
Sbjct: 114 ILLFTEPELTCVSSTIVRELLTYNKDISQFIP 145


>gi|83595879|gb|ABC25241.1| pantetheine-phosphate adenylyltransferase [uncultured marine
           bacterium Ant4D3]
          Length = 162

 Score =  114 bits (284), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 93/151 (61%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA+Y G+FDP+T+GH+D+I +A    E++V+A+  +  K +  L +++R EL +    
Sbjct: 1   MNKAIYPGTFDPVTHGHVDLIQRASKLFEEVVVAVAESPTK-RPMLDLKKRVELTR---- 55

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             I +    V+VI F GL   L     A +I+RGLR ++DF+YE ++  +NR L P++ +
Sbjct: 56  -IITEPLGNVTVIGFSGLLTELLTQQGANIILRGLRAVSDFEYEFQLAKMNRVLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + S+  D++ FV
Sbjct: 115 MFLTPAEKHSFISSTLVREIASLGGDVSQFV 145


>gi|312797359|ref|YP_004030281.1| phosphopantetheine adenylyltransferase [Burkholderia rhizoxinica
           HKI 454]
 gi|312169134|emb|CBW76137.1| Phosphopantetheine adenylyltransferase (EC 2.7.7.3) [Burkholderia
           rhizoxinica HKI 454]
          Length = 189

 Score =  114 bits (284), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 103/164 (62%), Gaps = 6/164 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           +M  AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F S+QER ++ ++ +
Sbjct: 22  LMVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRNKKPFFSLQERLDIAQEVL 80

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H+ P+    V V+SF GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ 
Sbjct: 81  GHY-PN----VKVMSFAGLLKDFVRANNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVE 135

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ +   +  ++++ T++R +  +  D++ FV   V  +LK+ V
Sbjct: 136 TMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLKDKV 179


>gi|261824810|pdb|3F3M|A Chain A, Six Crystal Structures Of Two Phosphopantetheine
           Adenylyltransferases Reveal An Alternative Ligand
           Binding Mode And An Associated Structural Change
          Length = 168

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 103/158 (65%), Gaps = 6/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AV  GSFDPIT GH+DII ++    +++ + +  NS K +G  S++ER +LI+QS+ H +
Sbjct: 6   AVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNS-KKEGTFSLEERMDLIEQSVKH-L 63

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V  F GL V+  + + A+ I+RGLR ++DF+YE+R+TS+N+ L  EI T+ +
Sbjct: 64  PN----VKVHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYM 119

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            +  +  +++S++++ + +  ADI+ FVP  V   LK 
Sbjct: 120 MSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKK 157


>gi|15924115|ref|NP_371649.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus Mu50]
 gi|15926709|ref|NP_374242.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus N315]
 gi|21282736|ref|NP_645824.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus MW2]
 gi|49483287|ref|YP_040511.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus MRSA252]
 gi|49485962|ref|YP_043183.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus MSSA476]
 gi|57651734|ref|YP_185998.1| lipopolysaccharide core biosynthesis protein KdtB [Staphylococcus
           aureus subsp. aureus COL]
 gi|82750732|ref|YP_416473.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           RF122]
 gi|87162391|ref|YP_493722.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus USA300_FPR3757]
 gi|88194824|ref|YP_499621.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus NCTC 8325]
 gi|148267617|ref|YP_001246560.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus JH9]
 gi|150393672|ref|YP_001316347.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus JH1]
 gi|151221200|ref|YP_001332022.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus str. Newman]
 gi|156979447|ref|YP_001441706.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus Mu3]
 gi|161509301|ref|YP_001574960.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus USA300_TCH1516]
 gi|221140476|ref|ZP_03564969.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus str. JKD6009]
 gi|253316755|ref|ZP_04839968.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus str. CF-Marseille]
 gi|253731735|ref|ZP_04865900.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus USA300_TCH959]
 gi|253733641|ref|ZP_04867806.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus TCH130]
 gi|255005911|ref|ZP_05144512.2| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus Mu50-omega]
 gi|257425176|ref|ZP_05601602.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus 55/2053]
 gi|257427839|ref|ZP_05604237.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus 65-1322]
 gi|257430474|ref|ZP_05606856.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus 68-397]
 gi|257433176|ref|ZP_05609534.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus E1410]
 gi|257436075|ref|ZP_05612122.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus M876]
 gi|257795145|ref|ZP_05644124.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A9781]
 gi|258407147|ref|ZP_05680296.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           A9763]
 gi|258421762|ref|ZP_05684683.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A9719]
 gi|258423832|ref|ZP_05686718.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A9635]
 gi|258436127|ref|ZP_05689110.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           A9299]
 gi|258443384|ref|ZP_05691727.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           A8115]
 gi|258444995|ref|ZP_05693312.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           A6300]
 gi|258449830|ref|ZP_05697928.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           A6224]
 gi|258451929|ref|ZP_05699945.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           A5948]
 gi|258454929|ref|ZP_05702892.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           A5937]
 gi|262048709|ref|ZP_06021591.1| hypothetical protein SAD30_1539 [Staphylococcus aureus D30]
 gi|262052220|ref|ZP_06024426.1| hypothetical protein SA930_0911 [Staphylococcus aureus 930918-3]
 gi|269202737|ref|YP_003282006.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus ED98]
 gi|282894152|ref|ZP_06302383.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A8117]
 gi|282903673|ref|ZP_06311561.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus C160]
 gi|282905442|ref|ZP_06313297.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282908414|ref|ZP_06316245.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282910700|ref|ZP_06318503.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282913900|ref|ZP_06321687.1| lipopolysaccharide core biosynthesis protein KdtB [Staphylococcus
           aureus subsp. aureus M899]
 gi|282916374|ref|ZP_06324136.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus D139]
 gi|282918823|ref|ZP_06326558.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus C427]
 gi|282923945|ref|ZP_06331621.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus C101]
 gi|282925309|ref|ZP_06332966.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A9765]
 gi|282928647|ref|ZP_06336244.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A10102]
 gi|283770185|ref|ZP_06343077.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus H19]
 gi|283957868|ref|ZP_06375319.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus A017934/97]
 gi|284024050|ref|ZP_06378448.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus 132]
 gi|293500935|ref|ZP_06666786.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|293509892|ref|ZP_06668601.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus M809]
 gi|293526479|ref|ZP_06671164.1| lipopolysaccharide core biosynthesis protein KdtB [Staphylococcus
           aureus subsp. aureus M1015]
 gi|294848115|ref|ZP_06788862.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A9754]
 gi|295405929|ref|ZP_06815738.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A8819]
 gi|295427612|ref|ZP_06820244.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus EMRSA16]
 gi|296276075|ref|ZP_06858582.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus MR1]
 gi|297208238|ref|ZP_06924668.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|297246399|ref|ZP_06930243.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A8796]
 gi|297591434|ref|ZP_06950072.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus MN8]
 gi|300912315|ref|ZP_07129758.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|304381318|ref|ZP_07363971.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus ATCC BAA-39]
 gi|54036869|sp|P63819|COAD_STAAN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|54036870|sp|P63820|COAD_STAAW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|54040902|sp|P63818|COAD_STAAM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|56748670|sp|Q6GA90|COAD_STAAS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|56748684|sp|Q6GHW1|COAD_STAAR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|71153204|sp|Q5HGV9|COAD_STAAC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|122539795|sp|Q2FZF5|COAD_STAA8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123486371|sp|Q2FHV6|COAD_STAA3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123548983|sp|Q2YXA0|COAD_STAAB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216604|sp|A7X140|COAD_STAA1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|172048823|sp|A6QFX8|COAD_STAAE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189082593|sp|A6U0U2|COAD_STAA2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189082594|sp|A5IS11|COAD_STAA9 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189082595|sp|A8Z1Q8|COAD_STAAT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|13700925|dbj|BAB42221.1| SA0973 [Staphylococcus aureus subsp. aureus N315]
 gi|14246895|dbj|BAB57287.1| phosphopantetheine adenyltransferase homologue [Staphylococcus
           aureus subsp. aureus Mu50]
 gi|21204174|dbj|BAB94872.1| MW1007 [Staphylococcus aureus subsp. aureus MW2]
 gi|49241416|emb|CAG40100.1| putative phosphopantetheine adenylyltransferase [Staphylococcus
           aureus subsp. aureus MRSA252]
 gi|49244405|emb|CAG42833.1| putative phosphopantetheine adenylyltransferase [Staphylococcus
           aureus subsp. aureus MSSA476]
 gi|57285920|gb|AAW38014.1| lipopolysaccharide core biosynthesis protein KdtB [Staphylococcus
           aureus subsp. aureus COL]
 gi|82656263|emb|CAI80677.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           RF122]
 gi|87128365|gb|ABD22879.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus USA300_FPR3757]
 gi|87202382|gb|ABD30192.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus NCTC 8325]
 gi|147740686|gb|ABQ48984.1| Phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus JH9]
 gi|149946124|gb|ABR52060.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus JH1]
 gi|150374000|dbj|BAF67260.1| phosphopantetheine adenyltransferase homolog [Staphylococcus aureus
           subsp. aureus str. Newman]
 gi|156721582|dbj|BAF77999.1| phosphopantetheine adenyltransferase homologue [Staphylococcus
           aureus subsp. aureus Mu3]
 gi|160368110|gb|ABX29081.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus USA300_TCH1516]
 gi|253724549|gb|EES93278.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus USA300_TCH959]
 gi|253728341|gb|EES97070.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus TCH130]
 gi|257272152|gb|EEV04284.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus 55/2053]
 gi|257274680|gb|EEV06167.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus 65-1322]
 gi|257278602|gb|EEV09221.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus 68-397]
 gi|257281269|gb|EEV11406.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus E1410]
 gi|257284357|gb|EEV14477.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus M876]
 gi|257789117|gb|EEV27457.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A9781]
 gi|257841302|gb|EEV65747.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           A9763]
 gi|257842095|gb|EEV66523.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A9719]
 gi|257846064|gb|EEV70092.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A9635]
 gi|257848816|gb|EEV72801.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           A9299]
 gi|257851474|gb|EEV75413.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           A8115]
 gi|257856117|gb|EEV79035.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           A6300]
 gi|257856750|gb|EEV79653.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           A6224]
 gi|257860144|gb|EEV82976.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           A5948]
 gi|257862809|gb|EEV85574.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           A5937]
 gi|259159891|gb|EEW44929.1| hypothetical protein SA930_0911 [Staphylococcus aureus 930918-3]
 gi|259163165|gb|EEW47725.1| hypothetical protein SAD30_1539 [Staphylococcus aureus D30]
 gi|262075027|gb|ACY11000.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus ED98]
 gi|269940619|emb|CBI48998.1| putative phosphopantetheine adenylyltransferase [Staphylococcus
           aureus subsp. aureus TW20]
 gi|282313917|gb|EFB44309.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus C101]
 gi|282316633|gb|EFB47007.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus C427]
 gi|282319814|gb|EFB50162.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus D139]
 gi|282321968|gb|EFB52292.1| lipopolysaccharide core biosynthesis protein KdtB [Staphylococcus
           aureus subsp. aureus M899]
 gi|282325305|gb|EFB55614.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282328079|gb|EFB58361.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282330734|gb|EFB60248.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282589686|gb|EFB94772.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A10102]
 gi|282592585|gb|EFB97595.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A9765]
 gi|282595291|gb|EFC00255.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus C160]
 gi|282763638|gb|EFC03767.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A8117]
 gi|283460332|gb|EFC07422.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus H19]
 gi|283470335|emb|CAQ49546.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus ST398]
 gi|283790017|gb|EFC28834.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus A017934/97]
 gi|285816805|gb|ADC37292.1| Phosphopantetheine adenylyltransferase [Staphylococcus aureus
           04-02981]
 gi|290920551|gb|EFD97614.1| lipopolysaccharide core biosynthesis protein KdtB [Staphylococcus
           aureus subsp. aureus M1015]
 gi|291095940|gb|EFE26201.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|291467342|gb|EFF09859.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus M809]
 gi|294824915|gb|EFG41337.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A9754]
 gi|294969364|gb|EFG45384.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A8819]
 gi|295127970|gb|EFG57604.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus EMRSA16]
 gi|296886977|gb|EFH25880.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|297176765|gb|EFH36025.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           A8796]
 gi|297576320|gb|EFH95036.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus MN8]
 gi|298694357|gb|ADI97579.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus ED133]
 gi|300886561|gb|EFK81763.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|302332733|gb|ADL22926.1| lipopolysaccharide core biosynthesis protein KdtB [Staphylococcus
           aureus subsp. aureus JKD6159]
 gi|302750948|gb|ADL65125.1| lipopolysaccharide core biosynthesis protein KdtB [Staphylococcus
           aureus subsp. aureus str. JKD6008]
 gi|304340301|gb|EFM06242.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus ATCC BAA-39]
 gi|312438499|gb|ADQ77570.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus TCH60]
 gi|312829518|emb|CBX34360.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus ECT-R 2]
 gi|315130289|gb|EFT86276.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus CGS03]
 gi|315193793|gb|EFU24188.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus CGS00]
 gi|315196154|gb|EFU26511.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus CGS01]
 gi|320141060|gb|EFW32907.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus MRSA131]
 gi|320143117|gb|EFW34907.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus MRSA177]
 gi|323440673|gb|EGA98383.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus O11]
 gi|323442384|gb|EGB00014.1| phosphopantetheine adenylyltransferase [Staphylococcus aureus O46]
 gi|329313792|gb|AEB88205.1| Phosphopantetheine adenylyltransferase [Staphylococcus aureus
           subsp. aureus T0131]
 gi|329725202|gb|EGG61691.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus 21172]
 gi|329728873|gb|EGG65294.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus 21193]
 gi|329730748|gb|EGG67127.1| pantetheine-phosphate adenylyltransferase [Staphylococcus aureus
           subsp. aureus 21189]
          Length = 160

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 103/158 (65%), Gaps = 6/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AV  GSFDPIT GH+DII ++    +++ + +  NS K +G  S++ER +LI+QS+ H +
Sbjct: 6   AVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNS-KKEGTFSLEERMDLIEQSVKH-L 63

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V  F GL V+  + + A+ I+RGLR ++DF+YE+R+TS+N+ L  EI T+ +
Sbjct: 64  PN----VKVHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYM 119

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            +  +  +++S++++ + +  ADI+ FVP  V   LK 
Sbjct: 120 MSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKK 157


>gi|314936687|ref|ZP_07844034.1| pantetheine-phosphate adenylyltransferase [Staphylococcus hominis
           subsp. hominis C80]
 gi|313655306|gb|EFS19051.1| pantetheine-phosphate adenylyltransferase [Staphylococcus hominis
           subsp. hominis C80]
          Length = 161

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 63/158 (39%), Positives = 100/158 (63%), Gaps = 6/158 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KAV  GSFDPIT GH+DII ++    ++L + I  NS K  G  SI+ER ELI++S+ H 
Sbjct: 5   KAVIPGSFDPITYGHLDIIERSSDRFDELHVCILKNSSKA-GTFSIEERMELIRESVKH- 62

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           +P+    V V +F GL V+    I ++ I+RGLR ++DF+YE+R+TS+N+ L   + T+ 
Sbjct: 63  LPN----VKVHNFNGLLVDFCDKIGSKTIIRGLRAVSDFEYELRLTSMNKKLNSNVETMY 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +    +  +++S++++ +    ADI+ FVP  V   LK
Sbjct: 119 MMTSTNYSFISSSVVKEVAQYKADISDFVPSHVERALK 156


>gi|262392588|ref|YP_003284442.1| phosphopantetheine adenylyltransferase [Vibrio sp. Ex25]
 gi|262336182|gb|ACY49977.1| phosphopantetheine adenylyltransferase [Vibrio sp. Ex25]
          Length = 161

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 90/156 (57%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +K +Y G+FDPITNGH+D+I +     + + I +  +  K   F S+ ER EL+ Q  
Sbjct: 1   MNKKVIYPGTFDPITNGHLDLIERTAKMFDSVTIGVAASPSKNTMF-SLDERVELVHQCC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + VSV+ F GL V+ AK+  A +++RGLR   DF+YE  +TS+ R L P + 
Sbjct: 60  QHL-----SNVSVVGFSGLLVDFAKEQQASILIRGLRTTMDFEYEFGLTSMYRKLLPGLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           +I L   E   +++ST++R +     ++  FVP PV
Sbjct: 115 SIFLTPSEEFAFLSSTIVREVAIHGGNVAQFVPSPV 150


>gi|313682361|ref|YP_004060099.1| phosphopantetheine adenylyltransferase [Sulfuricurvum kujiense DSM
           16994]
 gi|313155221|gb|ADR33899.1| Phosphopantetheine adenylyltransferase [Sulfuricurvum kujiense DSM
           16994]
          Length = 163

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 97/156 (62%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y G+FDPITNGH DII + +   ++++IA+  +S + K   ++QER +++K ++
Sbjct: 1   MHKIALYPGTFDPITNGHFDIIERGIRLFDEVIIAV-ADSQEKKPMFTLQERVDMVKLAV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                    RV+V+ F+ L V LA  + A V++RGLR ++DF++E+++  +N  L P I 
Sbjct: 60  RDL-----ERVTVVGFDNLTVELANTLGATVLIRGLRAVSDFEFELQLGYLNNSLDPNIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           T+ L  K    +++S+++R+L+  +      +P PV
Sbjct: 115 TVYLMPKLKHAFISSSIVRNLLKFNGKTEHLLPSPV 150


>gi|226326880|ref|ZP_03802398.1| hypothetical protein PROPEN_00740 [Proteus penneri ATCC 35198]
 gi|225204717|gb|EEG87071.1| hypothetical protein PROPEN_00740 [Proteus penneri ATCC 35198]
          Length = 161

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 53/157 (33%), Positives = 96/157 (61%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPIT GH+DI+ +A    + +++AI  +S +     +++ER +L KQ  
Sbjct: 1   MKNKAIYPGTFDPITYGHIDILTRAAGMFDTVLLAI-ADSARKNPMFTLEERVDLAKQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F  L  N AK   A +++RG+R ++DF+YE ++ ++NR   P++ 
Sbjct: 60  SHL-----SNVEVVGFSELMANFAKQQQATILIRGVRSVSDFEYEWQLANMNRHFAPDLD 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   ++  +V+S+LI+ +   D D+++F+PD V 
Sbjct: 115 SVFLLPSQNLSFVSSSLIKDVARHDGDVSTFLPDVVT 151


>gi|146340926|ref|YP_001205974.1| phosphopantetheine adenylyltransferase [Bradyrhizobium sp. ORS278]
 gi|166216061|sp|A4YV23|COAD_BRASO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|146193732|emb|CAL77749.1| phosphopantetheine adenylyltransferase [Bradyrhizobium sp. ORS278]
          Length = 164

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 93/161 (57%), Gaps = 1/161 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+D++ QA+   + L++A+G +  K K   S +ER  +  +  
Sbjct: 1   MQRIALYPGSFDPVTNGHLDVVRQAVHLCDKLIVAVGVHHGK-KPLFSTEERLAMAHEVF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +       +++ L V  A+   A +++RGLRD TD DYEM++  +N+ + P I 
Sbjct: 60  GPVASAAGCAFDASTYDNLTVTAAQQAGAILMIRGLRDGTDLDYEMQLAGMNQTMAPSIQ 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ + A    R +T++L+R + ++  +I+ FVP  V   LK
Sbjct: 120 TVFVPASVPVRPITASLVRQIAAMGGEISHFVPPSVVAPLK 160


>gi|78044695|ref|YP_360291.1| phosphopantetheine adenylyltransferase [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|123576151|sp|Q3AC43|COAD_CARHZ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|77996810|gb|ABB15709.1| pantetheine-phosphate adenylyltransferase [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 162

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 99/161 (61%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR AVY GSFDPITNGH+DII +A    + L++AI  N +K K   +++ER +++++++ 
Sbjct: 1   MRIAVYPGSFDPITNGHLDIIERAAELFDRLIVAIAKNPMK-KPLFTLEERLDMLRETLK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           ++ P+    + + SFEGL VN  K  +AQVI+RGLR ++DF+ E  M   N+ L P + T
Sbjct: 60  YY-PN----IEIDSFEGLTVNYLKAKNAQVIIRGLRAISDFENEFMMALTNKKLVPWVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           I L  K    +++S+ ++ +      +   VP+ V + L+ 
Sbjct: 115 IFLMTKAEYSFISSSAVKEVAMYGGCLKGLVPEYVELKLRE 155


>gi|78486269|ref|YP_392194.1| coenzyme A biosynthesis protein [Thiomicrospira crunogena XCL-2]
 gi|123555013|sp|Q31EA3|COAD_THICR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|78364555|gb|ABB42520.1| Phosphopantetheine adenylyltransferase [Thiomicrospira crunogena
           XCL-2]
          Length = 159

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/148 (40%), Positives = 93/148 (62%), Gaps = 6/148 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDPIT GH D+I +A  F + LVIA+  N  KT  F S+++R  L K+      
Sbjct: 5   AVYPGTFDPITCGHFDLIERAARFYDRLVIAVADNRNKTALF-SLEKRVALAKE----VT 59

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
            D  N V VI F GL V+  ++I   V++RGLR ++DF+YE ++ S+NR L PE+ T+ +
Sbjct: 60  ADMPN-VEVIGFSGLLVDFVREIDGNVLLRGLRAVSDFEYEFQLASMNRKLAPEVETMFM 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFV 152
              E   +++S+L+R + ++  D++ FV
Sbjct: 119 TPAEQYAFISSSLVREISALGGDVSEFV 146


>gi|291619453|ref|YP_003522195.1| CoaD [Pantoea ananatis LMG 20103]
 gi|291154483|gb|ADD79067.1| CoaD [Pantoea ananatis LMG 20103]
 gi|327395776|dbj|BAK13198.1| phosphopantetheine adenylyltransferase CoaD [Pantoea ananatis
           AJ13355]
          Length = 171

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 91/156 (58%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPIT GH+DI+ +A    + LV+AI  +  K K   ++ ER  L +Q+ 
Sbjct: 13  MTTKAIYPGTFDPITLGHIDIVTRAAQMFDRLVVAIAASPSK-KPLFTLDERVALARQAT 71

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V  F  L  N A+   A ++VRGLR ++DF+YE ++  +NR L P + 
Sbjct: 72  AHLA-----NVEVTGFSDLMANFARTQQANILVRGLRAVSDFEYETQLARMNRHLLPTLE 126

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   E+  +++STL++ +     D+++F+P PV
Sbjct: 127 SVFLMPSENFSFISSTLVKEVARHGGDVSAFLPAPV 162


>gi|51594408|ref|YP_068599.1| phosphopantetheine adenylyltransferase [Yersinia pseudotuberculosis
           IP 32953]
 gi|61212549|sp|Q66GD2|COAD_YERPS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|51587690|emb|CAH19290.1| phosphopantetheine adenylyltransferase [Yersinia pseudotuberculosis
           IP 32953]
          Length = 159

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 94/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ KA+Y G+FDPITNGH+D++ +A +    +++AI  +S K K   ++ ER  L K+  
Sbjct: 1   MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSK-KPMFTLDERVALAKK-- 57

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +      V V+ F  L    AK  +A ++VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 58  ---VTALLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E   +++S+L++ +     DIT F+P PV 
Sbjct: 115 SVFLMPSEKWSFISSSLVKEVARHGGDITPFLPKPVT 151


>gi|329767313|ref|ZP_08258838.1| pantetheine-phosphate adenylyltransferase [Gemella haemolysans
           M341]
 gi|328836002|gb|EGF85693.1| pantetheine-phosphate adenylyltransferase [Gemella haemolysans
           M341]
          Length = 163

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/157 (40%), Positives = 99/157 (63%), Gaps = 7/157 (4%)

Query: 1   MMRK-AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           M RK A+  GSFDPIT GH+DII ++    +++++AI  N  K K   S+ ER E+I ++
Sbjct: 1   MKRKIAIVPGSFDPITYGHIDIINRSAELFDEVIVAILVNPDK-KYLFSLDERVEMINET 59

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           I   IP+    V V SF GL VN AK + + VIVRGLR ++DF+YEM++T +N+ L   I
Sbjct: 60  IKE-IPN----VKVDSFSGLLVNYAKQVGSNVIVRGLRAVSDFEYEMQLTFMNKALDENI 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
            T  + A +   +++S++++ +    AD++ FVP  V
Sbjct: 115 ETFYMMANKQYSFISSSIVKGVSGFGADLSKFVPKHV 151


>gi|254293785|ref|YP_003059808.1| pantetheine-phosphate adenylyltransferase [Hirschia baltica ATCC
           49814]
 gi|254042316|gb|ACT59111.1| pantetheine-phosphate adenylyltransferase [Hirschia baltica ATCC
           49814]
          Length = 164

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 91/156 (58%), Gaps = 3/156 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y G+FDPIT GHMDII +A+  V+ LVI +  N  K   F S++ER E++ Q   
Sbjct: 1   MKIGLYPGTFDPITYGHMDIISRAVKLVDKLVIGVAVNESKGPLF-SVEERVEMVLQETA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F  D+   +    F  L ++ A   +A  IVRGLR ++DF+YE +M ++N+ +   I T
Sbjct: 60  EFAKDAV--IEAKPFNNLLIHFADQCNAHAIVRGLRAVSDFEYEFQMVAMNQKMDSSIET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + L A    + V+S L++ +  +D DI  FVPD V 
Sbjct: 118 VFLMADPEHQAVSSRLVKEIARLDGDIDLFVPDGVS 153


>gi|330831599|ref|YP_004394551.1| phosphopantetheine adenylyltransferase [Aeromonas veronii B565]
 gi|328806735|gb|AEB51934.1| Phosphopantetheine adenylyltransferase [Aeromonas veronii B565]
          Length = 160

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 97/157 (61%), Gaps = 7/157 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDP+TNGH D+I +A    +++V+ +  NS   +    + ER +L++Q +
Sbjct: 1   MTTRVIYPGTFDPVTNGHADLIGRAAKLFDEVVVGV-ANSPSKRPLFDLAERVQLVQQ-V 58

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +P+    V V+ F GL V+ AK+  A V++RGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 59  TSQLPN----VKVVGFSGLLVDFAKEHQANVLIRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E + +++STL++ +     DI  FV DPV 
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHGGDIRQFV-DPVV 150


>gi|126737917|ref|ZP_01753647.1| pantetheine-phosphate adenylyltransferase [Roseobacter sp.
           SK209-2-6]
 gi|126721310|gb|EBA18014.1| pantetheine-phosphate adenylyltransferase [Roseobacter sp.
           SK209-2-6]
          Length = 166

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 90/151 (59%), Gaps = 1/151 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F S++ER  +I+    
Sbjct: 1   MRVGLYPGTFDPITLGHIDIIRRASALVDKLVIGVAINRDKGPMF-SLEERVVMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ A+D+ AQ+IVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  KLSEQTGTEIVAHPFENLLIDCARDVGAQIIVRGLRAVADFEYEYQMVGMNRVLDSSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L A+   + + S L++ +  +D D++SFV
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLDGDVSSFV 150


>gi|325688192|gb|EGD30211.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           SK72]
          Length = 164

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 94/159 (59%), Gaps = 5/159 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+T GH+D+I +A    + L + I  N  K+ GF +I+ R  ++K+++ H  
Sbjct: 6   GLFTGSFDPMTKGHVDLIERASRLFDKLYVGIFYNREKS-GFFTIEARERMVKEALEHL- 63

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
               N   +IS   LAV +A+ + AQ  VRGLR+  D DYE  M   N+ L  E+ TI L
Sbjct: 64  ---DNVEVIISQNELAVTVARRLGAQAFVRGLRNSQDLDYEANMNFFNQELAGELETIFL 120

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            +K + ++++S+ IR LI+   DI ++VP  V   L+ I
Sbjct: 121 LSKPAYQHISSSRIRELIAFQQDIAAYVPQSVIKELERI 159


>gi|188532231|ref|YP_001906028.1| Phosphopantetheine adenylyltransferase [Erwinia tasmaniensis
           Et1/99]
 gi|229500789|sp|B2VF71|COAD_ERWT9 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|188027273|emb|CAO95116.1| Phosphopantetheine adenylyltransferase [Erwinia tasmaniensis
           Et1/99]
          Length = 158

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 97/161 (60%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+DI+ +A    + +V+A+  +  K K   S++ER  L K+ +
Sbjct: 1   MSTKAIYPGTFDPMTNGHLDIVTRAALMFDRIVLAVAASPSK-KPMFSLEERVALAKEVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V+ F  L  N AK   A V+VRGLR ++DF++EM++  +NR L   + 
Sbjct: 60  AH-LPN----VDVVGFSDLLANFAKAQQANVLVRGLRAVSDFEFEMQLAQMNRHLMDTLD 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           ++ L   E   +++S+L++ +     D+ +F+P PV   LK
Sbjct: 115 SVFLMPSEQYSFISSSLMKEVARHGGDVETFLPAPVYKALK 155


>gi|170286926|dbj|BAG13455.1| pantetheine-phosphate adenylyltransferase [uncultured Termite group
           1 bacterium]
          Length = 170

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/165 (38%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY GSFDP TNGH+DIII+A      + IA+   S+  K   S+QER  L+++ I +  
Sbjct: 7   AVYPGSFDPPTNGHLDIIIRASHLFPKITIAV-TKSINKKHIFSLQERINLLQKIIKNL- 64

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                 V V SF GL  N    I++ V++RGLR ++DF+YE +M  +NR L  +I TI L
Sbjct: 65  ----KNVKVASFSGLLANYLAKINSFVLIRGLRALSDFEYEFQMALMNRNLNKKIETIFL 120

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
              +S  +++S ++R +  +  D   FVP+ V + LK   + L+K
Sbjct: 121 MPDQSYTFLSSGMVREIAMLGGDTKDFVPECVKIELKKRSLDLLK 165


>gi|330447133|ref|ZP_08310783.1| pantetheine-phosphate adenylyltransferase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491324|dbj|GAA05280.1| pantetheine-phosphate adenylyltransferase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 160

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 96/156 (61%), Gaps = 7/156 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D+I +A +  + +++ +  N  K K    + ER EL  +  
Sbjct: 1   MTTRVIYPGTFDPITNGHLDLIERAAAMFDHVIVGVAFNPSK-KPLFDLNERVELAGKIT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V ++ F GL V+ AK+ +A ++VRGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 60  QHL-----DNVEIVGFSGLLVDFAKEHNANILVRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           T+ L   E + +++ST+++ +     D++ FV DP+
Sbjct: 115 TVFLTPAEENSFISSTIVKEVALHKGDVSQFV-DPL 149


>gi|67906519|gb|AAY82626.1| hypothetical protein [uncultured bacterium MedeBAC35C06]
          Length = 161

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 98/152 (64%), Gaps = 7/152 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDPIT GHMDII +A    + +++AI  +  K   F S++ER +L  ++I+
Sbjct: 1   MKVAIYPGSFDPITLGHMDIIDRACYLFDKVIVAIAKSESKNPLF-SLEERIKLT-ETIY 58

Query: 62  HFIPDSSNRVSVISF-EGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              P    +V V+ F   L V+LA+D  A  IVRGLR + DF+YE ++ ++NR L P+I 
Sbjct: 59  KDHP----KVEVVGFPRKLTVDLARDYGASAIVRGLRAVADFEYEFQLATMNRALAPDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           +I L  KES  YV+S+LI+ +  +  +I++FV
Sbjct: 115 SIFLTPKESLIYVSSSLIKEIADLKGNISNFV 146


>gi|328945607|gb|EGG39758.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           SK1087]
          Length = 164

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 96/160 (60%), Gaps = 7/160 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+T GH+D+I +A    + L + I  N  K+ GF +I+ R  ++K+++ H  
Sbjct: 6   GLFTGSFDPMTKGHVDLIERASRLFDKLYVGIFYNREKS-GFFTIEAREHMVKEALEHL- 63

Query: 65  PDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V VI+ +  LAV +A+ + AQ  VRGLR+  D DYE  M   N+ L  EI TI 
Sbjct: 64  ----DNVEVITSQNELAVTVARRLGAQAFVRGLRNSQDLDYEANMNFFNQELAGEIETIF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L +K + ++++S+ IR LI+   DI ++VP  V   L+ I
Sbjct: 120 LLSKPAYQHISSSRIRELIAFQQDIAAYVPQSVIKELERI 159


>gi|254457862|ref|ZP_05071289.1| pantetheine-phosphate adenylyltransferase [Campylobacterales
           bacterium GD 1]
 gi|207085255|gb|EDZ62540.1| pantetheine-phosphate adenylyltransferase [Campylobacterales
           bacterium GD 1]
          Length = 163

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 96/156 (61%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y G+FDPITNGH DII +AL   ++++IA+  ++ K K   ++ ER E+ K++I
Sbjct: 1   MKRIALYPGTFDPITNGHYDIIERALGLFDEVIIAVAISADK-KPMFTLNERIEMTKKAI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + VSV+ F+ L V LAK   A +++RGLR ++DF+YE+++  +N  L   I 
Sbjct: 60  GHL-----DNVSVLGFDNLTVELAKTHGATILIRGLRAVSDFEYELQLGYLNNSLDDSIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           T+ L  K    +++S+ +R+L+  +A     +P  V
Sbjct: 115 TVYLMPKLKHAFISSSSVRNLLKFNAKTEHLLPKEV 150


>gi|153810848|ref|ZP_01963516.1| hypothetical protein RUMOBE_01232 [Ruminococcus obeum ATCC 29174]
 gi|149833244|gb|EDM88326.1| hypothetical protein RUMOBE_01232 [Ruminococcus obeum ATCC 29174]
          Length = 169

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 96/152 (63%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP T GH+D+I +A    + +V+ +  NS K+  F S++ER  +++++  
Sbjct: 1   MVTAVYPGSFDPATYGHLDVIRRASVSFDRVVVGVLQNSAKSPLF-SVEERVNILEKATK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V +  F+GL+VN A++  AQVIVRGLR +TDF+YE++M   NR L P++ T
Sbjct: 60  D-IPN----VVIRPFDGLSVNFARENHAQVIVRGLRAVTDFEYELQMAQTNRVLAPDVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + L       YV+ST+++ +     D++SF P
Sbjct: 115 VFLTTTLEYAYVSSTIMKEVARFGGDLSSFAP 146


>gi|119943836|ref|YP_941516.1| pantetheine-phosphate adenylyltransferase [Psychromonas ingrahamii
           37]
 gi|171704611|sp|A1SR02|COAD_PSYIN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|119862440|gb|ABM01917.1| pantetheine-phosphate adenylyltransferase [Psychromonas ingrahamii
           37]
          Length = 161

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 93/152 (61%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  V+ GSFDP+T GH+D+I +A    E +VIA+  N+ K +   ++ ER +L+ ++  
Sbjct: 1   MKTVVFPGSFDPVTLGHIDLITRASKLAERVVIAVAVNTSK-RTLFNLNERCDLLSEATA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + + VI F GL  + AK+ +AQ ++RG+R  TD DYE+++  VN+ L  E+ T
Sbjct: 60  HL-----SGIEVIPFSGLLADFAKEHNAQALIRGIRGTTDADYELQLAQVNKALNSELET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           I L A  ++ +++ST+++ +   + DI  F P
Sbjct: 115 ILLPANAATGFISSTVVKEVFKHNGDIDPFAP 146


>gi|317494723|ref|ZP_07953135.1| pantetheine-phosphate adenylyltransferase [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316917325|gb|EFV38672.1| pantetheine-phosphate adenylyltransferase [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 159

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 97/157 (61%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDP+TNGH+D++ +A S  + +++AI  +  K K   +++ER  L  Q  
Sbjct: 1   MEKRAIYPGTFDPMTNGHLDLVTRAASMFDHVILAIAASPSK-KPMFTLEERVALATQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V+ F  L  + A+  +A ++VRGLR ++DF+YEM++ ++NR L P + 
Sbjct: 60  AH-LPN----VEVLGFSELMAHFAQHQNAHILVRGLRAVSDFEYEMQLANMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   +   +++S+L++ +     DI  FVP+ + 
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHGGDIAPFVPEQIA 151


>gi|89076365|ref|ZP_01162698.1| phosphopantetheine adenylyltransferase [Photobacterium sp. SKA34]
 gi|89047936|gb|EAR53527.1| phosphopantetheine adenylyltransferase [Photobacterium sp. SKA34]
          Length = 160

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 96/156 (61%), Gaps = 7/156 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D+I +A +  + +++ +  N  K K    + ER EL  +  
Sbjct: 1   MTTRVIYPGTFDPITNGHLDLIERAAAMFDHVIVGVAFNPSK-KPLFDLNERVELAGKIT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V ++ F GL V+ AK+ +A ++VRGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 60  KHL-----DNVEIVGFSGLLVDFAKEHNANILVRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           T+ L   E + +++ST+++ +     D++ FV DP+
Sbjct: 115 TVFLTPAEENSFISSTIVKEVALHKGDVSQFV-DPL 149


>gi|323702701|ref|ZP_08114362.1| pantetheine-phosphate adenylyltransferase [Desulfotomaculum
           nigrificans DSM 574]
 gi|323532364|gb|EGB22242.1| pantetheine-phosphate adenylyltransferase [Desulfotomaculum
           nigrificans DSM 574]
          Length = 162

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 95/161 (59%), Gaps = 5/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY GSFDPITNGH+DII +A    + L++A+  N  K     +I+ER +++ ++I 
Sbjct: 1   MRIGVYPGSFDPITNGHLDIIERATVLFDRLIVAVAINPQKKAPLFTIEERMDML-ENIL 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
              P+    V V SF+GL VN A    A VIVRG+R +TDF+ E      N+ L PE+ T
Sbjct: 60  SKYPN----VIVDSFDGLTVNYALKQGACVIVRGIRAITDFEGEFVFALTNKKLAPELET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L  K    +++ST+++ + S +  +++ VPD V   LK 
Sbjct: 116 VYLMTKAEYSFISSTVVKEVASYNGCLSAMVPDLVAQRLKE 156


>gi|312622535|ref|YP_004024148.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312203002|gb|ADQ46329.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 168

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 96/156 (61%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  VY GSFDP+TNGH+DII +A    + L++A+  N  KT  F  I+ER EL+K++  
Sbjct: 1   MKIGVYPGSFDPVTNGHLDIIERASKIFDKLIVAVLVNPNKTPVF-DIEERVELLKETTE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V +F+GL ++  K  +A+VIV+GLR ++DF+YE +M  +N+ L P I T
Sbjct: 60  H-LPN----VEVKAFKGLLIDFMKQENAKVIVKGLRAVSDFEYEFQMALLNKKLEPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I +       Y++S++++ +      I   VP+ + 
Sbjct: 115 IFMMTNSKYSYLSSSMVKEVARFGGCIEDLVPEKIA 150


>gi|315500083|ref|YP_004088886.1| pantetheine-phosphate adenylyltransferase [Asticcacaulis
           excentricus CB 48]
 gi|315418095|gb|ADU14735.1| pantetheine-phosphate adenylyltransferase [Asticcacaulis
           excentricus CB 48]
          Length = 163

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 96/155 (61%), Gaps = 5/155 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  +Y G+FDPITNGH DII +A+  V+ LVI +  N+ K   F ++ ER E++++S   
Sbjct: 4   RIGLYPGTFDPITNGHSDIIGRAVKLVDHLVIGVARNTGKAPVF-TLDERVEMLRESCAP 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
           F    ++RV V+ F+ L ++ A+++ A VI+RGLR + DF+YE +MT++N+ +  EI T+
Sbjct: 63  F----ADRVEVLPFDSLLMHFAEELGASVIIRGLRAVADFEYEFQMTAMNQQMNREIETV 118

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
            L A    + + S L++ +  +  +I  FV   V 
Sbjct: 119 FLMADPRHQAIASRLVKEIAQLGGNIAPFVSKSVA 153


>gi|255318862|ref|ZP_05360088.1| pantetheine-phosphate adenylyltransferase [Acinetobacter
           radioresistens SK82]
 gi|262378880|ref|ZP_06072037.1| pantetheine-phosphate adenylyltransferase [Acinetobacter
           radioresistens SH164]
 gi|255304118|gb|EET83309.1| pantetheine-phosphate adenylyltransferase [Acinetobacter
           radioresistens SK82]
 gi|262300165|gb|EEY88077.1| pantetheine-phosphate adenylyltransferase [Acinetobacter
           radioresistens SH164]
          Length = 163

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 91/158 (57%), Gaps = 6/158 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER  L K S+ H 
Sbjct: 5   RVIYPGTFDPITNGHIDLVTRAAKMFDEVVVAIAIGHHKNPVF-SLEERVALAKASLSHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V  + F+GL VN   +  A  ++RGLR ++DF+YE ++ ++NR L P+   + 
Sbjct: 64  -----SNVEFVGFDGLLVNFFHEQKATAVLRGLRAISDFEYEFQLANMNRQLDPQFEAVF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           L   E   +++STL+R +  +  D+  FVP  V    K
Sbjct: 119 LTPSEQYSFISSTLVREIARLKGDVNKFVPPAVVEAFK 156


>gi|332179469|gb|AEE15158.1| Phosphopantetheine adenylyltransferase [Thermodesulfobium narugense
           DSM 14796]
          Length = 168

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 96/156 (61%), Gaps = 3/156 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+++A+Y GSFDPIT GH+DI  +A    ++++IA+  N  K K   +I+ER  LIK+S+
Sbjct: 1   MIKRALYPGSFDPITLGHLDIARRASHLFDEVIIAVAYNE-KKKALFNIEERVNLIKESL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                +    V V S+  L +  AK ++   I+RGLR ++DF++E +M   NR + P I 
Sbjct: 60  KE--RNMPKNVHVTSYTCLTIEFAKSLNVSSIIRGLRVISDFEFEFQMALTNRRMDPRIE 117

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           T+ L   E   Y++ST+I+ + S++ ++T +V D V
Sbjct: 118 TVFLMTHEDYSYISSTIIKEIASLNGNVTPWVTDVV 153


>gi|221135338|ref|ZP_03561641.1| phosphopantetheine adenylyltransferase [Glaciecola sp. HTCC2999]
          Length = 163

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 93/152 (61%), Gaps = 6/152 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDPITNGH D+I +     E +++ I  N  K K   S++ER E+I + I
Sbjct: 1   MKTRAIYPGTFDPITNGHADLIERGADMFEHIIVGIASNPTK-KPLFSLEERVEMITE-I 58

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V  F GL  + A+  +A V++RGLR ++DF+YE ++ ++NR L P + 
Sbjct: 59  THHLPN----VEVKGFTGLLADFAQHENATVLIRGLRAVSDFEYEFQLANMNRRLNPNLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           ++ L   E + +++STL++ +     D++ FV
Sbjct: 115 SVFLTPAEENSFISSTLVKEVALHHGDVSQFV 146


>gi|312127710|ref|YP_003992584.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|312135043|ref|YP_004002381.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           owensensis OL]
 gi|312793406|ref|YP_004026329.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312877019|ref|ZP_07736992.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311775094|gb|ADQ04581.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           owensensis OL]
 gi|311777729|gb|ADQ07215.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311796160|gb|EFR12516.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|312180546|gb|ADQ40716.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 168

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 96/156 (61%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  VY GSFDP+TNGH+DII +A    + L++A+  N  KT  F  I+ER EL+K++  
Sbjct: 1   MKIGVYPGSFDPVTNGHLDIIERASKIFDKLIVAVLVNPNKTPVF-DIEERVELLKETTE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V +F+GL ++  K  +A+VIV+GLR ++DF+YE +M  +N+ L P I T
Sbjct: 60  H-LPN----VEVKAFKGLLIDFMKQENAKVIVKGLRAVSDFEYEFQMALLNKKLEPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I +       Y++S++++ +      I   VP+ + 
Sbjct: 115 IFMMTNSKYSYLSSSMVKEVARFGGCIEDLVPEKIA 150


>gi|242237622|ref|YP_002985803.1| phosphopantetheine adenylyltransferase [Dickeya dadantii Ech703]
 gi|242129679|gb|ACS83981.1| pantetheine-phosphate adenylyltransferase [Dickeya dadantii Ech703]
          Length = 159

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDP+TNGH+D++ +A    + L++AI  +  K   F ++ ER  L +Q+ 
Sbjct: 1   MKTRAIYPGTFDPLTNGHLDLLTRAARMFDHLILAIAASPSKNTLF-TLDERVALARQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V VI F  L  + AK   A ++VRGLR ++DF+YE+++  +N  L P + 
Sbjct: 60  GHL-----KNVEVIGFSDLMASFAKQQHATILVRGLRAISDFEYELQLAKMNTHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++STL++ +     D++ F+P P+   L   ++
Sbjct: 115 SVFLMPSEKWSFISSTLVKEVARHGGDVSHFLPAPITAALSQKLL 159


>gi|222529218|ref|YP_002573100.1| phosphopantetheine adenylyltransferase [Caldicellulosiruptor bescii
           DSM 6725]
 gi|254763923|sp|B9MRM3|COAD_ANATD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|222456065|gb|ACM60327.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           bescii DSM 6725]
          Length = 167

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 96/156 (61%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  VY GSFDP+TNGH+DII +A    + L++A+  N  KT  F  I+ER EL+K++  
Sbjct: 1   MKIGVYPGSFDPVTNGHLDIIERASKIFDKLIVAVLVNPNKTPVF-DIEERVELLKETTE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V +F+GL ++  K  +A+VIV+GLR ++DF+YE +M  +N+ L P I T
Sbjct: 60  H-LPN----VEVKAFKGLLIDFMKQENAKVIVKGLRAVSDFEYEFQMALLNKKLEPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I +       Y++S++++ +      I   VP+ + 
Sbjct: 115 IFMMTNSKYSYLSSSMVKEVARFGGCIEDLVPEKIA 150


>gi|90580914|ref|ZP_01236716.1| phosphopantetheine adenylyltransferase [Vibrio angustum S14]
 gi|90437985|gb|EAS63174.1| phosphopantetheine adenylyltransferase [Vibrio angustum S14]
          Length = 160

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 96/156 (61%), Gaps = 7/156 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D+I +A +  + +++ +  N  K K    + ER EL  +  
Sbjct: 1   MTTRVIYPGTFDPITNGHLDLIERAAAMFDHVIVGVAFNPSK-KPLFDLNERVELAGKIT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V ++ F GL V+ AK+ +A ++VRGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 60  KHL-----DNVEIVGFSGLLVDFAKERNANILVRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           T+ L   E + +++ST+++ +     D++ FV DP+
Sbjct: 115 TVFLTPAEENSFISSTIVKEVALHKGDVSQFV-DPL 149


>gi|300773839|ref|ZP_07083708.1| pantetheine-phosphate adenylyltransferase [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|300760010|gb|EFK56837.1| pantetheine-phosphate adenylyltransferase [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 159

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 98/160 (61%), Gaps = 5/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AV+ GSFDP+T  H DI+++AL   + +++A+G NS K +G LS  +R  ++ Q +F
Sbjct: 1   MKVAVFPGSFDPVTLAHQDIVLRALELFDRIIVAVGTNSTK-QGLLSTDDRVAIL-QEVF 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               + S+RV V +++GL V+  +   A  I+RGLR+  DF++E  +   N+ L PEI T
Sbjct: 59  ---AEVSDRVEVTTYKGLTVDYCRQAGANYILRGLRNTNDFEFEYAIAQNNKHLAPEIDT 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           I L +     +++ST++R +     DI+S VP  V  +++
Sbjct: 116 IFLMSTSGLGHISSTIVRDVTLHKGDISSMVPAAVISYME 155


>gi|169824374|ref|YP_001691985.1| putative phosphopantetheine adenyltransferase [Finegoldia magna
           ATCC 29328]
 gi|229500791|sp|B0S155|COAD_FINM2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|167831179|dbj|BAG08095.1| putative phosphopantetheine adenyltransferase [Finegoldia magna
           ATCC 29328]
          Length = 162

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 96/153 (62%), Gaps = 6/153 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K +Y GSFDPITNGHMDII ++    E++ +A+  N ++ K   ++++R E+I+++  H 
Sbjct: 5   KVLYPGSFDPITNGHMDIIERSAKIFEEVNVAVVKN-IQKKSTFTLEQRVEMIEKACKHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V +  FEGL V+ AK I    I+RGLR ++DF+ EM+M+  N+ L  E+ T+ 
Sbjct: 64  -----SNVKIHQFEGLTVDFAKQIGCSTIIRGLRAVSDFESEMQMSLANKKLNDELETLF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           L A     +++S+++R + S  ADI+  VP+ +
Sbjct: 119 LVADGKYAFLSSSIVREIASYGADISELVPENI 151


>gi|328954572|ref|YP_004371906.1| Phosphopantetheine adenylyltransferase [Desulfobacca acetoxidans
           DSM 11109]
 gi|328454896|gb|AEB10725.1| Phosphopantetheine adenylyltransferase [Desulfobacca acetoxidans
           DSM 11109]
          Length = 161

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/157 (36%), Positives = 95/157 (60%), Gaps = 7/157 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y GSFDPITNGH+D+I + L   +++++AI  N +K   F +I+ER ELI++ +
Sbjct: 1   MGKIAIYPGSFDPITNGHLDLINRGLKVFDEIIVAIAVNPIKQPLF-TIEERVELIREVL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                +   RV +  F GL V+  +     VI+RGLR ++DFDYE ++  +NR L PEI 
Sbjct: 60  -----NEHPRVKIDHFTGLLVDYVRQQGTNVILRGLRAVSDFDYEFQLALMNRRLAPEIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           T+ L       +++S++++  +S+   +   VP PV 
Sbjct: 115 TVFLMTSLKWVFLSSSILKEAVSLGGVVQDIVP-PVV 150


>gi|146309772|ref|YP_001174846.1| phosphopantetheine adenylyltransferase [Enterobacter sp. 638]
 gi|167009044|sp|A4W515|COAD_ENT38 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|145316648|gb|ABP58795.1| Phosphopantetheine adenylyltransferase [Enterobacter sp. 638]
          Length = 159

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 93/153 (60%), Gaps = 6/153 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPITNGH+DII +A S  + +++AI  +  K K    ++ER  L   ++
Sbjct: 1   MSTKAIYPGTFDPITNGHIDIITRAASMFDRVILAIAASPSK-KPMFDLEERVALATTAL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V+ F  L  N A+   A +++RGLR + DF+YEM++  +NR L PE+ 
Sbjct: 60  QH-LPN----VEVMGFSDLMANFARAQQANILIRGLRAVADFEYEMQLAHMNRHLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           ++ L   +   +++S+L++ +     D+T F+P
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHAGDVTHFLP 147


>gi|302380514|ref|ZP_07268979.1| pantetheine-phosphate adenylyltransferase [Finegoldia magna
           ACS-171-V-Col3]
 gi|303234080|ref|ZP_07320729.1| pantetheine-phosphate adenylyltransferase [Finegoldia magna
           BVS033A4]
 gi|302311457|gb|EFK93473.1| pantetheine-phosphate adenylyltransferase [Finegoldia magna
           ACS-171-V-Col3]
 gi|302495005|gb|EFL54762.1| pantetheine-phosphate adenylyltransferase [Finegoldia magna
           BVS033A4]
          Length = 162

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 96/153 (62%), Gaps = 6/153 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K +Y GSFDPITNGHMDII ++    E++ +A+  N ++ K   ++++R E+I+++  H 
Sbjct: 5   KVLYPGSFDPITNGHMDIIERSAKIFEEVNVAVVKN-IQKKSTFTLEQRVEMIEKACKHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V +  FEGL V+ AK I    I+RGLR ++DF+ EM+M+  N+ L  E+ T+ 
Sbjct: 64  -----SNVKIHQFEGLTVDFAKQIGCSTIIRGLRAVSDFESEMQMSLANKKLNDELETLF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           L A     +++S+++R + S  ADI+  VP+ +
Sbjct: 119 LVADGKYAFLSSSIVREIASYGADISELVPENI 151


>gi|58582131|ref|YP_201147.1| phosphopantetheine adenylyltransferase [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84624029|ref|YP_451401.1| phosphopantetheine adenylyltransferase [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|166711654|ref|ZP_02242861.1| phosphopantetheine adenylyltransferase [Xanthomonas oryzae pv.
           oryzicola BLS256]
 gi|188576261|ref|YP_001913190.1| phosphopantetheine adenylyltransferase [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|75435246|sp|Q5GZV9|COAD_XANOR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123521901|sp|Q2P2V0|COAD_XANOM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541054|sp|B2SIL3|COAD_XANOP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|58426725|gb|AAW75762.1| lipopolysaccharide synthesis enzyme [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84367969|dbj|BAE69127.1| lipopolysaccharide synthesis enzyme [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188520713|gb|ACD58658.1| pantetheine-phosphate adenylyltransferase [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 168

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 95/161 (59%), Gaps = 6/161 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K    LS++ R  L ++++  
Sbjct: 7   RTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPA-LSLERRVALAQEAL-- 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +   V V  F+ L  +  + + A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 64  ---AAHANVEVRGFDTLLAHFVRQMGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            L   E   +++S+L+R +  +  D++ FVP  V   L+ +
Sbjct: 121 FLTPSEQYSFISSSLVREIARLGGDVSGFVPASVVEALRQV 161


>gi|313204955|ref|YP_004043612.1| phosphopantetheine adenylyltransferase [Paludibacter
           propionicigenes WB4]
 gi|312444271|gb|ADQ80627.1| Phosphopantetheine adenylyltransferase [Paludibacter
           propionicigenes WB4]
          Length = 150

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 95/152 (62%), Gaps = 7/152 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++A++ G+FDP T GH  I+ + LSF +++VI IG N  K K   S+ +R ++I+Q+  
Sbjct: 1   MKRAIFPGTFDPFTIGHYSIVQRGLSFFDEIVIGIGLNQSK-KTLFSVDKRLDIIRQA-- 57

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            FI DS  RV V S++ L V+ A  + A  ++RGLR + DF+YE  +   NR L   I T
Sbjct: 58  -FIDDS--RVKVASYDSLTVDFALSVDANFVLRGLRSVVDFEYERSIADANRKLTG-IET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + LF +    +++ST+ R LI+   DI++F+P
Sbjct: 114 VILFTESEYSFISSTVTRDLIAFGKDISTFLP 145


>gi|331269671|ref|YP_004396163.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum
           BKT015925]
 gi|329126221|gb|AEB76166.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum
           BKT015925]
          Length = 176

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 96/155 (61%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY+GSFDPIT GH+DII +A +  + +++++  N  K KG  +I+ER ELI++   
Sbjct: 16  MKTAVYSGSFDPITEGHLDIIRRAANIFDQVIVSVLVNPSK-KGLFNIEERVELIEK--- 71

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +      V V SF GL V+  K+ +A+VI++GLR ++DF+YE++M  +N+ L P I T
Sbjct: 72  --VTKDIKNVKVESFHGLLVDYMKNKNAKVIIKGLRAVSDFEYELQMAHMNKKLDPSIET 129

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + +       Y++S+ I+ ++     I   VP+ V
Sbjct: 130 VFMMTNPKYSYLSSSSIKQVVMFGGCIKGLVPEQV 164


>gi|299144913|ref|ZP_07037981.1| pantetheine-phosphate adenylyltransferase [Bacteroides sp. 3_1_23]
 gi|298515404|gb|EFI39285.1| pantetheine-phosphate adenylyltransferase [Bacteroides sp. 3_1_23]
          Length = 152

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 98/152 (64%), Gaps = 7/152 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKA++ G+FDP T GH  ++ +AL+F++++VI IG N  K   +  I++R E+I++   
Sbjct: 1   MRKAIFPGTFDPFTIGHYSVVERALTFMDEIVIGIGINENKNT-YFPIEKREEMIRE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +     R+ V+S++ L ++ A+++ A+ IVRG+R + DF+YE  +  +NR L   I T
Sbjct: 57  --LYKDEPRIQVMSYDCLTIDFAQEVEARFIVRGIRTVKDFEYEETIADINRKLAG-IET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           I LF +     V+ST++R L++ + DI+ F+P
Sbjct: 114 ILLFTEPELTCVSSTIVRELLTYNKDISLFIP 145


>gi|197333912|ref|YP_002154901.1| pantetheine-phosphate adenylyltransferase [Vibrio fischeri MJ11]
 gi|254764186|sp|B5FFG3|COAD_VIBFM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|197315402|gb|ACH64849.1| pantetheine-phosphate adenylyltransferase [Vibrio fischeri MJ11]
          Length = 160

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 92/152 (60%), Gaps = 6/152 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++ +Y G+FDP+T+GH DII +A +  + +V+ +  +  K K   S++ER +++ Q+ 
Sbjct: 1   MTKRVIYPGTFDPVTHGHSDIISRAANMFDHVVVGVAFSPSK-KTMFSLEERMDMLVQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      N VSV+ F GL V+LAKD  A ++VRGLR   DF+YE+ +T++ + L PE+ 
Sbjct: 60  AHL-----NNVSVVGFSGLLVDLAKDQQANILVRGLRTTMDFEYELGLTTMYKKLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           TI L   E   +++ST++R        I  FV
Sbjct: 115 TIFLTPPEEHGFLSSTIVRETAIHGGKIDQFV 146


>gi|294677104|ref|YP_003577719.1| pantetheine-phosphate adenylyltransferase [Rhodobacter capsulatus
           SB 1003]
 gi|294475924|gb|ADE85312.1| pantetheine-phosphate adenylyltransferase [Rhodobacter capsulatus
           SB 1003]
          Length = 164

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 88/151 (58%), Gaps = 1/151 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII +AL+ V+ LVI +  N  K   F S++ER E++K    
Sbjct: 1   MRIGLYPGTFDPVTLGHIDIIERALALVDRLVIGVAINRDKGPLF-SLEERVEMLKAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    + V  FE L ++ A+D+ A VIVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  PITARRGGEIVVHPFENLLIDCARDVGAGVIVRGLRAVADFEYEFQMVGMNRALDASVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L A    + + S L++ +  +  D++ FV
Sbjct: 120 VFLMADARRQAIASKLVKEIARLGGDVSKFV 150


>gi|315125900|ref|YP_004067903.1| phosphopantetheine adenylyltransferase (PPAT) (dephospho-CoA
           pyrophosphorylase) [Pseudoalteromonas sp. SM9913]
 gi|315014414|gb|ADT67752.1| phosphopantetheine adenylyltransferase (PPAT) (dephospho-CoA
           pyrophosphorylase) [Pseudoalteromonas sp. SM9913]
          Length = 181

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 95/148 (64%), Gaps = 6/148 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y G+FDP+TNGH D+I +A    + +++AI  N  K   F +++ER +L  + + H  
Sbjct: 23  AIYPGTFDPLTNGHTDLIQRAAKMFDTVIVAIAHNPSKKPCF-TLEERVDLANEILSHL- 80

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
               + V VI F GL  +LA+D +A V++RG+R ++DFDYE ++ ++NR L P++ ++ L
Sbjct: 81  ----DNVKVIGFSGLLADLARDHNANVLIRGIRAVSDFDYEFQLANMNRRLNPDLESVFL 136

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFV 152
              E + +++STL++ +   + D++ FV
Sbjct: 137 TPAERNTFISSTLVKEVARHNGDVSEFV 164


>gi|167646832|ref|YP_001684495.1| phosphopantetheine adenylyltransferase [Caulobacter sp. K31]
 gi|189082558|sp|B0SZS4|COAD_CAUSK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|167349262|gb|ABZ71997.1| pantetheine-phosphate adenylyltransferase [Caulobacter sp. K31]
          Length = 162

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/156 (36%), Positives = 94/156 (60%), Gaps = 3/156 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+TNGH+DII +A+  V+ LVI +  N  K   F +++ER   +++   
Sbjct: 1   MRIGLYPGTFDPVTNGHLDIIGRAVKLVDKLVIGVAVNIGKGPLF-TLEERVATLERETA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H       ++ V  F+ L +  A+++ AQ+IVRGLR + DF+YE +MT++N+ L  EI T
Sbjct: 60  HLT--KIAQIEVRPFDTLLMYFAREVGAQMIVRGLRAVADFEYEFQMTAMNQQLDREIET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + L A    + + S L++ + ++  D+  FVP  V 
Sbjct: 118 VFLMADPRHQAIASRLVKEIAALGGDVHKFVPPGVA 153


>gi|324995255|gb|EGC27167.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           SK678]
          Length = 164

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 93/159 (58%), Gaps = 5/159 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+T GH+D+I +A    + L + I  N  K+ GF +I+ R  ++K+++ H  
Sbjct: 6   GLFTGSFDPMTKGHVDLIERASRLFDKLYVGIFYNREKS-GFFTIEARERMVKEALEHL- 63

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
               N   +IS   LAV +A+ + AQ  VRGLR+  D DYE  M   N  L  E+ TI L
Sbjct: 64  ---DNVEVIISQNELAVTVARRLGAQAFVRGLRNSQDLDYEANMNFFNHELAGELETIFL 120

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            +K + ++++S+ IR LI+   DI ++VP  V   L+ I
Sbjct: 121 LSKPAYQHISSSRIRELIAFQQDIAAYVPQSVIKELERI 159


>gi|260172992|ref|ZP_05759404.1| phosphopantetheine adenylyltransferase [Bacteroides sp. D2]
 gi|315921270|ref|ZP_07917510.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313695145|gb|EFS31980.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 152

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 98/152 (64%), Gaps = 7/152 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKA++ G+FDP T GH  ++ +AL+F++++VI IG N  K   +  I++R E+I++   
Sbjct: 1   MRKAIFPGTFDPFTIGHYSVVERALTFMDEIVIGIGINENKNT-YFPIEKREEMIRE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +     R+ V+S++ L ++ A+++ A+ IVRG+R + DF+YE  +  +NR L   I T
Sbjct: 57  --LYKDEPRIQVMSYDCLTIDFAQEVGARFIVRGIRTVKDFEYEETIADINRKLAG-IET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           I LF +     V+ST++R L++ + DI+ F+P
Sbjct: 114 ILLFTEPELTCVSSTIVRELLTYNKDISLFIP 145


>gi|110832942|ref|YP_691801.1| pantetheine-phosphate adenylyltransferase [Alcanivorax borkumensis
           SK2]
 gi|110646053|emb|CAL15529.1| pantetheine-phosphate adenylyltransferase [Alcanivorax borkumensis
           SK2]
          Length = 186

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 95/161 (59%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D++ +A    +++V+ I   S K     S+ ER EL  QS+
Sbjct: 24  MTNRVIYPGTFDPITNGHLDLVERAAKMFDEVVVGIAA-SEKKGPLFSLDERVELT-QSV 81

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +P+    V V  F  L  +  ++    +++RGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 82  LSHLPN----VRVTGFSKLLAHFCREEGGNILLRGLRAVSDFEYEFQLANMNRKLAPELE 137

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ L   E   +++S+LIR +  +D D+ +FVP  V   L+
Sbjct: 138 TVFLTPAEHLSFISSSLIREIALLDGDVNNFVPPLVAEALE 178


>gi|170286930|dbj|BAG13458.1| pantetheine-phosphate adenylyltransferase [uncultured Termite group
           1 bacterium]
          Length = 170

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 96/165 (58%), Gaps = 6/165 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY GSFDP TNGH+DIII+A      ++IA+   S+  K   S+QER  L+++ I +  
Sbjct: 7   AVYPGSFDPPTNGHLDIIIRASHLFPKIIIAV-TKSINKKHIFSLQERINLLQKIIKNL- 64

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                 V V SF GL  N    I++ V++RGLR ++DF+YE +M  +NR L  +I T+ L
Sbjct: 65  ----KNVKVASFSGLLANYLAKINSFVLIRGLRALSDFEYEFQMALMNRNLNKKIETVFL 120

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
              +S  +++S ++R +  +  D   FVP+ V + LK   + L K
Sbjct: 121 MPDQSYTFLSSGMVREIAMLGGDTKDFVPECVKIELKKRSLDLSK 165


>gi|91781708|ref|YP_556914.1| phosphopantetheine adenylyltransferase [Burkholderia xenovorans
           LB400]
 gi|296161523|ref|ZP_06844328.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp. Ch1-1]
 gi|122970735|sp|Q145X7|COAD_BURXL RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|91685662|gb|ABE28862.1| Coenzyme A biosynthesis protein, Cytidyltransferase-related protein
           [Burkholderia xenovorans LB400]
 gi|295888167|gb|EFG67980.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp. Ch1-1]
          Length = 171

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 102/163 (62%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F +++ER ++  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRNKKPFFTLEERLDIAHEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+SF+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VQVMSFKGLLKDFVRSNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              +  ++++ T++R +  +  D++ FV   V  +LK  V +L
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEQWLKEKVAAL 160


>gi|297180062|gb|ADI16287.1| phosphopantetheine adenylyltransferase [uncultured bacterium
           HF0010_16H03]
          Length = 160

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 96/152 (63%), Gaps = 7/152 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDPIT GHMDII +     + +V+AI  +  K   F +++ER  L   SIF
Sbjct: 1   MKVAIYPGSFDPITFGHMDIIERGCGLFDKVVVAIAKSESKNPMF-TLEERINL-ATSIF 58

Query: 62  HFIPDSSNRVSVISF-EGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
               + +++V V+ F   L V LAKD  A  I+RGLR ++DF+YE ++ ++NR L P+I 
Sbjct: 59  ----EDNDKVEVVGFPRKLTVELAKDYEACAIIRGLRAVSDFEYEFQLATMNRSLAPDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           +I L  KES  YV+S+LI+ +  +  D++ FV
Sbjct: 115 SIFLTPKESLIYVSSSLIKEISDLKGDVSKFV 146


>gi|255281787|ref|ZP_05346342.1| pantetheine-phosphate adenylyltransferase [Bryantella formatexigens
           DSM 14469]
 gi|255267854|gb|EET61059.1| pantetheine-phosphate adenylyltransferase [Bryantella formatexigens
           DSM 14469]
          Length = 162

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 95/155 (61%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++AVY GSFDP+T GH+DII ++ + V++L++ +  N+ K   F S+ ER +++     
Sbjct: 1   MKRAVYPGSFDPVTFGHLDIIRRSAALVDELIVGVLQNNNKKPLFSSL-ERVKIL----L 55

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D SN V V +F GL+++  K   AQ +VRGLR +TDFDYE++M   NR + P+I T
Sbjct: 56  EVTKDMSN-VRVEAFTGLSIDFVKKCDAQFLVRGLRAITDFDYELQMAQTNRIMAPDIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           I L       Y++S+ ++ +     DI+ FVP  V
Sbjct: 115 IFLTTSLEYAYLSSSTVKEVAYYGGDISKFVPSGV 149


>gi|190570529|ref|YP_001974887.1| phosphopantetheine adenylyltransferase [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|213019287|ref|ZP_03335094.1| phosphopantetheine adenylyltransferase [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
 gi|229541060|sp|B3CMX3|COAD_WOLPP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|190356801|emb|CAQ54166.1| phosphopantetheine adenylyltransferase [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|212995396|gb|EEB56037.1| phosphopantetheine adenylyltransferase [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
          Length = 168

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 96/159 (60%), Gaps = 5/159 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            +Y G+FDPIT GH+DII +A   V+ L+I +  N  K   F  I+ R+ + K  +    
Sbjct: 8   GIYPGTFDPITFGHLDIIKRACKLVDKLIIGVAENVNKHTNF-DIRLRTSMAKNEVKGAG 66

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
            D+     +ISF GL V  AK+ +A VI+RGLR ++DFDYE +M+ VN  L PEI TI L
Sbjct: 67  IDAD----IISFNGLLVKFAKEQNASVIIRGLRAVSDFDYEFQMSWVNYKLFPEIETIFL 122

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            A E +++++S+ ++ +  +  D+++FV   V   L N+
Sbjct: 123 PASEDTQFISSSFVKEIARLGGDVSNFVSKSVQSELINL 161


>gi|168188190|gb|ACA14484.1| CoaD [Aeromonas hydrophila]
          Length = 215

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 95/158 (60%), Gaps = 7/158 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  K +Y G+FDPITNGH D+I +A    +++V+ +  NS   +    + ER  L +Q  
Sbjct: 56  MTNKVIYPGTFDPITNGHTDLIGRAARLFDEVVVGV-ANSPSKRPLFDLAERVLLAQQVT 114

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V+ F GL V+ A++  A V++RGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 115 AH-LPN----VKVVGFSGLLVDFAREQQANVLIRGLRAVSDFEYEFQLANMNRRLMPELE 169

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           ++ L   E + +++STL++ +     DI  FV DP+  
Sbjct: 170 SVFLTPAEENSFISSTLVKEVALHGGDIRQFV-DPIVA 206


>gi|119713190|gb|ABL97258.1| putative phosphopantetheine adenylyltransferase [uncultured marine
           bacterium EB0_50A10]
          Length = 160

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 97/152 (63%), Gaps = 7/152 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDPIT GHMDII +     + +V+AI  +  K   F S+++R  L   SI+
Sbjct: 1   MRVAIYPGSFDPITYGHMDIIDRGCGLFDKVVVAIAKSESKNPMF-SLEDRINL-ATSIY 58

Query: 62  HFIPDSSNRVSVISF-EGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
               ++++ V V+ F   L V+LAKD  A  I+RGLR ++DF+YE ++ ++NR L P+I 
Sbjct: 59  ----ENNDMVEVVGFPRKLTVDLAKDYGACAIIRGLRAVSDFEYEFQLATMNRSLAPDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           +I L  KES  YV+S+LI+ +  +  DI+ FV
Sbjct: 115 SIFLTPKESLIYVSSSLIKEISDLKGDISKFV 146


>gi|317050103|ref|YP_004117751.1| pantetheine-phosphate adenylyltransferase [Pantoea sp. At-9b]
 gi|316951720|gb|ADU71195.1| pantetheine-phosphate adenylyltransferase [Pantoea sp. At-9b]
          Length = 161

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 90/153 (58%), Gaps = 6/153 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPIT GH+DI+ +A    + +V+AI  +  K K   S+ ER +L +Q  
Sbjct: 1   MSTKAIYPGTFDPITLGHLDIVTRAARMFDHIVLAIAASPSK-KPLFSLDERVDLARQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V VI F  L  N A+   A V+VRGLR ++DF+YE+++  +NR L P++ 
Sbjct: 60  AHL-----GNVEVIGFSDLMANFAQAQQANVLVRGLRAVSDFEYELQLAHMNRHLLPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           ++ L   E   +V+S+L++ +     D+ +F+P
Sbjct: 115 SVFLMPSEGFSFVSSSLVKEVARHQGDVQAFLP 147


>gi|256545260|ref|ZP_05472625.1| lipopolysaccharide core biosynthesis protein KdtB [Anaerococcus
           vaginalis ATCC 51170]
 gi|256399087|gb|EEU12699.1| lipopolysaccharide core biosynthesis protein KdtB [Anaerococcus
           vaginalis ATCC 51170]
          Length = 164

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/161 (39%), Positives = 97/161 (60%), Gaps = 6/161 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K +Y GSFDPIT GH+DII +     +++VIAI  N  K   F SI+ER +LI+  I  F
Sbjct: 2   KVIYPGSFDPITIGHLDIIKRLNKMFDEVVIAILINEAKHSLF-SIKERKQLIENEIKEF 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
             D+   V V +FEGL V+ AK  ++++I+RGLR +TD++YEM +   N  L  ++ TI 
Sbjct: 61  QLDN---VKVKTFEGLLVDFAKKENSKIIIRGLRAVTDYEYEMNIAQFNSSLYEDLETIF 117

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPV--CVFLKN 162
           L +     +++S+ +R L S   D++ FV   V   ++ KN
Sbjct: 118 LLSDPKFSFISSSGVRELASFGGDVSKFVSKNVKKAIYEKN 158


>gi|254482653|ref|ZP_05095891.1| pantetheine-phosphate adenylyltransferase [marine gamma
           proteobacterium HTCC2148]
 gi|214037012|gb|EEB77681.1| pantetheine-phosphate adenylyltransferase [marine gamma
           proteobacterium HTCC2148]
          Length = 161

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 95/157 (60%), Gaps = 6/157 (3%)

Query: 6   VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIP 65
           +Y G+FDPITNGH+D+  +A      +V+AI  +  KT  F  +++R  L + S+ H   
Sbjct: 7   IYPGTFDPITNGHVDLTERASRLFGRVVVAIAYSEKKTPLF-DLEQRIALCEASLSHL-- 63

Query: 66  DSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALF 125
              + V V  F  L  + AK   A+ ++RGLR + DF+YE ++T++NR + PE  ++ L 
Sbjct: 64  ---DNVEVTGFSNLLTDFAKSQDARCVLRGLRTVADFEYEFQLTNMNRAMFPEFESVFLT 120

Query: 126 AKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
             E   +++S+L+R + ++  DIT FVP+PV + L++
Sbjct: 121 PSEHLSFISSSLVREIAALKGDITPFVPEPVALALQS 157


>gi|94499819|ref|ZP_01306355.1| pantetheine-phosphate adenylyltransferase [Oceanobacter sp. RED65]
 gi|94428020|gb|EAT12994.1| pantetheine-phosphate adenylyltransferase [Oceanobacter sp. RED65]
          Length = 159

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 91/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPITNGH D++ +A    + +V+A+  +S   K    +  R +L ++ + 
Sbjct: 1   MTRVIYPGTFDPITNGHTDLVTRASKLFDHIVVAV-ADSPHKKPLFDLDTRCQLAEEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + V ++ F  L  +  ++ +AQV++RGLR ++DF+YE ++ ++NR L PE+ T
Sbjct: 60  HL-----DNVEIVGFNTLLAHFVREQNAQVLLRGLRAVSDFEYEFQLANMNRALAPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   Y++STLIR +  ++ D+  FV
Sbjct: 115 VFLTPDERHSYISSTLIREIARLEGDVKKFV 145


>gi|322380925|ref|ZP_08054996.1| phosphopantetheine adenylyltransferase [Helicobacter suis HS5]
 gi|321146648|gb|EFX41477.1| phosphopantetheine adenylyltransferase [Helicobacter suis HS5]
          Length = 164

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/164 (35%), Positives = 102/164 (62%), Gaps = 8/164 (4%)

Query: 1   MMRK-AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           M++K A+Y GSFDPITNGH+DII +     ++L++A+  +S K   F S+  R ++++ +
Sbjct: 6   MLKKLAIYPGSFDPITNGHLDIIQRGSELFDNLIVAVAKSSAKCPMF-SLANRLKMLQLA 64

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
             H      + V  ++FEGL V+LAKD + + I+RGLR ++DF++E++M   N+ L P++
Sbjct: 65  TAHL-----HNVKCLAFEGLLVDLAKDHNCRCIIRGLRAVSDFEFELQMCYANKSLNPDL 119

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVF-LKN 162
            T+       + +++S+++R ++S    I   VP  V  F LKN
Sbjct: 120 ETLYFMPSLQNTFISSSVVRSILSHKGQIKHLVPPAVLEFILKN 163


>gi|295109967|emb|CBL23920.1| pantetheine-phosphate adenylyltransferase, bacterial [Ruminococcus
           obeum A2-162]
          Length = 164

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 99/160 (61%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP T GH+D+I +A    + +V+ +  NS K+  F S++ER  +++++  
Sbjct: 1   MVTAVYPGSFDPATYGHLDVIRRASVSFDRVVVGVLHNSSKSPLF-SVEERVNILEKATK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V +  F+GL+VN A++  AQVIVRGLR +TDF+YE++M   NR L P++ T
Sbjct: 60  D-IPN----VIIKPFDGLSVNFARENHAQVIVRGLRAVTDFEYELQMAQTNRVLAPDVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           I L       YV+ST+++ +     D+++F P  +   L+
Sbjct: 115 IFLTTSLEYAYVSSTIMKEVARFGGDLSNFAPPEIIKTLR 154


>gi|307264820|ref|ZP_07546382.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|306920078|gb|EFN50290.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           wiegelii Rt8.B1]
          Length = 160

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/156 (36%), Positives = 97/156 (62%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH+DII +  +  + L++A+  N  K K   S++ER EL+K ++ 
Sbjct: 1   MKTAIYPGSFDPVTYGHIDIIKRGANLFDKLIVAVLLNPSK-KPLFSVEERVELLK-AVT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           + IP+    V +  F+GL V+ AK ++A  I++GLR ++DF+YE +M  +N+ L P + T
Sbjct: 59  YDIPN----VEIDYFDGLLVDYAKKVNANAIIKGLRMVSDFEYEFQMALINKKLNPSVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I L       Y++S++++ +      ++ FVPD V 
Sbjct: 115 IFLMTNAKYGYLSSSVVKEIAQFGGCLSEFVPDIVA 150


>gi|302871971|ref|YP_003840607.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302574830|gb|ADL42621.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 168

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 96/156 (61%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  VY GSFDP+TNGH+DII +A    + L++A+  N  KT  F  I+ER EL+K++  
Sbjct: 1   MKIGVYPGSFDPVTNGHLDIIERASKIFDKLIVAVLVNPNKTPVF-DIEERVELLKETTE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V + +F+GL ++  K  +A+VIV+GLR ++DF+YE +M  +N+ L P I T
Sbjct: 60  H-LPN----VEIKAFKGLLIDFMKQENAKVIVKGLRAVSDFEYEFQMALLNKKLEPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I +       Y++S++++ +      I   VP+ + 
Sbjct: 115 IFMMTNSKYSYLSSSMVKEVARFGGCIEDLVPEKIA 150


>gi|289667747|ref|ZP_06488822.1| phosphopantetheine adenylyltransferase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 168

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/161 (33%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K    LS++ R  L ++++  
Sbjct: 7   RPAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPA-LSLERRVALAQEAL-- 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +   V V  F+ L  +  +++ A V++RGLR ++DF+YE +M S++R L PE+ T+
Sbjct: 64  ---AAHTNVEVRGFDTLLAHFVREMGAGVLLRGLRAVSDFEYEFQMASMHRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            L   E   +++S+L+R +  +  D++ FVP  V   L+ +
Sbjct: 121 FLTPAEQYSFISSSLVREIARLGGDVSGFVPASVVEALRQV 161


>gi|188590355|ref|YP_001920575.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum E3
           str. Alaska E43]
 gi|251779121|ref|ZP_04822041.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum E1
           str. 'BoNT E Beluga']
 gi|229488131|sp|B2V4C6|COAD_CLOBA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|188500636|gb|ACD53772.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum E3
           str. Alaska E43]
 gi|243083436|gb|EES49326.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum E1
           str. 'BoNT E Beluga']
          Length = 159

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 89/155 (57%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDPITNGH+DII +     + L+I +  N V  KG   I+ER ELIK+   
Sbjct: 1   MKVAVYPGSFDPITNGHLDIIERGSKVFDKLIIGVLVN-VDKKGLFEIEERVELIKKVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H        V VISF GL ++  K  +A++I++GLR ++DF+YE +M  +N  L P+I T
Sbjct: 60  HI-----KNVEVISFNGLLIDFLKAYNAKIILKGLRAVSDFEYEFKMALMNNKLDPDIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + +       Y++S+ ++ +      I   VP  +
Sbjct: 115 VFMMTSAQYSYLSSSSVKQVAKFGGCIEGLVPKEI 149


>gi|153807002|ref|ZP_01959670.1| hypothetical protein BACCAC_01279 [Bacteroides caccae ATCC 43185]
 gi|149130122|gb|EDM21332.1| hypothetical protein BACCAC_01279 [Bacteroides caccae ATCC 43185]
          Length = 151

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 97/152 (63%), Gaps = 7/152 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKA++ G+FDP T GH  ++ +AL+F++++VI IG N  K   +  I +R E+I++   
Sbjct: 1   MRKAIFPGTFDPFTIGHYSVVERALTFMDEIVIGIGINENKNT-YFPIDKREEMIRE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +     R+ V+S++ L ++ A+++ A+ IVRG+R + DF+YE  +  +NR L   I T
Sbjct: 57  --LYKDDPRIRVMSYDCLTIDFAQEVGAKFIVRGIRTVKDFEYEETIADINRKLAG-IET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           I LF +     V+ST++R L++ + DI+ F+P
Sbjct: 114 ILLFTEPELTCVSSTIVRELLTFNKDISQFIP 145


>gi|189485490|ref|YP_001956431.1| pantetheine-phosphate adenylyltransferase [uncultured Termite group
           1 bacterium phylotype Rs-D17]
 gi|189485492|ref|YP_001956433.1| pantetheine-phosphate adenylyltransferase [uncultured Termite group
           1 bacterium phylotype Rs-D17]
 gi|170287449|dbj|BAG13970.1| pantetheine-phosphate adenylyltransferase [uncultured Termite group
           1 bacterium phylotype Rs-D17]
 gi|170287451|dbj|BAG13972.1| pantetheine-phosphate adenylyltransferase [uncultured Termite group
           1 bacterium phylotype Rs-D17]
          Length = 170

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/165 (38%), Positives = 95/165 (57%), Gaps = 6/165 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY GSFDP TNGH+DIII+A      + IA+   S+  K   S+QER  L+++ I +  
Sbjct: 7   AVYPGSFDPPTNGHLDIIIRASHLFPKITIAV-TKSINKKHIFSLQERINLLQKIIKNL- 64

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                 V V SF GL  N    I++ V++RGLR ++DF+YE +M  +NR L  +I TI L
Sbjct: 65  ----KNVKVASFSGLLANYLAKINSFVLIRGLRALSDFEYEFQMALMNRNLNKKIETIFL 120

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
              +S  +++S ++R +  +  D   FVP+ V + LK   + L K
Sbjct: 121 MPDQSYTFLSSGMVREIAMLGGDTKDFVPECVKIELKKRSLDLSK 165


>gi|241889640|ref|ZP_04776938.1| pantetheine-phosphate adenylyltransferase [Gemella haemolysans ATCC
           10379]
 gi|241863262|gb|EER67646.1| pantetheine-phosphate adenylyltransferase [Gemella haemolysans ATCC
           10379]
          Length = 163

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/157 (40%), Positives = 100/157 (63%), Gaps = 7/157 (4%)

Query: 1   MMRK-AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           M RK A+  GSFDPIT GH+DII ++    +++++AI  N  K K   S+ ER E+IK++
Sbjct: 1   MKRKIAIVPGSFDPITYGHIDIIKRSSELFDEIIVAILVNPDK-KYLFSLDERVEMIKET 59

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           I   IP+    V V +F GL VN AK + + VIVRGLR ++DF+YEM++T +N+ L   I
Sbjct: 60  IKD-IPN----VRVDAFSGLLVNYAKKVGSSVIVRGLRAVSDFEYEMQLTFMNKALDEGI 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
            T  + A +   +++S++++ +    AD++ FVP  V
Sbjct: 115 ETFYMMANKQYSFISSSIVKGVSGFGADLSKFVPKNV 151


>gi|224476239|ref|YP_002633845.1| phosphopantetheine adenylyltransferase [Staphylococcus carnosus
           subsp. carnosus TM300]
 gi|254764170|sp|B9DPV4|COAD_STACT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|222420846|emb|CAL27660.1| putative phosphopantetheine adenylyltransferase [Staphylococcus
           carnosus subsp. carnosus TM300]
          Length = 161

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 100/158 (63%), Gaps = 6/158 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KAV  GSFDPIT GHMDII +     +++ I +  NS K +G  +++ER  LI+ S+   
Sbjct: 5   KAVIPGSFDPITYGHMDIIERVAQRFDEIHICVLKNSNK-EGTFTVEERMALIEASVAD- 62

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           IP+    V V  F GL V+   ++ A+ I+RGLR ++DF+YE+R+TS+N+ L  ++ T+ 
Sbjct: 63  IPN----VEVHQFNGLLVDFCDEVGAKTIIRGLRAVSDFEYELRLTSMNKKLNSDVETLY 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +    +  +++S++++ +    ADI+ FVP+PV   LK
Sbjct: 119 MMTSTNYSFISSSVVKEVAQYKADISEFVPEPVEKALK 156


>gi|254360518|ref|ZP_04976667.1| pantetheine-phosphate adenylyltransferase [Mannheimia haemolytica
           PHL213]
 gi|261492356|ref|ZP_05988918.1| pantetheine-phosphate adenylyltransferase [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261496142|ref|ZP_05992550.1| pantetheine-phosphate adenylyltransferase [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|153091058|gb|EDN73063.1| pantetheine-phosphate adenylyltransferase [Mannheimia haemolytica
           PHL213]
 gi|261308244|gb|EEY09539.1| pantetheine-phosphate adenylyltransferase [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261312039|gb|EEY13180.1| pantetheine-phosphate adenylyltransferase [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 159

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 91/161 (56%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M    +Y G+FDPITNGH+DII +A      +++A+  N  K   F S++ER EL+KQS 
Sbjct: 1   MSYNVIYAGTFDPITNGHLDIICKASHLFGKVIVAVAQNPSKQPLF-SLEERVELVKQSC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             +       + VI F GL  + AK  +A+ ++RG+R   D DYE+++  +N  L  ++ 
Sbjct: 60  TQW-----QNIEVIGFSGLLADFAKQQNAKALIRGIRGADDIDYEIQLAQLNYKLSGDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           TI        RY++ST++R +   + DI+ FVP  V   LK
Sbjct: 115 TIFFPPSIEWRYLSSTMVREIYRHNGDISQFVPQAVKNALK 155


>gi|238924040|ref|YP_002937556.1| pantetheine-phosphate adenylyltransferase [Eubacterium rectale ATCC
           33656]
 gi|259491312|sp|C4Z9Y1|COAD_EUBR3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|238875715|gb|ACR75422.1| pantetheine-phosphate adenylyltransferase [Eubacterium rectale ATCC
           33656]
 gi|291524776|emb|CBK90363.1| pantetheine-phosphate adenylyltransferase, bacterial [Eubacterium
           rectale DSM 17629]
 gi|291528903|emb|CBK94489.1| pantetheine-phosphate adenylyltransferase, bacterial [Eubacterium
           rectale M104/1]
          Length = 161

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 97/153 (63%), Gaps = 6/153 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y GSFDP+T GH+DII ++   V++LV+ +  NS K   F S++ER  +IK+   
Sbjct: 1   MKVGIYPGSFDPVTFGHLDIIERSAKIVDELVVGVLNNSAKNSLF-SLEERVSMIKEMTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H IP+    V V  FEGL V+  K I+A +I+RGLR +TDF+YE+++   N    PEI T
Sbjct: 60  H-IPN----VRVGCFEGLLVDYMKKINATIIIRGLRAVTDFEYELQIAQANGVQNPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           + L +  +  Y++ST+++   S   DI+ FVP+
Sbjct: 115 VFLTSSLNYSYLSSTIVKEFASYGGDISKFVPE 147


>gi|88607052|ref|YP_505233.1| pantetheine-phosphate adenylyltransferase [Anaplasma
           phagocytophilum HZ]
 gi|88598115|gb|ABD43585.1| pantetheine-phosphate adenylyltransferase [Anaplasma
           phagocytophilum HZ]
          Length = 168

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 99/160 (61%), Gaps = 3/160 (1%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  +Y G+FDPIT GH+DII +A + V++LVI +   SV+     S + R+E+I++ +  
Sbjct: 4   RLGIYPGTFDPITFGHIDIIKRACTLVDELVIGV-ARSVQKSTIFSAELRAEMIQREMH- 61

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
            + +  + V V  F+GL    AK   A +I+RGLR +TDFDYE +M+ +N  L P I T+
Sbjct: 62  -VLECKSVVKVEVFDGLLTAFAKQKKALMIIRGLRAVTDFDYEFQMSWINYKLTPGIETV 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L A E +++++S+ ++ +  +  D++ FVP  V   L++
Sbjct: 121 FLPAAEETQFISSSFVKEVARLGGDVSVFVPHNVHEHLRD 160


>gi|160939085|ref|ZP_02086436.1| hypothetical protein CLOBOL_03979 [Clostridium bolteae ATCC
           BAA-613]
 gi|158438048|gb|EDP15808.1| hypothetical protein CLOBOL_03979 [Clostridium bolteae ATCC
           BAA-613]
          Length = 164

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 89/151 (58%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR AVY GSFDP+T GH DII +    V+ L+I +  N  K   F S QER  ++K+   
Sbjct: 1   MRTAVYPGSFDPVTLGHYDIIERTAKMVDKLIIGVLNNKAKCPLF-SAQERVNMLKE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +  S   V + SFEGL ++  +   A ++VRGLR +TDF+YE++M   NR + PEI T
Sbjct: 57  --VTSSLPNVEIQSFEGLLIDFVRRSHADIVVRGLRAITDFEYELQMAQTNRVIAPEIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           I L       Y++S++++ +   + DI+ F+
Sbjct: 115 IFLTTNLKYSYLSSSIVKEIAEYEGDISEFL 145


>gi|326796923|ref|YP_004314743.1| phosphopantetheine adenylyltransferase [Marinomonas mediterranea
           MMB-1]
 gi|326547687|gb|ADZ92907.1| Phosphopantetheine adenylyltransferase [Marinomonas mediterranea
           MMB-1]
          Length = 162

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 91/157 (57%), Gaps = 6/157 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDPITNGH D++ +A      +++A+   S K +  LS   R EL +  + H  
Sbjct: 5   AVYPGTFDPITNGHADLVERAAKLFSKVIVAVAA-SPKKRPALSHDLRIELAENVLGHL- 62

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
               + V V+ F+ L     + ++ QV+VRGLR ++DF+YE ++ ++NR + P++ ++ L
Sbjct: 63  ----HNVEVVGFDNLLTEFTRSVNGQVVVRGLRAVSDFEYEFQLANMNRVIAPDVESLFL 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
              E   Y++STL+R + S+D D   FV   V   LK
Sbjct: 119 TPSEKHSYISSTLVREIASLDGDFGQFVHPEVEKVLK 155


>gi|295105987|emb|CBL03530.1| Phosphopantetheine adenylyltransferase [Gordonibacter pamelaeae
           7-10-1-b]
          Length = 159

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 99/157 (63%), Gaps = 8/157 (5%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+A+  G+FDPIT+GH+D+I +A   V D V+     S K +   S++ER+EL++Q+  
Sbjct: 1   MRRALTPGTFDPITSGHLDVITRAAQLV-DEVVVAVAASPKKQPLFSLEERAELVRQATS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V  F+ L V+ A  + A V+V+GLR +TDF+YE +MT++N  L  E+ T
Sbjct: 60  H-LPN----VRVEPFDELLVDFAARMEATVVVKGLRAITDFEYEFQMTALNYQLNQELET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           + + +     Y++S+++R + S+  D+  FVP   CV
Sbjct: 115 LFIMSPPQYMYLSSSIVREIASLHGDVNGFVPP--CV 149


>gi|269837912|ref|YP_003320140.1| pantetheine-phosphate adenylyltransferase [Sphaerobacter
           thermophilus DSM 20745]
 gi|269787175|gb|ACZ39318.1| pantetheine-phosphate adenylyltransferase [Sphaerobacter
           thermophilus DSM 20745]
          Length = 168

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/171 (33%), Positives = 100/171 (58%), Gaps = 6/171 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAI--GCNSVKTKGFLSIQERSELIKQ 58
           M   A+Y GSFDPITNGH+D+  +A    ++L++AI  G      +   S++ER  + +Q
Sbjct: 1   MTHIALYPGSFDPITNGHIDVACRAARLFDELIVAIYEGDELHDKRALFSVEERRAMAEQ 60

Query: 59  SIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPE 118
           ++    P+    + V ++ GL VN A+ + AQVIVRGLR ++DF+YE ++  +NR + P+
Sbjct: 61  ALAGLAPN----LRVDTYRGLTVNYARSVGAQVIVRGLRAVSDFEYEFKLAHMNRHMAPD 116

Query: 119 IATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           +  + L       +V+S+LI+ + S+  ++   VPD V   L     ++V+
Sbjct: 117 VDVVCLMTSSQHSFVSSSLIKQVASLGGNVQGLVPDHVAEALARKFGAVVR 167


>gi|237749583|ref|ZP_04580063.1| phosphopantetheine adenylyltransferase [Oxalobacter formigenes
           OXCC13]
 gi|229380945|gb|EEO31036.1| phosphopantetheine adenylyltransferase [Oxalobacter formigenes
           OXCC13]
          Length = 162

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/163 (34%), Positives = 100/163 (61%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A    ++L++ +  + VK K F S++ER ++ K+ + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASGLFDELIVGVADSRVK-KPFFSMEERMQIAKEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V SF GL  +  +  +A VI+RGLR ++DF+YE +M  +NR L PE  T+ +
Sbjct: 62  PN----VRVESFTGLLKDFVRVHNASVIIRGLRAVSDFEYEFQMAGMNRYLMPEAETLFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              +  ++++ T++R +  +  D++ FV   V  +LK  VI +
Sbjct: 118 TPSDQYQFISGTIVREIAFLGGDVSKFVFPSVEKWLKKKVIEM 160


>gi|78184686|ref|YP_377121.1| phosphopantetheine adenylyltransferase [Synechococcus sp. CC9902]
 gi|123581512|sp|Q3AXV0|COAD_SYNS9 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|78168980|gb|ABB26077.1| Phosphopantetheine adenylyltransferase [Synechococcus sp. CC9902]
          Length = 163

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 93/160 (58%), Gaps = 6/160 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           +A+Y GSFDP+TNGHMD+I +A     D+++A+  N  K   F S++ER   I+ S  H 
Sbjct: 2   RALYPGSFDPLTNGHMDLIERAAVLFGDVIVAVLGNPSKKPAF-SVEERIRQIRSSTAHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                  V V+SF+GL VN AK+ SA +I+RGLR M+DF+YE+++   NR L   + T+ 
Sbjct: 61  -----QGVEVVSFDGLTVNCAKEHSADLILRGLRAMSDFEYELQLAHTNRSLDDTLETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           +       +++S++++ +      I   VP  V + L  +
Sbjct: 116 MATSTQHSFLSSSVVKEVARFGGAIDHMVPKEVALDLNRL 155


>gi|327469053|gb|EGF14525.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           SK330]
          Length = 164

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 96/160 (60%), Gaps = 7/160 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+T GH+D+I +A    + L + I  N  K+ GF +I+ R  ++K+++ H  
Sbjct: 6   GLFTGSFDPMTKGHVDLIERASRLFDKLYVGIFYNREKS-GFFTIEARERMVKEALQHL- 63

Query: 65  PDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V VI+ +  LAV +A+ + A+V VRGLR+  D DYE  M   N+ L  EI TI 
Sbjct: 64  ----DNVEVITSQNELAVTVARRLGAKVFVRGLRNSQDLDYEANMNFFNQELAGEIETIF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L +K   ++++S+ IR LI+   DI ++VP  V   L+ I
Sbjct: 120 LLSKPDYQHISSSRIRELIAFQQDIAAYVPQSVIKELERI 159


>gi|309798982|ref|ZP_07693239.1| pantetheine-phosphate adenylyltransferase [Streptococcus infantis
           SK1302]
 gi|308117386|gb|EFO54805.1| pantetheine-phosphate adenylyltransferase [Streptococcus infantis
           SK1302]
          Length = 162

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 94/159 (59%), Gaps = 7/159 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+TNGHMD+I +A    + L + I  N  KT GFL I+ R + +++++ H  
Sbjct: 6   GLFTGSFDPMTNGHMDLIERASKLFDQLYVGIFYNPHKT-GFLPIESRKKTVEKAVAHL- 63

Query: 65  PDSSNRVSVI-SFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               N V VI S + L V++A+ + A+++VRGLR+ TD  YE      N  L  E+ TI 
Sbjct: 64  ----NNVKVIASHDELVVDVARRLGAEILVRGLRNATDLQYEASFDFYNHKLAGEMETIY 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           L ++    +++S+ +R L+    DI+ +VP+ V   L N
Sbjct: 120 LHSRPEHVHISSSAVRELLKFGQDISEYVPNAVLEELNN 158


>gi|163858289|ref|YP_001632587.1| phosphopantetheine adenylyltransferase [Bordetella petrii DSM
           12804]
 gi|229488120|sp|A9I6L9|COAD_BORPD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|163262017|emb|CAP44319.1| pantetheine-phosphate adenylyltransferase [Bordetella petrii]
          Length = 170

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 97/157 (61%), Gaps = 6/157 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A +  + +V+ I  +S   K F SI ER E+ ++ + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRAAALFDKVVVGI-AHSRNKKPFFSIDERVEIAREVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V SF GL  +  ++ + +VIVRGLR ++DF+YE +M  +NR L PE+ T+ +
Sbjct: 62  PN----VEVRSFAGLLKDFVREQNGRVIVRGLRAVSDFEYEFQMAGMNRHLLPEVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
              +  ++++ T++R +  +  D++ FV   V  +L+
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLQ 154


>gi|307728377|ref|YP_003905601.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp.
           CCGE1003]
 gi|323524667|ref|YP_004226820.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp.
           CCGE1001]
 gi|307582912|gb|ADN56310.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp.
           CCGE1003]
 gi|323381669|gb|ADX53760.1| pantetheine-phosphate adenylyltransferase [Burkholderia sp.
           CCGE1001]
          Length = 171

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 102/163 (62%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F +++ER ++  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRNKKPFFTLKERLDIAHEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+SF+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VQVMSFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              +  ++++ T++R +  +  D++ FV   V  +LK  V +L
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLKEKVAAL 160


>gi|152994584|ref|YP_001339419.1| pantetheine-phosphate adenylyltransferase [Marinomonas sp. MWYL1]
 gi|150835508|gb|ABR69484.1| pantetheine-phosphate adenylyltransferase [Marinomonas sp. MWYL1]
          Length = 164

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 89/148 (60%), Gaps = 6/148 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDPITNGH D++ +A    E +++A+   S K +  LS + R  L K+ + H  
Sbjct: 8   AVYPGTFDPITNGHTDLVERASKLFEKVIVAVAA-SPKKRPALSHELRISLAKEVLGHL- 65

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                 V V+ F+ L     + +S +V++RGLR ++DF+YE ++ ++NR + P++ +I L
Sbjct: 66  ----TNVEVVGFDNLLTEFTRSVSGKVVIRGLRAVSDFEYEFQLANMNRAIAPDVESIFL 121

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFV 152
              E   Y++STL+R + S++ D   FV
Sbjct: 122 TPSEKHSYISSTLVREIASLNGDFGQFV 149


>gi|90415301|ref|ZP_01223235.1| phosphopantetheine adenylyltransferase [marine gamma
           proteobacterium HTCC2207]
 gi|90332624|gb|EAS47794.1| phosphopantetheine adenylyltransferase [marine gamma
           proteobacterium HTCC2207]
          Length = 160

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 93/152 (61%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M   VY G+FDPITNGH+D++ +A    + ++I I  +  K   F S+ ER +L   ++ 
Sbjct: 1   MTTIVYPGTFDPITNGHIDLVERASRMFDKIIIGIATSQRKGPLF-SVDERIQLATDALA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    + ++ F+ L VN  +D  A  I+RGLR ++DF+YE ++ ++NR L P I +
Sbjct: 60  H-VPN----IEILGFDYLLVNFVQDCKADAIMRGLRAVSDFEYEFQLANMNRALSPNIES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + L   E   Y++S+L+R + S+D D++ F P
Sbjct: 115 VFLTPAEHLSYISSSLVREISSLDGDVSKFAP 146


>gi|170691509|ref|ZP_02882674.1| pantetheine-phosphate adenylyltransferase [Burkholderia graminis
           C4D1M]
 gi|170143714|gb|EDT11877.1| pantetheine-phosphate adenylyltransferase [Burkholderia graminis
           C4D1M]
          Length = 171

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 102/163 (62%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F +++ER ++  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRNKKPFFTLKERLDIAHEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+SF+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VQVMSFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              +  ++++ T++R +  +  D++ FV   V  +LK  V +L
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLKEKVAAL 160


>gi|150024749|ref|YP_001295575.1| pantetheine-phosphate adenylyltransferase [Flavobacterium
           psychrophilum JIP02/86]
 gi|189082570|sp|A6GXD6|COAD_FLAPJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|149771290|emb|CAL42759.1| Pantetheine-phosphate adenylyltransferase [Flavobacterium
           psychrophilum JIP02/86]
          Length = 151

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 100/157 (63%), Gaps = 7/157 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKA++ GSFDP+T GH DII +++   ++++IAIG N+ K K   S+++R   IK++  
Sbjct: 1   MRKAIFPGSFDPLTLGHSDIIKRSIPLFDEIIIAIGVNAEK-KYMFSLEDRKRFIKET-- 57

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F  + S  VSVIS+EGL ++L K + A  I+RGLR+  DF++E  +   NR L  +I T
Sbjct: 58  -FKDEPS--VSVISYEGLTIDLCKKLGADFILRGLRNPADFEFEKAIAHTNRRLS-KIET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           I L    S+ +++S+++R +I    D +  VP+ V V
Sbjct: 114 IFLLTAASTSFISSSIVRDVIRNGGDYSVLVPEAVRV 150


>gi|325981157|ref|YP_004293559.1| pantetheine-phosphate adenylyltransferase [Nitrosomonas sp. AL212]
 gi|325530676|gb|ADZ25397.1| pantetheine-phosphate adenylyltransferase [Nitrosomonas sp. AL212]
          Length = 159

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 96/151 (63%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA+Y G+FDPIT GH D++ +A    + +V+AI  +S K K F +++ER E+ ++   
Sbjct: 1   MDKAIYPGTFDPITRGHEDLVRRASRLFDQIVVAIAVSSSK-KPFFTLEERVEMARE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             + D SN V V++F GL +N  +   +++IVRGLR  +DF+YE +M  +NR L P++ T
Sbjct: 57  -VLSDCSN-VKVMAFSGLLMNFLQQQRSRIIVRGLRAASDFEYEFQMAGMNRGLYPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + +   E   +V++T++R + S+  +  +FV
Sbjct: 115 LFMTPSEQYMFVSATIVREIASLGGNADTFV 145


>gi|251791514|ref|YP_003006235.1| phosphopantetheine adenylyltransferase [Dickeya zeae Ech1591]
 gi|247540135|gb|ACT08756.1| pantetheine-phosphate adenylyltransferase [Dickeya zeae Ech1591]
          Length = 159

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 96/162 (59%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDP+TNGH+D++ +A    + L++AI  +  K   F +++ER  L K++ 
Sbjct: 1   MKTRAIYPGTFDPLTNGHLDLLTRATRMFDHLILAIAASPGKNTLF-TLEERVALAKEAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V+ F  L    A+   A ++VRGLR ++DF+YE+++  +N  L P + 
Sbjct: 60  RH-LPN----VEVVGFTELMATFARQQQATILVRGLRAVSDFEYELQLAKMNHHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           ++ L   E   +++S+L++ +     D++ F+P P+   L+ 
Sbjct: 115 SVFLMPSEQWSFISSSLVKEVARHGGDVSHFLPPPISAALQK 156


>gi|293607599|ref|ZP_06689933.1| pantetheine-phosphate adenylyltransferase [Achromobacter piechaudii
           ATCC 43553]
 gi|292814032|gb|EFF73179.1| pantetheine-phosphate adenylyltransferase [Achromobacter piechaudii
           ATCC 43553]
          Length = 167

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 96/158 (60%), Gaps = 6/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A +  + +V+ I  +S   K F SI ER E+ ++ + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRAATLFDKVVVGI-AHSRNKKPFFSIDERVEIAREVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V SF GL  +  +D   +VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VEVQSFGGLLKDFVRDQGGRVIVRGLRAVSDFEYEFQMAGMNRHLLPDVETLFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
              +  ++++ T++R +  +  D++ FV   V  +L+ 
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLQE 155


>gi|119468499|ref|ZP_01611590.1| Phosphopantetheine adenylyltransferase (PPAT) (Dephospho-CoA
           pyrophosphorylase) [Alteromonadales bacterium TW-7]
 gi|119448007|gb|EAW29272.1| Phosphopantetheine adenylyltransferase (PPAT) (Dephospho-CoA
           pyrophosphorylase) [Alteromonadales bacterium TW-7]
          Length = 163

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/154 (35%), Positives = 96/154 (62%), Gaps = 7/154 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y G+FDP+TNGH D+I +A    + +++A+  N  K   F +++ER  L    + H  
Sbjct: 5   AIYPGTFDPLTNGHTDLIQRAAKMFDTVLVAVANNPSKQPCF-NLEERVALANTILSHL- 62

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
               + V VI F GL  +LA+D +A V++RG+R ++DFDYE ++ ++NR L P++ ++ L
Sbjct: 63  ----DNVKVIGFSGLLADLARDHNAHVLIRGIRAVSDFDYEFQLANMNRRLNPDLESVFL 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
              E + +++STL++ +     D++ FV DP+ V
Sbjct: 119 TPAEKNSFISSTLVKEVARHHGDVSEFV-DPIIV 151


>gi|257791108|ref|YP_003181714.1| pantetheine-phosphate adenylyltransferase [Eggerthella lenta DSM
           2243]
 gi|317488166|ref|ZP_07946739.1| pantetheine-phosphate adenylyltransferase [Eggerthella sp.
           1_3_56FAA]
 gi|325830814|ref|ZP_08164198.1| pantetheine-phosphate adenylyltransferase [Eggerthella sp. HGA1]
 gi|257475005|gb|ACV55325.1| pantetheine-phosphate adenylyltransferase [Eggerthella lenta DSM
           2243]
 gi|316912737|gb|EFV34273.1| pantetheine-phosphate adenylyltransferase [Eggerthella sp.
           1_3_56FAA]
 gi|325487221|gb|EGC89664.1| pantetheine-phosphate adenylyltransferase [Eggerthella sp. HGA1]
          Length = 160

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 104/157 (66%), Gaps = 8/157 (5%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++A+  G+FDPIT+GH+D+I +A   V+++V+A+   S K K   S++ER+EL++++  
Sbjct: 1   MKRALTPGTFDPITSGHLDVITRAAQLVDEVVVAV-AASPKKKPLFSLEERAELVRRATS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V  F+ L V+LA  + A V+++GLR +TDF+YE +MT++N  L  E+ T
Sbjct: 60  H-LPN----VRVEPFDELLVDLAAKLDATVVIKGLRAITDFEYEFQMTALNYQLNQELET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           + + +     Y++S+++R + S+  D+  FV  P CV
Sbjct: 115 LFIMSPPQYMYLSSSIVREIASLHGDVAQFV--PACV 149


>gi|326389656|ref|ZP_08211222.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325994371|gb|EGD52797.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 159

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 95/161 (59%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH+DII +     + L++A+  N +K K   SI+ER EL+K ++ 
Sbjct: 1   MKTAIYPGSFDPVTYGHIDIIKRGALLFDKLIVAVLLNPIK-KPLFSIEERIELLK-AVT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V +  F+ L V+ AK + A VI+RGLR ++DF+YE +M  +N+ L P I T
Sbjct: 59  KNIPN----VQIDYFDDLLVDYAKKVRAGVIIRGLRMVSDFEYEFQMALINKKLDPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L   E   Y +S+ ++ +       + FVP+ V   LK 
Sbjct: 115 VFLMTNEQYSYFSSSAVKEIAQFRGGFSKFVPEIVAQKLKE 155


>gi|146296797|ref|YP_001180568.1| pantetheine-phosphate adenylyltransferase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|166216531|sp|A4XKE2|COAD_CALS8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|145410373|gb|ABP67377.1| Phosphopantetheine adenylyltransferase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 168

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 95/156 (60%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  VY GSFDP+TNGH+DII +A    + L++A+  N  KT  F  I ER EL+K++  
Sbjct: 1   MKIGVYPGSFDPVTNGHLDIIERASKIFDKLIVAVLVNPNKTPVF-DIDERVELLKETTE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V +F+GL ++  K  +A+VIV+GLR ++DF+YE +M  +N+ L P I T
Sbjct: 60  H-LPN----VEVKAFKGLLIDFMKQENAKVIVKGLRAVSDFEYEFQMALLNKKLEPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I +       Y++S++++ +      I   VP+ + 
Sbjct: 115 IFMMTNSKYSYLSSSMVKEVARFGGCIEDLVPEKIA 150


>gi|37912917|gb|AAR05253.1| predicted phosphopantetheine adenylyltransferase [uncultured marine
           proteobacterium ANT32C12]
          Length = 160

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 98/152 (64%), Gaps = 7/152 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y GSFDPIT GHMDII +     + +++AI  +  K   F S+++R  L  QSI+
Sbjct: 1   MRVGIYPGSFDPITFGHMDIIDRGCGLFDKVIVAIAKSESKNPLF-SVEDRINL-AQSIY 58

Query: 62  HFIPDSSNRVSVISF-EGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +++V V+ F   L V+LA+D +A  I+RGLR ++DF+YE ++ ++NR L P+I 
Sbjct: 59  A----DNDKVEVLGFPRKLTVDLARDHNACAIIRGLRAVSDFEYEFQLATMNRSLAPDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           +I L  KES  YV+S+LI+ +  ++ DI+ FV
Sbjct: 115 SIFLTPKESLIYVSSSLIKEISGLNGDISKFV 146


>gi|77361205|ref|YP_340780.1| phosphopantetheine adenylyltransferase (PPAT) (dephospho-CoA
           pyrophosphorylase) [Pseudoalteromonas haloplanktis
           TAC125]
 gi|123588470|sp|Q3IHU4|COAD_PSEHT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|76876116|emb|CAI87338.1| Phosphopantetheine adenylyltransferase (PPAT) (Dephospho-CoA
           pyrophosphorylase) [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 164

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 95/152 (62%), Gaps = 7/152 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y G+FDP+TNGH D+I +A    + +++AI  N  K   F S+ ER  L    + H  
Sbjct: 5   AIYPGTFDPLTNGHTDLIQRASKMFDTVIVAIAHNPSKQPCF-SLDERVALANTLLTHI- 62

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
               + V VI F GL  +LA+D +A V++RG+R ++DFDYE ++ ++NR L P++ ++ L
Sbjct: 63  ----DNVKVIGFSGLLADLARDHNANVLIRGIRAVSDFDYEFQLANMNRRLNPDLESVFL 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
              E + +++STL++ +   + D++ FV DP+
Sbjct: 119 TPSERNSFISSTLVKEVARHNGDVSEFV-DPI 149


>gi|332037894|gb|EGI74343.1| phosphopantetheine adenylyltransferase [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 163

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 97/154 (62%), Gaps = 7/154 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y G+FDP+TNGH D+I +A    + +++A+  N  K   F +++ER EL    + H  
Sbjct: 5   AIYPGTFDPLTNGHTDLIQRAAKMFDTVLVAVANNPSKKPCF-NLEERVELANSILSHL- 62

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
               + V VI F GL  +LA+  +A V++RG+R ++DFDYE ++ ++NR L P++ ++ L
Sbjct: 63  ----DNVKVIGFSGLLADLARVHNANVLIRGIRAVSDFDYEFQLANMNRRLNPDLESVFL 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
              E + +++STL++ +   + D++ FV DPV V
Sbjct: 119 TPAERNSFISSTLVKEVARHNGDVSEFV-DPVIV 151


>gi|289551062|ref|YP_003471966.1| Phosphopantetheine adenylyltransferase [Staphylococcus lugdunensis
           HKU09-01]
 gi|315658559|ref|ZP_07911431.1| pantetheine-phosphate adenylyltransferase [Staphylococcus
           lugdunensis M23590]
 gi|289180594|gb|ADC87839.1| Phosphopantetheine adenylyltransferase [Staphylococcus lugdunensis
           HKU09-01]
 gi|315496888|gb|EFU85211.1| pantetheine-phosphate adenylyltransferase [Staphylococcus
           lugdunensis M23590]
          Length = 160

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 98/158 (62%), Gaps = 6/158 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KAV  GSFDPIT GH+DII ++    ++L + +  NS K  G  ++ ER ELI++S+ H 
Sbjct: 5   KAVIPGSFDPITYGHLDIIERSAGRFDELHVCVLKNSNKA-GTFTVNERIELIEESVKHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V V  F+GL V+    I A+ I+RGLR ++DF+YE+R+TS+N+ L  ++ T+ 
Sbjct: 64  -----SNVQVHHFDGLLVDFCDQIGAKTIIRGLRAVSDFEYELRLTSMNKKLNSDVETMY 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +    +  +++S++++ +    A+I+ FVP  V   LK
Sbjct: 119 MMTSTNYSFISSSVVKEVAQYKANISDFVPPNVATALK 156


>gi|262198142|ref|YP_003269351.1| pantetheine-phosphate adenylyltransferase [Haliangium ochraceum DSM
           14365]
 gi|262081489|gb|ACY17458.1| pantetheine-phosphate adenylyltransferase [Haliangium ochraceum DSM
           14365]
          Length = 170

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 90/153 (58%), Gaps = 5/153 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+TNGH+DI+ ++L+  + +++A+  N V+ +   S+ ER   I+  +    
Sbjct: 9   AVYPGTFDPVTNGHLDILERSLALFDRVIVALAEN-VRKEPVFSVSERVAFIEGGV---- 63

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
            +   ++S  +F+GL V   K + A+ IVRGLR + DF+YE +   +NR L P + T+  
Sbjct: 64  GEHGGKLSFDAFDGLLVEYCKRVGARFIVRGLRALADFEYEFQFAHMNRRLAPGLDTVFF 123

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
              E + YV+S+L++ +     DIT  VP  V 
Sbjct: 124 MTDERNHYVSSSLVKEVARFGGDITGLVPPQVA 156


>gi|157373256|ref|YP_001471856.1| phosphopantetheine adenylyltransferase [Shewanella sediminis
           HAW-EB3]
 gi|189082591|sp|A8FPF5|COAD_SHESH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|157315630|gb|ABV34728.1| Pantetheine-phosphate adenylyltransferase [Shewanella sediminis
           HAW-EB3]
          Length = 158

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 97/164 (59%), Gaps = 7/164 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDP+TNGH D+I +A    + +VI I  N  K   F +++ER  L++   
Sbjct: 1   MHTRAIYPGTFDPVTNGHADLIERAAKLFKHVVIGIAANPSKKPRF-TLEERVALLQLVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F GL V+ AK+  A V+VRGLR ++DF+YE ++ ++NR L  ++ 
Sbjct: 60  SHL-----DNVEVVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLANMNRRLSSDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV-PDPVCVFLKNI 163
           ++ L   E + +++STL++ +     D++ FV P+     + N+
Sbjct: 115 SVFLTPAEENSFISSTLVKEVAHHGGDVSQFVHPEVAKALMTNV 158


>gi|329850839|ref|ZP_08265684.1| pantetheine-phosphate adenylyltransferase [Asticcacaulis
           biprosthecum C19]
 gi|328841154|gb|EGF90725.1| pantetheine-phosphate adenylyltransferase [Asticcacaulis
           biprosthecum C19]
          Length = 159

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 91/155 (58%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPITNGH DII +A+  V+ LVI +  N+ K   F +++ER E+I +   
Sbjct: 1   MRIGLYPGTFDPITNGHTDIIGRAVKLVDKLVIGVARNTGKGPTF-TLEERVEMIVEQTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H        + V  F  L ++ A++I A VI+RGLR + DF+YE +MT++N+ L  EI T
Sbjct: 60  HL-----GNIEVRPFSSLLMHFAEEIGASVIIRGLRAVADFEYEFQMTAMNQQLNREIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L A    + + S L++ +  +   I  FV + V
Sbjct: 115 VFLMADPRHQAIASRLVKEIAQLGGSIRPFVAESV 149


>gi|260779656|ref|ZP_05888546.1| phosphopantetheine adenylyltransferase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260604465|gb|EEX30769.1| phosphopantetheine adenylyltransferase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 164

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 94/161 (58%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           + + +Y G+FDPITNGH+D+I +A    ++++IA+  +  K   F +++ER    +Q   
Sbjct: 6   LSRVIYPGTFDPITNGHLDLIERAADMFDEVIIAVAASPSKNTMF-TLEERVTFAQQVTQ 64

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + VS   F GL V+ AK  +A V++RGLR   DF+YE  +T++ R L P + +
Sbjct: 65  HL-----DNVSSKGFSGLMVDFAKQENANVLIRGLRTTVDFEYEFGLTNMYRRLMPGLES 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L   E   +++ST++R +     D+T+FVP  V   LKN
Sbjct: 120 VFLTPAEEHAFISSTIVREVAIHGGDVTNFVPKAVAEALKN 160


>gi|59710739|ref|YP_203515.1| phosphopantetheine adenylyltransferase [Vibrio fischeri ES114]
 gi|71648653|sp|Q5E8L9|COAD_VIBF1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|59478840|gb|AAW84627.1| pantetheine-phosphate adenylyltransferase [Vibrio fischeri ES114]
          Length = 162

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 99/166 (59%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  +Y G+FDPITNGH+D+I ++ S  + +++A+  +  K K   ++ ER +L+ Q++
Sbjct: 1   MTKLTLYPGTFDPITNGHLDLIKRSASMFDHIIVAVAASPSK-KTLFTLDERVQLV-QAV 58

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +P+    V V  F GL V+ AK+  A ++VRGLR   DF+YE  +TS+ R L PE+ 
Sbjct: 59  TKDLPN----VYVEGFSGLMVDFAKEKKANLLVRGLRTTMDFEYEFGLTSMYRKLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           ++ L   E   +++ST++R +      + +FVP  V   LKN V S
Sbjct: 115 SVFLTPSEEYAFLSSTIVREVALHGGSVEAFVPSSVNQALKNKVAS 160


>gi|289523241|ref|ZP_06440095.1| pantetheine-phosphate adenylyltransferase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503784|gb|EFD24948.1| pantetheine-phosphate adenylyltransferase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 163

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 94/161 (58%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KAVY GSFDPITNGH+ +  +A +  ++LV+AI  N  K   F +++ER  + ++++ 
Sbjct: 1   MLKAVYPGSFDPITNGHLYVAERAAALFDELVLAILVNPQKKSTF-TVEERKTMAREALS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H     SN V V SFEGL V+  +    +VI+RGLR ++DF+YE +M  +NR L PEI T
Sbjct: 60  HV----SN-VRVKSFEGLLVDFMRQERCRVIIRGLRALSDFEYEFQMALMNRELAPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           I +       Y++S+ ++ +      +   VP  V   L+ 
Sbjct: 115 IFIVTDAQYSYLSSSAVKEVFQFGGSVQGMVPPGVYRRLRE 155


>gi|262369413|ref|ZP_06062741.1| phosphopantetheine adenylyltransferase [Acinetobacter johnsonii
           SH046]
 gi|262315481|gb|EEY96520.1| phosphopantetheine adenylyltransferase [Acinetobacter johnsonii
           SH046]
          Length = 163

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 90/155 (58%), Gaps = 6/155 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER  L K S+ H 
Sbjct: 5   RVIYPGTFDPITNGHIDLVTRASRMFDEVVVAIAIGHHKNPLF-SLEERVSLAKASLSHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V  + F+GL VN  ++  A  ++RGLR ++DF+YE ++ ++NR L      + 
Sbjct: 64  -----DNVEFVGFDGLLVNFFREQKATAVLRGLRAVSDFEYEFQLANMNRQLDSHFEAVF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           L   E   +++STLIR +  +  D+T FVP  V  
Sbjct: 119 LTPSEQYSFISSTLIREIARLKGDVTKFVPQAVVA 153


>gi|85060183|ref|YP_455885.1| phosphopantetheine adenylyltransferase [Sodalis glossinidius str.
           'morsitans']
 gi|123518745|sp|Q2NQU5|COAD_SODGM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|84780703|dbj|BAE75480.1| phosphopantetheine adenylyltransferase [Sodalis glossinidius str.
           'morsitans']
          Length = 160

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 89/157 (56%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +V+AI  +  K +    + ER  L  Q  
Sbjct: 1   MTNKAIYPGTFDPLTNGHLDLVTRAAKMFDVVVLAIAASPSK-RPLFDLNERVALATQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V  F  L  + A+   A +++RG+R MTD DYEM +  +NR L P + 
Sbjct: 60  AH-LPN----VKVTGFSDLMADFARQQQANILIRGVRAMTDVDYEMPLAKMNRHLMPALE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           T+ +   E+  Y++STL++ +     D+  F+P P+ 
Sbjct: 115 TVFMLPAEAWSYISSTLVKEVALHGGDVDHFLPAPIA 151


>gi|93005190|ref|YP_579627.1| coenzyme A biosynthesis protein [Psychrobacter cryohalolentis K5]
 gi|92392868|gb|ABE74143.1| Phosphopantetheine adenylyltransferase [Psychrobacter
           cryohalolentis K5]
          Length = 170

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 95/150 (63%), Gaps = 6/150 (4%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K +Y G+FDPITNGH+D++ +A    +++VIA+     K K   + +ER  L+ +++F  
Sbjct: 13  KILYPGTFDPITNGHVDLVTRATKLFDEVVIAVASGHHK-KPLFNFEERVALV-ETVFVD 70

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           +P    +VSVI FEGL V+  ++ +A  ++RGLR M+DF+YE ++ ++NR L      + 
Sbjct: 71  LP----QVSVIGFEGLLVDFMREKNATAVLRGLRAMSDFEYEFQLANMNRELDENFEAVF 126

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVP 153
           L   ++  +++ST+IR +  +  D+T FVP
Sbjct: 127 LTPSQNYSFISSTMIREIAKLGGDVTKFVP 156


>gi|195977714|ref|YP_002122958.1| phosphopantetheine adenylyltransferase [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|229541061|sp|B4U1S8|COAD_STREM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|195974419|gb|ACG61945.1| phosphopantetheine adenylyltransferase CoaD [Streptococcus equi
           subsp. zooepidemicus MGCS10565]
          Length = 166

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 96/153 (62%), Gaps = 7/153 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            +YTGSFDP+TNGHMD+I +A    E + + I  N+   + F + + R++++++++   +
Sbjct: 6   GLYTGSFDPVTNGHMDMIKRASHLFEHVYVGI-FNNPNKQSFFTFELRAQMLREAVC-AL 63

Query: 65  PDSSNRVSVISFE-GLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           P+    V+V+S E GLAV+LA+++S   ++RGLR+  DFDYE  +   N  L P+I TI 
Sbjct: 64  PN----VTVVSAEHGLAVDLARELSVTHLIRGLRNTADFDYEAGLEYFNHRLAPDIETIY 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           L A    + ++S+ IR LI+  A IT  VP  V
Sbjct: 120 LMANHDLQPISSSRIRELIAFRAPITGLVPQAV 152


>gi|257453943|ref|ZP_05619219.1| pantetheine-phosphate adenylyltransferase [Enhydrobacter aerosaccus
           SK60]
 gi|257448608|gb|EEV23575.1| pantetheine-phosphate adenylyltransferase [Enhydrobacter aerosaccus
           SK60]
          Length = 174

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 96/150 (64%), Gaps = 4/150 (2%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K +Y G+FDPIT GH+D+I +A    +++++A+     K K   +++ER  L++++    
Sbjct: 14  KIIYPGTFDPITKGHLDLIKRACRLFDEVIVAVAIGHHK-KPLFTLEERIGLVEKACHD- 71

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
             D SN +SVI F+GL V+LAK+  A  ++RGLR M+DF+YE ++ ++NR L P    + 
Sbjct: 72  -KDLSN-ISVIGFDGLLVDLAKNQQATGVLRGLRAMSDFEYEFQLANLNRELDPNFEAVF 129

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVP 153
           L   +   +++STL+R +  ++ D++ FVP
Sbjct: 130 LTPSQQYSFISSTLVREIGKLEGDVSKFVP 159


>gi|160879470|ref|YP_001558438.1| pantetheine-phosphate adenylyltransferase [Clostridium
           phytofermentans ISDg]
 gi|189082563|sp|A9KNU8|COAD_CLOPH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|160428136|gb|ABX41699.1| pantetheine-phosphate adenylyltransferase [Clostridium
           phytofermentans ISDg]
          Length = 163

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 99/155 (63%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y GSFDP+T GH+D+I ++   +++LVI +  NS KT  F +++ER +L+ + + 
Sbjct: 1   MKIGIYPGSFDPVTLGHLDVIRRSAKIMDELVIGVLANSSKTPLF-TVEERVKLL-ECVV 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V V++F+GL V+ AK + A+ ++RGLR +TDF+YE+++   N  L  EI T
Sbjct: 59  KDIPN----VKVVAFDGLTVDFAKKLGAKFLIRGLRAITDFEYELQIAQTNHKLDEEIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           +         Y++S++++ + S   DI+ FVP+ +
Sbjct: 115 VFFTTSVEYSYLSSSIVKEIASYGGDISKFVPNSI 149


>gi|297588352|ref|ZP_06946995.1| pantetheine-phosphate adenylyltransferase [Finegoldia magna ATCC
           53516]
 gi|297573725|gb|EFH92446.1| pantetheine-phosphate adenylyltransferase [Finegoldia magna ATCC
           53516]
          Length = 164

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 95/153 (62%), Gaps = 6/153 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K +Y GSFDPITNGHMDII ++    E++ +A+  N ++ K   S+++R  +I+++  H 
Sbjct: 7   KVLYPGSFDPITNGHMDIIERSAKIFEEVNVAVVKN-IQKKSTFSLEQRVAMIEKACNHL 65

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V V  FEGL V+ AK I    I+RGLR ++DF+ EM+M+  N+ L  E+ T+ 
Sbjct: 66  -----SNVRVHQFEGLTVDFAKQIGCSTIIRGLRAVSDFESEMQMSLANKKLNNELETLF 120

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           L A     +++S+++R + S  ADI+  VP+ +
Sbjct: 121 LVADGKYAFLSSSIVREIASYGADISELVPENI 153


>gi|70726829|ref|YP_253743.1| phosphopantetheine adenylyltransferase [Staphylococcus haemolyticus
           JCSC1435]
 gi|123659924|sp|Q4L5D8|COAD_STAHJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|68447553|dbj|BAE05137.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 161

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 97/158 (61%), Gaps = 6/158 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KAV  GSFDPIT GH+DII ++    ++L I +  NS KT G  +I ER  LI++S+ H 
Sbjct: 5   KAVIPGSFDPITYGHIDIIERSAGRFDELHICVLKNSNKT-GTFNIDERMALIEESVKHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V V ++ GL V+    I AQ I+RGLR ++DF+YE+R+TS+N+ L   + T+ 
Sbjct: 64  -----SNVEVHNYNGLLVDFCDKIGAQTIIRGLRAVSDFEYELRLTSMNKKLNSNVETMY 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +    +  +++S++++ +    ADI+ FVP  V   LK
Sbjct: 119 MMTSTNYSFISSSVVKEVAQYKADISDFVPPNVEKALK 156


>gi|262282765|ref|ZP_06060533.1| phosphopantetheine adenylyltransferase [Streptococcus sp.
           2_1_36FAA]
 gi|262262056|gb|EEY80754.1| phosphopantetheine adenylyltransferase [Streptococcus sp.
           2_1_36FAA]
          Length = 164

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 61/153 (39%), Positives = 93/153 (60%), Gaps = 7/153 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDPIT GH+D+I +A    + L + I  N  K+ GF  I+ R  ++K+++ H  
Sbjct: 6   GLFTGSFDPITKGHVDLIERASRLFDKLYVGIFYNREKS-GFFIIEARERIVKEALQHL- 63

Query: 65  PDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V VI+ +  LAV +A+ + A+  VRGLR+  D DYE  MT  NR L  E+ TI 
Sbjct: 64  ----DNVEVITSQNELAVIVARRLGAKAFVRGLRNSQDLDYEADMTFFNRELAGELETIF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           L +K + R+++S+ IR LI+   DI ++VP  V
Sbjct: 120 LLSKPAYRHISSSRIRELIAFQQDIAAYVPQSV 152


>gi|283798041|ref|ZP_06347194.1| pantetheine-phosphate adenylyltransferase [Clostridium sp. M62/1]
 gi|291074343|gb|EFE11707.1| pantetheine-phosphate adenylyltransferase [Clostridium sp. M62/1]
 gi|295091820|emb|CBK77927.1| pantetheine-phosphate adenylyltransferase, bacterial [Clostridium
           cf. saccharolyticum K10]
          Length = 163

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 99/154 (64%), Gaps = 7/154 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH DII ++    + L++ +  NS K+  F S++ER +++K  + 
Sbjct: 1   MKTAIYPGSFDPVTLGHYDIIERSSQIFDRLIVGVLNNSAKSPLF-SVEERVKMLK-DVT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P+    V + SF+GL ++ A++  AQVIVRGLR +TDF+YE++M  +NR + PEI T
Sbjct: 59  KELPN----VEIKSFDGLLIDFARENQAQVIVRGLRAVTDFEYELQMAQMNRVIAPEIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDP 155
           + L       Y++S++ + +     DI++F+ DP
Sbjct: 115 LFLTTNLKYAYLSSSIAKEVAMYGGDISAFL-DP 147


>gi|292492245|ref|YP_003527684.1| pantetheine-phosphate adenylyltransferase [Nitrosococcus halophilus
           Nc4]
 gi|291580840|gb|ADE15297.1| pantetheine-phosphate adenylyltransferase [Nitrosococcus halophilus
           Nc4]
          Length = 160

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 93/148 (62%), Gaps = 6/148 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDPIT GH D++ +A    E +++A+  + VK   F S++ER  L ++     +
Sbjct: 6   AVYPGTFDPITRGHSDLVARAAPLFERIIVAVAASPVKAPCF-SLEERVSLAEE----VL 60

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
            D  N V V  F+ L  + A+D  A+V++RGLR ++DF+YE ++ S+NR L PE+ T+ L
Sbjct: 61  ADHPN-VEVQGFDSLLADFARDCGARVLLRGLRAVSDFEYEFQLASMNRHLVPEVETLFL 119

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFV 152
              E   +++++L+R + ++  D++ FV
Sbjct: 120 TPAEQYAFISASLVREVAALGGDVSPFV 147


>gi|262376639|ref|ZP_06069867.1| pantetheine-phosphate adenylyltransferase [Acinetobacter lwoffii
           SH145]
 gi|262308349|gb|EEY89484.1| pantetheine-phosphate adenylyltransferase [Acinetobacter lwoffii
           SH145]
          Length = 163

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 91/154 (59%), Gaps = 6/154 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D++ +A    +++V+AI     K   F S++ER  L K+S+ H 
Sbjct: 5   RVIYPGTFDPITNGHIDLVTRAARMFDEVVVAIAIGHHKNPVF-SLEERVALAKESLSHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V  + F+GL VN  ++  A  ++RGLR ++DF+YE ++ ++NR L      + 
Sbjct: 64  -----DNVEFVGFDGLLVNFFREQKATAVLRGLRAVSDFEYEFQLANMNRQLDSHFEAVF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           L   E   +++STL+R +  +  D+T FVP  V 
Sbjct: 119 LTPSEQYSFISSTLVREIARLRGDVTKFVPPNVV 152


>gi|123968510|ref|YP_001009368.1| phosphopantetheine adenylyltransferase [Prochlorococcus marinus
           str. AS9601]
 gi|166216574|sp|A2BR50|COAD_PROMS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123198620|gb|ABM70261.1| putative pantetheine-phosphate adenylyltransferase [Prochlorococcus
           marinus str. AS9601]
          Length = 157

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 60/158 (37%), Positives = 98/158 (62%), Gaps = 6/158 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K +Y G+FDP+TNGH+D+I +A     +LV+A+  N+ KT  F +++ R   IK S+ H 
Sbjct: 2   KILYPGTFDPLTNGHLDLIERAEKIFGNLVVAVLENTSKTPTF-NLERRIIQIKNSLSH- 59

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           +P+    + VIS+ GL V+ A D+ A +I+RGLR M+DF+YE+++   N+ L  +I TI 
Sbjct: 60  LPN----IEVISYSGLTVDCANDLKANLILRGLRAMSDFEYELQIAHTNKSLNNDIETIF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           L    +  +++S+L++ +     +I   VP PV   LK
Sbjct: 116 LSTNTNYSFLSSSLVKEVAKFGGEINHMVPPPVEKDLK 153


>gi|239636371|ref|ZP_04677373.1| pantetheine-phosphate adenylyltransferase [Staphylococcus warneri
           L37603]
 gi|239597726|gb|EEQ80221.1| pantetheine-phosphate adenylyltransferase [Staphylococcus warneri
           L37603]
          Length = 161

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 58/158 (36%), Positives = 99/158 (62%), Gaps = 6/158 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KAV  GSFDPIT GH+DII ++    +++ + +  NS K  G  +++ER +LI+ S+ H 
Sbjct: 5   KAVIPGSFDPITYGHLDIIERSADRFDEIHVCVLKNSSKG-GTFNLEERMDLIRGSVAHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V V  + GL V+  K + A+ I+RGLR ++DF+YE+R+TS+N+ L  +I T+ 
Sbjct: 64  -----SNVEVHHYNGLLVDFCKQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNSDIETMY 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +    +  +++S++++ + +  ADI+ FVP  V   LK
Sbjct: 119 MMTSTNYSFISSSIVKEVAAYKADISEFVPPNVAKALK 156


>gi|325694148|gb|EGD36066.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           SK150]
          Length = 164

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 95/160 (59%), Gaps = 7/160 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+T GH+D+I +A    + L + I  N  K+ GF +I+ R  ++K+++ H  
Sbjct: 6   GLFTGSFDPMTKGHVDLIERASRLFDKLYVGIFYNREKS-GFFTIEARERMVKEALQHL- 63

Query: 65  PDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V VI+ +  LAV +A+ +  QV VRGLR+  D DYE  M   N  L  E+ TI 
Sbjct: 64  ----DNVEVITSQNELAVTVARRLGTQVFVRGLRNSQDLDYEANMNFFNHELAGELETIF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L +K + ++++S+ IR LI+   DI ++VP  V   L+ I
Sbjct: 120 LLSKPAYQHISSSRIRELIAFQQDIAAYVPQSVIKELERI 159


>gi|119503520|ref|ZP_01625603.1| CheW protein [marine gamma proteobacterium HTCC2080]
 gi|119460582|gb|EAW41674.1| CheW protein [marine gamma proteobacterium HTCC2080]
          Length = 161

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 94/157 (59%), Gaps = 6/157 (3%)

Query: 6   VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIP 65
           VY G+FDPIT GH+D++ +A    + +V+AI   S K +    ++ER+ L ++++ H   
Sbjct: 7   VYPGTFDPITKGHIDLVERAARLFDRVVVAI-AQSEKKEPLFDLEERTTLTREALSHV-- 63

Query: 66  DSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALF 125
              N + V SF GL  +L  +  +  ++RGLR + DF+YE ++ ++NR L P+  ++ L 
Sbjct: 64  ---NNLEVCSFTGLLTDLVTEQGSNCVLRGLRAVADFEYEYQLANMNRALKPDFESVFLT 120

Query: 126 AKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
             E+  Y++S+L+R + S+  DIT FV   V   LKN
Sbjct: 121 PSENLAYISSSLVREIASMGGDITPFVATNVAEALKN 157


>gi|322375838|ref|ZP_08050349.1| pantetheine-phosphate adenylyltransferase [Streptococcus sp. C300]
 gi|321279106|gb|EFX56148.1| pantetheine-phosphate adenylyltransferase [Streptococcus sp. C300]
          Length = 162

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 94/159 (59%), Gaps = 7/159 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+TNGH+DII +A    + L + +  N  K +GFL ++ R   +++++ H  
Sbjct: 6   GLFTGSFDPMTNGHLDIIERASKLFDKLYVGVFYNPHK-QGFLPVENRKRAVEKAVAHL- 63

Query: 65  PDSSNRVSVI-SFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V V+ S + L V++AK + A+ +VRGLR+ TD  YE      N  L PEI TI 
Sbjct: 64  ----DNVEVLASHDQLVVDVAKRLGAKTLVRGLRNTTDLQYESSFDYYNHQLAPEIETIY 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           L+++    Y++S+ +R L+    +I  +VP+ V   L++
Sbjct: 120 LYSRPEHLYISSSAVRELLKFGQEIQQYVPNSVVEELEH 158


>gi|324993432|gb|EGC25352.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           SK405]
 gi|327461706|gb|EGF08037.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           SK1]
 gi|327489559|gb|EGF21352.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           SK1058]
          Length = 164

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 93/160 (58%), Gaps = 7/160 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDPIT GH+D+I +A    + L + I  N  K  GF  I+ R  ++K+++ H  
Sbjct: 6   GLFTGSFDPITKGHVDLIERASRLFDKLYVGIFYNREKY-GFFRIEARERMVKEALQHL- 63

Query: 65  PDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V VI+ +  LAV +A+ + A+  VRGLR+  D DYE  M   N+ L  EI TI 
Sbjct: 64  ----DNVEVITSQNELAVTVARRLGAKAFVRGLRNSQDLDYEANMNFFNQELAGEIETIF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L +K   +Y++S+ IR LI+   DI ++VP  V   L+ I
Sbjct: 120 LLSKPVYQYISSSRIRELIAFQQDIAAYVPQSVIKELERI 159


>gi|257468862|ref|ZP_05632956.1| phosphopantetheine adenylyltransferase [Fusobacterium ulcerans ATCC
           49185]
 gi|317063112|ref|ZP_07927597.1| phosphopantetheine adenylyltransferase [Fusobacterium ulcerans ATCC
           49185]
 gi|313688788|gb|EFS25623.1| phosphopantetheine adenylyltransferase [Fusobacterium ulcerans ATCC
           49185]
          Length = 164

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  VY GSFDPIT GH D+I ++L   + L++A+  NS K KG+ S++ER ++IK    
Sbjct: 1   MKIGVYAGSFDPITKGHYDVIKKSLKITDKLIVAVMNNSNK-KGWFSLEERKDMIKL--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLC-PEIA 120
             + + S+R+ V SF+GL +N  K+  A +I+RGLR ++D++YE+     N  L   EI 
Sbjct: 57  -LVGEDSDRIEVKSFDGLLINFMKENGADIIIRGLRAVSDYEYELGYAFANHDLSYGEIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ + A     Y++S+ +R    + A +  FV D +   +K
Sbjct: 116 TVFIPAAREYMYLSSSSVREAAMVGARLDIFVDDKIAEIVK 156


>gi|257459646|ref|ZP_05624755.1| pantetheine-phosphate adenylyltransferase [Campylobacter gracilis
           RM3268]
 gi|257443071|gb|EEV18205.1| pantetheine-phosphate adenylyltransferase [Campylobacter gracilis
           RM3268]
          Length = 158

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 95/160 (59%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           RK +Y G+FDPITNGH+D+I +AL   +++++A+  N  K K + S+Q R E+ + +   
Sbjct: 5   RKCIYPGTFDPITNGHLDVIKRALGLFDEVIVAVALNESK-KPYFSLQSRLEMARAAT-- 61

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   VSV SF+ L V+ AK    + ++RGLR ++DF+YE+++   N  L  E  ++
Sbjct: 62  ---RGLRGVSVQSFDNLLVDFAKSCGVRFVIRGLRAVSDFEYELQIGYANASLWEEFESV 118

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L     + +++S+++R ++S   D++  VP  +  FLK 
Sbjct: 119 YLMPTLKNAFISSSIVRSVLSHGGDVSHLVPSEILEFLKK 158


>gi|167037712|ref|YP_001665290.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167040373|ref|YP_001663358.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter sp.
           X514]
 gi|256752290|ref|ZP_05493153.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|300914457|ref|ZP_07131773.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter sp.
           X561]
 gi|307724307|ref|YP_003904058.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter sp.
           X513]
 gi|320116127|ref|YP_004186286.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|229541049|sp|B0K9Z1|COAD_THEP3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229541050|sp|B0K1X4|COAD_THEPX RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166854613|gb|ABY93022.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter sp.
           X514]
 gi|166856546|gb|ABY94954.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256748858|gb|EEU61899.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|300889392|gb|EFK84538.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter sp.
           X561]
 gi|307581368|gb|ADN54767.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter sp.
           X513]
 gi|319929218|gb|ADV79903.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
          Length = 159

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 94/156 (60%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH+DII +  +  + L++A+  N  K K   S++ER EL+K   +
Sbjct: 1   MKTAIYPGSFDPVTYGHIDIIERGANLFDKLIVAVLLNPSK-KPLFSVEERVELLKAVTY 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D SN V +  F+GL V+ AK + A  I++GLR ++DF+YE +M  +N+ L P + T
Sbjct: 60  ----DISN-VEIDYFDGLLVDYAKKVKANAIIKGLRMVSDFEYEFQMALINKKLNPSLET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I L       Y++S++++ +      ++ FVPD V 
Sbjct: 115 IFLMTNAKYGYLSSSVVKEIAQFGGCLSEFVPDIVA 150


>gi|326389526|ref|ZP_08211093.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325994531|gb|EGD52956.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 159

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 97/156 (62%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH+DII +  +  + L++A+  N  K K   +++ER EL+K ++ 
Sbjct: 1   MKTAIYPGSFDPVTYGHIDIIKRGANLFDKLIVAVLLNPSK-KPLFTVEERVELLK-AVT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           + IP+    V +  F+GL V+ AK ++A  I++GLR ++DF+YE +M  +N+ L P + T
Sbjct: 59  YDIPN----VEIDYFDGLLVDYAKKVNANAIIKGLRMVSDFEYEFQMALINKKLNPSVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I L       Y++S++++ +      ++ FVPD V 
Sbjct: 115 IFLMTNAKYGYLSSSVVKEIAQFGGCLSEFVPDIVA 150


>gi|271498732|ref|YP_003331757.1| pantetheine-phosphate adenylyltransferase [Dickeya dadantii Ech586]
 gi|270342287|gb|ACZ75052.1| pantetheine-phosphate adenylyltransferase [Dickeya dadantii Ech586]
          Length = 159

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 96/162 (59%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  +A+Y G+FDP+TNGH+D++ +A S  + L++AI  +  K   F +++ER  L K++ 
Sbjct: 1   MKTRAIYPGTFDPMTNGHLDLLTRATSMFDHLILAIASSPSKNTLF-TLEERVALAKEAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V  F  L    A+   A ++VRGLR ++DF+YE+++  +N  L P + 
Sbjct: 60  RH-LPN----VEVEGFTDLMATFARQRKATILVRGLRAVSDFEYELQLAKMNHHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           ++ L   E   +++S+L++ +     D++ F+P P+   L+ 
Sbjct: 115 SVFLMPSEQWSFISSSLVKEVARHGGDVSHFLPPPIAAALQE 156


>gi|227328066|ref|ZP_03832090.1| phosphopantetheine adenylyltransferase [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 159

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 93/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +V+AI  +  K   F ++ ER  L K + 
Sbjct: 1   MTTKAIYPGTFDPLTNGHLDLLTRASRLFDHVVLAIAASPSKHTLF-TLDERVALAKGAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F  L V+ A+  +A ++VRGLR + DF+YE+++  +N  L P + 
Sbjct: 60  QHL-----SNVEVVGFSDLMVHFAQQQNANILVRGLRAVADFEYELQLAKMNHHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E   +++S+L++ +   D D++ F+PD + 
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHDGDVSHFLPDAIV 151


>gi|225870015|ref|YP_002745962.1| phosphopantetheine adenylyltransferase [Streptococcus equi subsp.
           equi 4047]
 gi|254764171|sp|C0MBZ1|COAD_STRE4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|225699419|emb|CAW92897.1| phosphopantetheine adenylyltransferase [Streptococcus equi subsp.
           equi 4047]
          Length = 166

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 61/153 (39%), Positives = 96/153 (62%), Gaps = 7/153 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            +YTGSFDP+TNGHMD+I +A    E + + I  N+   + F + + R++++ +++   +
Sbjct: 6   GLYTGSFDPVTNGHMDMIKRASHLFEHVYVGI-FNNPNKQSFFTFELRAQMLSEAVC-AL 63

Query: 65  PDSSNRVSVISFE-GLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           P+    V+V+S E GLAV+LA+++S   ++RGLR+  DFDYE+ +   N  L P+I TI 
Sbjct: 64  PN----VTVVSAEHGLAVDLARELSVTHLIRGLRNTADFDYEIGLEYFNHRLAPDIETIY 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           L A    + V+S+ IR LI+  A IT  VP  V
Sbjct: 120 LMATHDLQPVSSSRIRELIAFRAPITGLVPQAV 152


>gi|225011530|ref|ZP_03701968.1| pantetheine-phosphate adenylyltransferase [Flavobacteria bacterium
           MS024-2A]
 gi|225004033|gb|EEG42005.1| pantetheine-phosphate adenylyltransferase [Flavobacteria bacterium
           MS024-2A]
          Length = 150

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 94/155 (60%), Gaps = 7/155 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+K V+ GSFDPIT GH+DII +AL   + L+IA+G N  K K   S+Q+R E I ++  
Sbjct: 1   MKKYVFPGSFDPITLGHVDIIERALPLCDSLIIAVGENKDK-KYMFSLQQRIEFIMKTF- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +  ++SV +++GL VN  K++ A  I+RGLR+  DF++E  +  +NR L  EI T
Sbjct: 59  ----SNEPKISVQTYKGLTVNFCKEVEATAILRGLRNPADFEFEKSIAQINRRLT-EIDT 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L       Y++S ++R ++  + D TS VP  V
Sbjct: 114 LFLLTSADHSYISSGIVREIMIHNGDYTSLVPKAV 148


>gi|313901222|ref|ZP_07834710.1| pantetheine-phosphate adenylyltransferase [Clostridium sp. HGF2]
 gi|312954180|gb|EFR35860.1| pantetheine-phosphate adenylyltransferase [Clostridium sp. HGF2]
          Length = 156

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 94/155 (60%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A++ GSFDP+T GH+DII +A    + L++ I  NS K   F S++ER   ++ +  
Sbjct: 1   MKAAIFPGSFDPVTLGHLDIIERASRLFDRLIVVILENSEKHATF-SMEERLTFLRSNTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + V V +  GL V+ A+   A  IVRG+R + D++YE+ + SVN+ + PE+ T
Sbjct: 60  HL-----SNVEVAADHGLTVDFARKQEAVAIVRGVRSVKDYEYELDIASVNQHIAPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L+A     YV+S++IR L+    DI+++VP  V
Sbjct: 115 VLLYASPEFSYVSSSIIRELVKYGQDISAYVPKDV 149


>gi|289422342|ref|ZP_06424192.1| pantetheine-phosphate adenylyltransferase [Peptostreptococcus
           anaerobius 653-L]
 gi|289157287|gb|EFD05902.1| pantetheine-phosphate adenylyltransferase [Peptostreptococcus
           anaerobius 653-L]
          Length = 165

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 93/156 (59%), Gaps = 8/156 (5%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KA++ GSFDP+TNGH+DII +A    ++L I +  N  K   F +I+ER  LIK++  H 
Sbjct: 6   KAIFAGSFDPVTNGHVDIIERASKLFDELKIGVLINPNKNSLF-TIEERMNLIKEATCHI 64

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V +I FEGL ++  K     V+VRG+R   D DYE++M  +N+ LC +I T+ 
Sbjct: 65  -----DNVEIIFFEGLLIDYCKQNDISVLVRGVRSAADVDYELQMAHMNKELCTDIETVI 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVF 159
           L       +V+S+LI+ ++  +A+I + V  P CV 
Sbjct: 120 LPTNTKYSFVSSSLIKEVLHFNAEIKNLV--PACVL 153


>gi|157151694|ref|YP_001449954.1| phosphopantetheine adenylyltransferase [Streptococcus gordonii str.
           Challis substr. CH1]
 gi|189082596|sp|A8AVZ4|COAD_STRGC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|157076488|gb|ABV11171.1| pantetheine-phosphate adenylyltransferase [Streptococcus gordonii
           str. Challis substr. CH1]
          Length = 164

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 59/153 (38%), Positives = 93/153 (60%), Gaps = 7/153 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+T GH+D+I +A    + L + I  N  K+ GF +I+ R  ++K+++ H  
Sbjct: 6   GLFTGSFDPMTKGHVDLIERASRLFDKLYVGIFYNREKS-GFFTIEARERIVKEALQHL- 63

Query: 65  PDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V VI+ +  LAV +A+ + A+  VRGLR+  D DYE  MT  NR L  E+ TI 
Sbjct: 64  ----DNVEVITSQNELAVTVARRLGAKAFVRGLRNSQDLDYEADMTFFNRELAGELETIF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           L +K + ++++S+ IR LI+   DI  +VP  V
Sbjct: 120 LLSKPAYQHISSSRIRELIAFQQDIADYVPQSV 152


>gi|149925753|ref|ZP_01914017.1| phosphopantetheine adenylyltransferase [Limnobacter sp. MED105]
 gi|149825870|gb|EDM85078.1| phosphopantetheine adenylyltransferase [Limnobacter sp. MED105]
          Length = 167

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 93/151 (61%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR AVY G+FDP+T GH D++ +     + LV+ +  +S   K F S+ ER ++ ++ + 
Sbjct: 1   MRIAVYPGTFDPLTRGHEDLVRRGAKIFDKLVVGV-ADSPNKKPFFSMDERVQIAREVLS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+ P+    V V  F GL  +  ++ +A VI+RGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HY-PN----VEVKGFRGLLKDFVRENNANVIIRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   +  ++++ T++R + S+  D++ FV
Sbjct: 115 MFLTPSDQYQFISGTIVREIASLGGDVSKFV 145


>gi|329890201|ref|ZP_08268544.1| pantetheine-phosphate adenylyltransferase [Brevundimonas diminuta
           ATCC 11568]
 gi|328845502|gb|EGF95066.1| pantetheine-phosphate adenylyltransferase [Brevundimonas diminuta
           ATCC 11568]
          Length = 161

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 92/156 (58%), Gaps = 5/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+TNGH+DII +A+  V+ LVI +  N  K   F S  ER E++K  + 
Sbjct: 1   MRIGLYPGTFDPVTNGHLDIIGRAVKLVDRLVIGVAKNDDKGPLF-STAERVEMLKAEVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F  D    + V  F  L ++ A+++ A VI+RGLR + DF+YE +MT++N+ L  +I T
Sbjct: 60  RFNAD----IEVRPFSSLLMHFAEELDASVIIRGLRAVADFEYEFQMTAMNQRLNSDIET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + L A    + + S L++ +  +D  I SFV   V 
Sbjct: 116 VFLMADPRHQAIASRLVKEIARLDGRIDSFVSPAVA 151


>gi|259419032|ref|ZP_05742949.1| pantetheine-phosphate adenylyltransferase [Silicibacter sp.
           TrichCH4B]
 gi|259345254|gb|EEW57108.1| pantetheine-phosphate adenylyltransferase [Silicibacter sp.
           TrichCH4B]
          Length = 165

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 87/151 (57%), Gaps = 1/151 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A   V+ LVI +  N  K   F  ++ER  +I+    
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRAAMLVDRLVIGVAINRDKGPLF-DLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ A+D+ AQVIVRGLR + DF+YE +M  +NR L   I T
Sbjct: 60  KLTEQTGTEIIAHPFENLLIDCARDVGAQVIVRGLRAVADFEYEFQMVGMNRALDDSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L A+   + + S L++ +  +D D++ FV
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLDGDVSKFV 150


>gi|54307429|ref|YP_128449.1| phosphopantetheine adenylyltransferase [Photobacterium profundum
           SS9]
 gi|46911849|emb|CAG18647.1| putative Phosphopantetheine adenylyltransferase
           (Pantetheine-phosphateadenylyltransferase) (PPAT)
           (Dephospho-CoApyrophosphorylase) [Photobacterium
           profundum SS9]
          Length = 163

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 95/152 (62%), Gaps = 6/152 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D+I +A +  + +V+ I  +  K K    + ER  L  Q+I
Sbjct: 3   MTTRVIYPGTFDPITNGHLDLIERAAAMFDHVVVGIAASPSK-KPLFDLPERVALT-QAI 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +P+    V ++ F GL V+ AK+ +A ++VRGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 61  TKHLPN----VEIVGFSGLLVDFAKESNANILVRGLRAVSDFEYEFQLANMNRRLMPELE 116

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           T+ L   E + +++ST+++ +     D++ FV
Sbjct: 117 TVFLTPSEENSFISSTIVKEVALHKGDVSQFV 148


>gi|15895015|ref|NP_348364.1| phosphopantetheine adenylyltransferase [Clostridium acetobutylicum
           ATCC 824]
 gi|29427954|sp|Q97IB2|COAD_CLOAB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|15024706|gb|AAK79704.1|AE007683_3 Phosphopantetheine adenylyltransferase [Clostridium acetobutylicum
           ATCC 824]
 gi|325509152|gb|ADZ20788.1| Phosphopantetheine adenylyltransferase [Clostridium acetobutylicum
           EA 2018]
          Length = 161

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 60/155 (38%), Positives = 92/155 (59%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDPITNGH+DII +A    + +++ +  N  K KG  S+ ER +LIK+ I 
Sbjct: 1   MKVAVYPGSFDPITNGHLDIISRASKVFDKVIVGVLINPEK-KGMFSVDERVDLIKRVIK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F     N VSV SF GL VN  ++  + V++RGLR + DF+YE++ + +N+ L P + T
Sbjct: 60  PF-----NNVSVQSFSGLLVNFMENNDSNVMIRGLRSVGDFEYELQTSLMNKKLNPNVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + +       +++ST I+ +      I   VPD +
Sbjct: 115 VFMMTSLEFSFLSSTAIKQVAVFGGCIKELVPDEI 149


>gi|330957093|gb|EGH57353.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 159

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 93/151 (61%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+   S K      +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDQVVIAVAA-SPKKNPLFPLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  H-LPN----VEVVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++D DIT FV
Sbjct: 115 LFLTPSERYSFISSTLVREIAALDGDITKFV 145


>gi|285018710|ref|YP_003376421.1| phosphopantetheine adenylyltransferase (pantetheine-phosphate
           adenylyltransferase) (ppat) (dephospho-CoA
           pyrophosphorylase) protein [Xanthomonas albilineans GPE
           PC73]
 gi|76150322|emb|CAJ01857.1| hypothetical protein [Xanthomonas albilineans]
 gi|283473928|emb|CBA16429.1| putative phosphopantetheine adenylyltransferase
           (pantetheine-phosphate adenylyltransferase) (ppat)
           (dephospho-coa pyrophosphorylase) protein [Xanthomonas
           albilineans]
          Length = 168

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 91/155 (58%), Gaps = 6/155 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +V+ +  +  K    LS++ R  L ++++  
Sbjct: 7   RIAVYPGTFDPITNGHIDLVNRAAPLFEQVVVGVAQSPSKGP-TLSLELRVALAREAL-- 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V VI F+ L  +  + +   V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 64  ---AGHRNVEVIGFDTLLAHFVRSVGGGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
            L   E   +++S+L+R +  +  D++ FVP  V 
Sbjct: 121 FLTPAEQHSFISSSLVREIARLGGDVSGFVPPSVL 155


>gi|327482698|gb|AEA86008.1| phosphopantetheine adenylyltransferase [Pseudomonas stutzeri DSM
           4166]
          Length = 160

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 96/160 (60%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    ++++IA+  N  K   F  +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITMGHADLVERASRLFDEVIIAVAANPKKNPLF-PLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V VI F  L  +  K+  A +++RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  H-LPN----VKVIGFSTLLAHFVKEQQANILLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L   E   Y++STL+R + S+  D++ FV   V   LK
Sbjct: 115 LFLTPSEKYSYISSTLVREIASLQGDVSKFVHPAVMQALK 154


>gi|21672821|ref|NP_660888.1| phosphopantetheine adenylyltransferase [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|8469203|sp|Q9Z613|COAD_BUCAP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|4378709|gb|AAD19637.1| putative lipopolysaccharide biosynthesis enzyme [Buchnera
           aphidicola]
 gi|21623473|gb|AAM68099.1| phosphopantetheine adenylyltransferase [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 165

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 95/156 (60%), Gaps = 5/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y G+FDPIT GH+D+I +A    ++++IAI  N+V  K   +++ER +L K + 
Sbjct: 1   MKKIAIYPGTFDPITYGHLDVITRATKIFDNIIIAI-SNNVHKKTIFNLKERIKLTKLAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
           FH      N   VI F GL  NLAK   + +++RG+R + DFDYE+++ ++N+ + P++ 
Sbjct: 60  FHL----KNIKKVIGFNGLLANLAKREKSNILIRGVRTIFDFDYEIKLAAINKQIYPDLD 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           +I   + +   +++S+ ++ +     +I  ++P  +
Sbjct: 116 SIFFLSSKEVSFISSSFVKEIAKYQGNIKPYLPKEI 151


>gi|329296442|ref|ZP_08253778.1| pantetheine-phosphate adenylyltransferase [Plautia stali symbiont]
          Length = 161

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 93/153 (60%), Gaps = 6/153 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+T GH+DI+ +A    + +V+AI  +  K K   S+ ER +L +Q  
Sbjct: 1   MSTKAIYPGTFDPMTLGHLDIVTRAAQMFDRIVLAIAASPSK-KPLFSLDERVDLARQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V+ F  L  N A+  +A V+VRGLR ++DF+YE+++  +NR L P + 
Sbjct: 60  AH-LPN----VEVVGFSDLMANFAQAQNANVLVRGLRAVSDFEYELQLAHINRHLLPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           ++ L   E   +V+S+L++ +     D+ +F+P
Sbjct: 115 SVFLMPSEGFSFVSSSLVKEVARHQGDVQAFLP 147


>gi|311108736|ref|YP_003981589.1| pantetheine-phosphate adenylyltransferase [Achromobacter
           xylosoxidans A8]
 gi|310763425|gb|ADP18874.1| pantetheine-phosphate adenylyltransferase [Achromobacter
           xylosoxidans A8]
          Length = 167

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 96/158 (60%), Gaps = 6/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A +  + +V+ I  +  K K F SI ER E+ ++ + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRAATLFDKVVVGIAISRNK-KPFFSIDERVEIAREVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V SF GL  +  +D   +VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VEVQSFGGLLKDFVRDQGGRVIVRGLRAVSDFEYEFQMAGMNRHLLPDVETLFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
              +  ++++ T++R +  +  D++ FV   V  +L+ 
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLQE 155


>gi|90414928|ref|ZP_01222892.1| phosphopantetheine adenylyltransferase [Photobacterium profundum
           3TCK]
 gi|61212602|sp|Q6LVM8|COAD_PHOPR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|90323984|gb|EAS40580.1| phosphopantetheine adenylyltransferase [Photobacterium profundum
           3TCK]
          Length = 161

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 95/152 (62%), Gaps = 6/152 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D+I +A +  + +V+ I  +  K K    + ER  L  Q+I
Sbjct: 1   MTTRVIYPGTFDPITNGHLDLIERAAAMFDHVVVGIAASPSK-KPLFDLPERVALT-QAI 58

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +P+    V ++ F GL V+ AK+ +A ++VRGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 59  TKHLPN----VEIVGFSGLLVDFAKESNANILVRGLRAVSDFEYEFQLANMNRRLMPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           T+ L   E + +++ST+++ +     D++ FV
Sbjct: 115 TVFLTPSEENSFISSTIVKEVALHKGDVSQFV 146


>gi|149193823|ref|ZP_01870921.1| phosphopantetheine adenylyltransferase [Caminibacter mediatlanticus
           TB-2]
 gi|149135776|gb|EDM24254.1| phosphopantetheine adenylyltransferase [Caminibacter mediatlanticus
           TB-2]
          Length = 159

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 100/156 (64%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+DII +A    +++++A+  N  K   F S+++R +++K++ 
Sbjct: 1   MYNKAIYPGTFDPVTNGHLDIIKRACKIFDEIIVAVADNKDKNTMF-SLEKRVKMMKKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            + +P    ++ V SF  L V  A+  +A++I+RGLR ++DF+YE++M   N+ L  EI 
Sbjct: 60  EN-LP----KIKVKSFNSLLVEFARKENAKIIIRGLRAVSDFEYELQMGYANKSLDEEID 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           TI L     + +++S+++R ++  + D++  VP  +
Sbjct: 115 TIYLMPNLQNAFISSSVVRSILKYNGDVSHLVPKEI 150


>gi|82703847|ref|YP_413413.1| coenzyme A biosynthesis protein [Nitrosospira multiformis ATCC
           25196]
 gi|123543782|sp|Q2Y5F0|COAD_NITMU RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|82411912|gb|ABB76021.1| Phosphopantetheine adenylyltransferase [Nitrosospira multiformis
           ATCC 25196]
          Length = 165

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 92/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA+Y G+FDPIT GH D++ +A     ++V+A+  +S K K F + +ER  +++Q   
Sbjct: 1   MDKAIYPGTFDPITRGHEDLVRRASGLFREVVVAVAASSGK-KPFFTQEERVAMVRQ--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             + D  N V V+ F GL +  A+   A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 57  -VLTDYPN-VKVMPFSGLLMEFAQQQQARVIVRGLRAVSDFEYEFQMAGMNRTLYPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   ++++T++R +     +I  FV
Sbjct: 115 LFLTPSEQYMFISATIVREIALFGGNIEKFV 145


>gi|159897269|ref|YP_001543516.1| phosphopantetheine adenylyltransferase [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|229500846|sp|A9AWY7|COAD_HERA2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|159890308|gb|ABX03388.1| pantetheine-phosphate adenylyltransferase [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 165

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 95/161 (59%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY  SFDPITNGH+D+  +A    ++LV+A+     K K   + ++R  +I++S+ 
Sbjct: 1   MTIAVYPASFDPITNGHLDVAARASRLFDELVLAVAHRPYK-KLLFTTEQRIAMIRESVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V +F  L V  A +I A V+VRGLR  TDF++E +M  +N  L P + T
Sbjct: 60  H-LPN----VRVDAFSSLVVEYALEIGATVLVRGLRAATDFEHEFQMAHINHHLAPTLDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L A +    ++S+ +R + +   D++SFVP  + + LK 
Sbjct: 115 VCLMADQRFTLLSSSAVREIAAYGGDVSSFVPAHIALALKQ 155


>gi|330998994|ref|ZP_08322719.1| pantetheine-phosphate adenylyltransferase [Parasutterella
           excrementihominis YIT 11859]
 gi|329575736|gb|EGG57262.1| pantetheine-phosphate adenylyltransferase [Parasutterella
           excrementihominis YIT 11859]
          Length = 165

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 55/163 (33%), Positives = 95/163 (58%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A Y G+FDP+TNGH+D+I +A      L++A+   S +     +++ER ++ K+++  F 
Sbjct: 4   ATYPGTFDPLTNGHLDLIRRACWIFPKLIVAV-AESKRKHTLFTLEERVQMAKEAVKGF- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+ FEGL V+  +   +  IVRG R ++DF+YE +M  +N+ L PE+ TI L
Sbjct: 62  PN----VEVVGFEGLLVDFVRRHGSTCIVRGARAVSDFEYEFQMAGMNQKLMPEVETIFL 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              E  ++++ T +R +  +  D++ FVP  +   L+   I L
Sbjct: 118 TPAEQFQFISGTFVREIAMMGGDVSGFVPQNIRAALERKRIEL 160


>gi|110598420|ref|ZP_01386692.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related
           [Chlorobium ferrooxidans DSM 13031]
 gi|110339954|gb|EAT58457.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related
           [Chlorobium ferrooxidans DSM 13031]
          Length = 167

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 53/152 (34%), Positives = 94/152 (61%), Gaps = 5/152 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y G+FDP TNGH+D++ +AL+  E++++ I  N+ K +   +I+ER  +I + +
Sbjct: 1   MQTNAIYPGTFDPFTNGHLDVLERALNIFEEVIVVIAENTQK-QSLFTIEERQAMINEVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             +   +  RV V+  +GL  + A+ + A+ I+RG+R + DF+YE +M+ +NR L PE+ 
Sbjct: 60  GEY---AGVRVEVLR-QGLLADYARQLGAKAIIRGVRQVKDFEYEFQMSLLNRHLYPEVT 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           T+ L       YV S++IR +  +  D++ FV
Sbjct: 116 TVFLMPNVKYTYVASSIIREVSMLGGDVSKFV 147


>gi|229829108|ref|ZP_04455177.1| hypothetical protein GCWU000342_01193 [Shuttleworthia satelles DSM
           14600]
 gi|229792271|gb|EEP28385.1| hypothetical protein GCWU000342_01193 [Shuttleworthia satelles DSM
           14600]
          Length = 162

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 90/152 (59%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDP T GH+DII ++    + L++A+  NS K   F S++ER +++K    
Sbjct: 1   MRTAIYPGSFDPATFGHLDIIERSSKLFDQLIVAVLNNSAKESLF-SVEERVDMLK---- 55

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +      V V SFEGL ++ A+ + A  +VRGLR ++DF+YE+++   N    PEI T
Sbjct: 56  -MLTAGCPNVKVDSFEGLLIDYARRMDAGFLVRGLRAVSDFEYELQIAQTNHVEYPEIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           I L    +  Y++ST++R   S   DI  FVP
Sbjct: 115 IFLTTSLNYSYLSSTIVREFASYGGDIRQFVP 146


>gi|254486094|ref|ZP_05099299.1| pantetheine-phosphate adenylyltransferase [Roseobacter sp. GAI101]
 gi|214042963|gb|EEB83601.1| pantetheine-phosphate adenylyltransferase [Roseobacter sp. GAI101]
          Length = 164

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 87/151 (57%), Gaps = 1/151 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F  + ER  LI     
Sbjct: 1   MRVGLYPGTFDPITLGHLDIIRRATTLVDKLVIGVAINRDKGPLF-ELTERVALITSECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   V V  FE L +N A+D+ AQ+I+RGLR + DF+YE +M  +NR L   I T
Sbjct: 60  KLQEETGVEVVVHPFENLLINCARDVGAQMIIRGLRAVADFEYEYQMVGMNRKLDDSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L A+   + + S L++ +  +  D++ FV
Sbjct: 120 VFLMAEAEHQAIASKLVKEIARLGGDVSKFV 150


>gi|95929551|ref|ZP_01312293.1| Coenzyme A biosynthesis protein [Desulfuromonas acetoxidans DSM
           684]
 gi|95134248|gb|EAT15905.1| Coenzyme A biosynthesis protein [Desulfuromonas acetoxidans DSM
           684]
          Length = 163

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 97/157 (61%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R AVY GSFDPITNGH+DII + L   + +++A+  NS K KG  S++ER ++I+  +
Sbjct: 1   MNRTAVYPGSFDPITNGHLDIIQRGLHAFDTIIVAVAKNSSK-KGLFSVEERVDMIRDVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                  + R+ V + +GL ++      A+VI+RGLR ++DF+YE ++  +N  +  E+ 
Sbjct: 60  -----GDNPRIIVDTIDGLLIDYVMRKGARVILRGLRAVSDFEYEFQLAQMNHTVQKEVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           T+ +       Y++S++++ + S++  I+ FVP+ V 
Sbjct: 115 TMFMMTSVRYGYLSSSIVKEMASLNGPISEFVPEAVL 151


>gi|315225623|ref|ZP_07867432.1| pantetheine-phosphate adenylyltransferase [Capnocytophaga ochracea
           F0287]
 gi|314944440|gb|EFS96480.1| pantetheine-phosphate adenylyltransferase [Capnocytophaga ochracea
           F0287]
          Length = 150

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 97/157 (61%), Gaps = 7/157 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++A++ GSFDPIT GH DII +AL   +++V+AIG NS K   F ++++R E I+++  
Sbjct: 1   MKRALFPGSFDPITLGHYDIIKRALDLFDEIVVAIGINSDKNYMF-TVEQRKEFIEKAF- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                   +V V +++GL V+  K+I AQ I+RGLR+  DF++E  +   NR L  +I T
Sbjct: 59  ----ADEPKVKVTTYQGLTVDFCKEIDAQFILRGLRNPADFEFEKAIAHTNRKLS-QIET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           + L     + +++S+++R +I    D T  VP+ V V
Sbjct: 114 VFLLTAARTSFISSSIVRDVIRNHGDYTVLVPESVRV 150


>gi|315452625|ref|YP_004072895.1| phosphopantetheine adenylyltransferase [Helicobacter felis ATCC
           49179]
 gi|315131677|emb|CBY82305.1| Phosphopantetheine adenylyltransferase [Helicobacter felis ATCC
           49179]
          Length = 164

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 98/158 (62%), Gaps = 6/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y G+FDPITNGH+DII +A +    LV+AI  +  K+  F S++ER E+++ SI    
Sbjct: 6   AIYPGTFDPITNGHLDIIQRASALFGRLVVAIARSKAKSPMF-SLEERLEMMRLSIAPLA 64

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                RV  + FEGL V+LA++ +A+ I+RGLR ++DF++E +M   N+ L P++ T+  
Sbjct: 65  -----RVECMGFEGLLVDLARERNARYIIRGLRAVSDFEFEFQMGYANKSLNPQLETLYF 119

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
                + +++++++R +++    I   VP  V  F++ 
Sbjct: 120 MPALQNAFISASVVRSILAHKGQIAHLVPASVVDFIQR 157


>gi|90023239|ref|YP_529066.1| CheW protein [Saccharophagus degradans 2-40]
 gi|89952839|gb|ABD82854.1| CheW protein [Saccharophagus degradans 2-40]
          Length = 181

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 98/166 (59%), Gaps = 6/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++ VY G+FDPITNGH+D++ +A    + +V+AI   S K     ++ ER  L +  + 
Sbjct: 13  MKRVVYPGTFDPITNGHIDLVERAAHLFDYVVVAI-AESRKKNPLFTMSERVALTEDVLS 71

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    + V  F+ L  +L ++  A  +VRGLR ++DF+YE ++ ++NR L P + +
Sbjct: 72  H-LPN----IEVCGFDCLLKDLVEEKQAYGVVRGLRAVSDFEYEFQLANMNRALAPAMES 126

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           + L   E   Y++STL+R + S+  D+T FVP  V   L    ISL
Sbjct: 127 LFLTPAEHLSYISSTLVREIASLGGDVTKFVPKQVKEALDQKYISL 172


>gi|254428570|ref|ZP_05042277.1| pantetheine-phosphate adenylyltransferase [Alcanivorax sp. DG881]
 gi|196194739|gb|EDX89698.1| pantetheine-phosphate adenylyltransferase [Alcanivorax sp. DG881]
          Length = 163

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 97/161 (60%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  + +Y G+FDPITNGH+D++ +A    +++V+ I   S K     +++ER +L ++ +
Sbjct: 1   MTNRVIYPGTFDPITNGHLDLVERAAKMFDEVVVGIAA-SEKKGPLFTLEERVDLTRRVL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V  F  L  +  ++    +++RGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 60  SH-LPN----VKVTGFSKLLAHFCREEGGNILLRGLRAVSDFEYEFQLANMNRQLAPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ L   E   +++S+LIR +  +D D+ +FVP  V   L+
Sbjct: 115 TVFLTPAEHLSFISSSLIREIALLDGDVNNFVPPLVAEALE 155


>gi|187477072|ref|YP_785096.1| phosphopantetheine adenylyltransferase [Bordetella avium 197N]
 gi|123514426|sp|Q2KY40|COAD_BORA1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|115421658|emb|CAJ48168.1| phosphopantetheine adenylyltransferase [Bordetella avium 197N]
          Length = 167

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 98/157 (62%), Gaps = 6/157 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A +  + +V+A+  +  K K F +I ER E+ ++ + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRAAALFDKVVVAVAYSRNK-KPFFNIDERVEIAREVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V SF GL  +  ++ + +VIVRGLR M+DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VEVRSFGGLLRDFVREQNGRVIVRGLRAMSDFEYEFQMAGMNRHLLPDVETLFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
              +  ++++ T++R +  +  D++ FV   V  +L+
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLQ 154


>gi|42520387|ref|NP_966302.1| phosphopantetheine adenylyltransferase [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|99034962|ref|ZP_01314766.1| hypothetical protein Wendoof_01000408 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|225629850|ref|ZP_03787761.1| phosphopantetheine adenylyltransferase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|61212647|sp|Q73HM7|COAD_WOLPM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|42410125|gb|AAS14236.1| phosphopantetheine adenylyltransferase [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|225591294|gb|EEH12423.1| phosphopantetheine adenylyltransferase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 168

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 94/159 (59%), Gaps = 5/159 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            +Y G+FDPIT GH+DII +A   V+ L+I +  N  K   F   + R+ + +  I    
Sbjct: 8   GIYPGTFDPITFGHLDIIKRACKLVDKLIIGVAENVNKHTAF-DTKLRTSMAENEIKGLG 66

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
            D+     VISF GL V  AK+ +A VI+RGLR ++DFDYE +M+ VN  L PEI TI L
Sbjct: 67  IDAD----VISFNGLLVKFAKEQNASVIIRGLRAVSDFDYEFQMSWVNYKLLPEIETIFL 122

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            A E +++++S+ ++ +  +  D++ FV   V   L N+
Sbjct: 123 PASEDTQFISSSFVKEIARLGEDVSKFVSKGVQNELINL 161


>gi|42522214|ref|NP_967594.1| hypothetical protein Bd0623 [Bdellovibrio bacteriovorus HD100]
 gi|61212607|sp|Q6MQ60|COAD_BDEBA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|39574745|emb|CAE78587.1| ppaT [Bdellovibrio bacteriovorus HD100]
          Length = 160

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 63/162 (38%), Positives = 92/162 (56%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + AVY GSFDPIT GH+DII   +S + D VI +   S + +   S++ER  LI++++
Sbjct: 1   MSKIAVYPGSFDPITMGHVDII-NRISPLYDEVIVLVAQSSQKQSMFSVEERKTLIEKAL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V  F GL V   K   AQVIVRGLR ++DF+YEM M ++NR L P+  
Sbjct: 60  SHL-----KNVKVDIFGGLTVEYMKKAKAQVIVRGLRAVSDFEYEMTMANMNRKLAPDFE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ +FA     Y++S  ++ +      +   VPD V   ++N
Sbjct: 115 TLLVFASPEFYYISSRGVKEVAINGGALKGLVPDVVVEAMEN 156


>gi|254437496|ref|ZP_05050990.1| pantetheine-phosphate adenylyltransferase [Octadecabacter
           antarcticus 307]
 gi|198252942|gb|EDY77256.1| pantetheine-phosphate adenylyltransferase [Octadecabacter
           antarcticus 307]
          Length = 164

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 90/155 (58%), Gaps = 1/155 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII++A S V+ LVI +  N  K   F S++ER  +I+    
Sbjct: 1   MRIGLYPGTFDPLTLGHLDIILRACSLVDKLVIGVAINRDKGPLF-SLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ AKD+ A +I+RGLR + DF+YE +M  +NR L   + T
Sbjct: 60  DLSAQTGCEIVAHPFENLLIHCAKDVGATIIIRGLRAVADFEYEYQMVGMNRQLDNTVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L A+   + + S L++ +  +D D++ FV   V
Sbjct: 120 VFLMAEAQHQAIASKLVKEIARLDGDVSKFVTPAV 154


>gi|317129320|ref|YP_004095602.1| pantetheine-phosphate adenylyltransferase [Bacillus
           cellulosilyticus DSM 2522]
 gi|315474268|gb|ADU30871.1| pantetheine-phosphate adenylyltransferase [Bacillus
           cellulosilyticus DSM 2522]
          Length = 159

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 94/158 (59%), Gaps = 6/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY GSFDP+TNGH+DII +  +  E +++A+  N  K   F SI+ER  L++++  H  
Sbjct: 5   AVYPGSFDPVTNGHLDIISRGANVFEKVIVAVLHNRSKQPLF-SIEERVALLRETTKHI- 62

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                 V V  F+GL +N  K+  A  I++GLR ++DF+YE++M S+NR L  ++ T  +
Sbjct: 63  ----ENVEVDFFDGLLINYVKNKQATTIIKGLRAISDFEYELQMASINRKLDEKVETFFM 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            +     Y++S++++ L   +A I   VP  V   ++N
Sbjct: 119 MSNNQYSYLSSSIVKELAKYEAPIEDLVPPSVEKAIRN 156


>gi|71064902|ref|YP_263629.1| phosphopantetheine adenylyltransferase [Psychrobacter arcticus
           273-4]
 gi|71037887|gb|AAZ18195.1| Phosphopantetheine adenylyltransferase [Psychrobacter arcticus
           273-4]
          Length = 170

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 95/150 (63%), Gaps = 6/150 (4%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K +Y G+FDPITNGH+D++ +A    +++VIA+     K K   + +ER  L+ +++F  
Sbjct: 13  KILYPGTFDPITNGHVDLVTRATKLFDEVVIAVASGHHK-KPLFNFEERVALV-ETVFID 70

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           +P    +VSVI FEGL V+  ++ +A  ++RGLR M+DF+YE ++ ++NR L      + 
Sbjct: 71  LP----QVSVIGFEGLLVDFMREKNATAVLRGLRVMSDFEYEFQLANMNRELDENFEAVF 126

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVP 153
           L   ++  +++ST+IR +  +  D+T FVP
Sbjct: 127 LTPSQNYSFISSTMIREIAKLGGDVTKFVP 156


>gi|114566240|ref|YP_753394.1| pantetheine-phosphate adenylyltransferase [Syntrophomonas wolfei
           subsp. wolfei str. Goettingen]
 gi|122318671|sp|Q0AZ31|COAD_SYNWW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|114337175|gb|ABI68023.1| Phosphopantetheine adenylyltransferase [Syntrophomonas wolfei
           subsp. wolfei str. Goettingen]
          Length = 161

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 90/152 (59%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDP+TNGH+DI+ ++    +++++A+  ++V  K   S+ ER +LI++S  
Sbjct: 1   MKLAVYPGSFDPVTNGHIDILEKSSKIFDEIIVAV-IHNVTKKALFSLDERVKLIEESTR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      N V V +F GL  N   D  A  I+RGLR +TDF+YEM M  +N+ L P I T
Sbjct: 60  HL-----NNVRVDAFSGLLANYLADKQACAIIRGLRTVTDFEYEMHMAMMNKKLIPNIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           +   +     +++S+ ++    +  D+ S VP
Sbjct: 115 MFFMSDSQYTFISSSAVKEAALLGGDVGSLVP 146


>gi|322387097|ref|ZP_08060708.1| pantetheine-phosphate adenylyltransferase [Streptococcus infantis
           ATCC 700779]
 gi|321142084|gb|EFX37578.1| pantetheine-phosphate adenylyltransferase [Streptococcus infantis
           ATCC 700779]
          Length = 162

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 92/161 (57%), Gaps = 7/161 (4%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  ++TGSFDP+TNGHMD+I +A    + L + I  N  K  GFL I+ R E +++++ H
Sbjct: 4   RIGLFTGSFDPMTNGHMDLIERASKLFDKLYVGIFYNPHKN-GFLPIESRLETVEKAVRH 62

Query: 63  FIPDSSNRVSVIS-FEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                   V VIS  + L V++A+ +   V+VRGLR+  D  YE      N  L  EI T
Sbjct: 63  L-----KNVQVISSHDELVVDVARKLGVHVLVRGLRNAADLQYEASFDFYNHQLAGEIET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           I L ++    Y++S+ +R L+  + DI+ +VP+ V   LKN
Sbjct: 118 IYLHSRPEHVYISSSAVRELLKFEQDISKYVPNVVLEELKN 158


>gi|209964381|ref|YP_002297296.1| phosphopantetheine adenylyltransferase [Rhodospirillum centenum SW]
 gi|226709012|sp|B6ISP7|COAD_RHOCS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|209957847|gb|ACI98483.1| pantetheine-phosphate adenylyltransferase [Rhodospirillum centenum
           SW]
          Length = 183

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 91/150 (60%), Gaps = 2/150 (1%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  VY G+FDPITNGH DII +A   V+ L++ +  N+ K   F S  ER E+++  + H
Sbjct: 6   RIGVYPGTFDPITNGHFDIIQRATLVVDHLIVGVARNAGKGPLF-STDERVEMVRDELPH 64

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
            I      V V +F+ L ++ A ++ AQVI+RGLR ++DF+YE +M  +N  L P++ T+
Sbjct: 65  -ISTHGATVEVRAFDSLLMHFAVEMGAQVIIRGLRAVSDFEYEFQMAGMNHRLNPQVETL 123

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFV 152
            L A +  ++++S  ++ +  +  DI  FV
Sbjct: 124 FLMASDRHQFISSRFVKEIGRLGGDIRPFV 153


>gi|206889787|ref|YP_002248644.1| pantetheine-phosphate adenylyltransferase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|226706704|sp|B5YK79|COAD_THEYD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|206741725|gb|ACI20782.1| pantetheine-phosphate adenylyltransferase [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 161

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 94/162 (58%), Gaps = 5/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  VY G+FDPITNGH+D+I +AL   ++L++A+  +S K     +++ER   I Q+ 
Sbjct: 1   MTKTGVYPGTFDPITNGHLDVIKRALKIFDELIVAVAMSSYKKTPIFTVEERVHFIAQTT 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                D  N + V  F+GL VN  K+  A  IVRGLR ++D+++E+++   NR L  +I 
Sbjct: 61  ----KDLKN-LKVEVFDGLLVNFIKEKKAVAIVRGLRAVSDYEFELQLAHANRRLFRDIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ L   E   +++S+L++ +      + S VP  V   L+N
Sbjct: 116 TVFLMPSEEYSFLSSSLVKEIAYFGGSVKSLVPPIVEKALRN 157


>gi|167758116|ref|ZP_02430243.1| hypothetical protein CLOSCI_00454 [Clostridium scindens ATCC 35704]
 gi|167664013|gb|EDS08143.1| hypothetical protein CLOSCI_00454 [Clostridium scindens ATCC 35704]
          Length = 162

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 53/152 (34%), Positives = 95/152 (62%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M K +Y GSFDP+T GH+D+I ++   V++L++ +  N  K+  F S +ER  ++ + + 
Sbjct: 1   MLKGIYPGSFDPVTYGHLDVIERSSKLVDELIVGVLNNKAKSPLF-SAEERVRMLNE-VT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P+    V+V+ FEGL V+ A+ + A +++RGLR +TDF+YE++M   N  + P++ T
Sbjct: 59  KDMPN----VTVVPFEGLLVDFARKMDAGLVIRGLRAITDFEYELQMAQTNHKMEPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + L       Y++ST ++ + +   DI+ FVP
Sbjct: 115 VFLTTSLDYSYLSSTTVKEVAAFGGDISQFVP 146


>gi|146284314|ref|YP_001174467.1| phosphopantetheine adenylyltransferase [Pseudomonas stutzeri A1501]
 gi|145572519|gb|ABP81625.1| pantetheine-phosphate adenylyltransferase [Pseudomonas stutzeri
           A1501]
          Length = 203

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 96/160 (60%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    ++++IA+  N  K   F  +++R EL ++   
Sbjct: 44  MNRVLYPGTFDPITMGHADLVERASRLFDEVIIAVAANPKKNPLF-PLEQRVELAREVTK 102

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V VI F  L  +  K+  A +++RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 103 H-LPN----VKVIGFSTLLAHFVKEQQANILLRGLRAVSDFEYEFQLANMNRQLAPDVES 157

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L   E   Y++STL+R + S+  D++ FV   V   LK
Sbjct: 158 LFLTPSEKYSYISSTLVREIASLQGDVSKFVHPAVMQALK 197


>gi|221639381|ref|YP_002525643.1| phosphopantetheine adenylyltransferase [Rhodobacter sphaeroides
           KD131]
 gi|221160162|gb|ACM01142.1| Pantetheine-phosphate adenylyltransferase [Rhodobacter sphaeroides
           KD131]
          Length = 166

 Score =  110 bits (276), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 93/155 (60%), Gaps = 3/155 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           +MR  +Y G+FDP+T GH+DII +A++ V+ LVI +  N  K   F S++ER  +++   
Sbjct: 4   IMRIGLYPGTFDPLTLGHLDIIQRAMALVDRLVIGVAINRDKGPLF-SLEERVRMVETEC 62

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              I  +   + V  FE L ++ A+D+ A VIVRGLR + DF+YE +M  +NR L   I 
Sbjct: 63  -RAIAANGGEIVVHPFENLLIDCARDVGASVIVRGLRAVADFEYEFQMVGMNRALDAGIE 121

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV-PD 154
           T+ L A    + + S L++ +  +  D++SFV PD
Sbjct: 122 TVFLMADARRQAIASKLVKEIARLGGDVSSFVTPD 156


>gi|171464204|ref|YP_001798317.1| pantetheine-phosphate adenylyltransferase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|229500852|sp|B1XS68|COAD_POLNS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|171193742|gb|ACB44703.1| pantetheine-phosphate adenylyltransferase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 165

 Score =  110 bits (276), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 95/151 (62%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP T GH D++ +A S  ++L++ +  +S     F +++ER ++ K+ + 
Sbjct: 1   MTVAVYPGTFDPFTRGHEDLVRRASSIFKELIVGV-ADSRSKHPFFTLEERIDIAKE-VL 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            + P+    V V+ F GL  + A++ +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 59  GYYPN----VKVVGFSGLLKDFAREHNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   +  ++++ T +R + S+  D++ FV
Sbjct: 115 LFLTPSDQYQFISGTFVREIASMGGDVSKFV 145


>gi|126726344|ref|ZP_01742185.1| pantetheine-phosphate adenylyltransferase [Rhodobacterales
           bacterium HTCC2150]
 gi|126704207|gb|EBA03299.1| pantetheine-phosphate adenylyltransferase [Rhodobacterales
           bacterium HTCC2150]
          Length = 164

 Score =  110 bits (276), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 92/155 (59%), Gaps = 1/155 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT+GH+DI+ +A   V+ LVI +  N  K   F +++ER E+I++   
Sbjct: 1   MRIGLYPGTFDPITHGHLDIMKRAAVLVDRLVIGVAINRDKGPMF-TLEERVEMIEKHCA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   + V  FE L ++ A+D+ AQ I+RGLR ++DF+YE +M  +NR +   I T
Sbjct: 60  ALKEHTDVEIVVHPFENLLIDCARDVGAQFIIRGLRAVSDFEYEFQMVGMNRAMDSSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L A+   + + S L++ +  +  D++ FV   V
Sbjct: 120 VFLMAEAKHQAIASKLVKEIARLGGDVSKFVTKDV 154


>gi|148239604|ref|YP_001224991.1| phosphopantetheine adenylyltransferase [Synechococcus sp. WH 7803]
 gi|166216613|sp|A5GL79|COAD_SYNPW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|147848143|emb|CAK23694.1| Phosphopantetheine adenylyltransferase [Synechococcus sp. WH 7803]
          Length = 165

 Score =  110 bits (276), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 90/150 (60%), Gaps = 6/150 (4%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KA+Y GSFDP+T GH+D+I +  S V++LV+A+  N  K+  F S+++R   I  S  H 
Sbjct: 2   KALYPGSFDPLTLGHLDLIERGASLVDELVVAVLQNPGKSPAF-SLEQRLRQITASTEHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                  VSVISF+GL V  AK+   ++I+RGLR M+DF+YE+++   NR L PE  T+ 
Sbjct: 61  -----GNVSVISFDGLTVACAKEQGTRLILRGLRAMSDFEYELQIAHTNRSLAPEFETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVP 153
           L       +++S++++ +      +   VP
Sbjct: 116 LTTSAHYSFLSSSVVKEVARFGGAVDHMVP 145


>gi|187934254|ref|YP_001885428.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum B
           str. Eklund 17B]
 gi|229488132|sp|B2TJ12|COAD_CLOBB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|187722407|gb|ACD23628.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum B
           str. Eklund 17B]
          Length = 159

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 89/155 (57%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDPITNGH+DII +     + L+I +  N V  KG   I+ER ELIK+   
Sbjct: 1   MKIAVYPGSFDPITNGHLDIIERGSKVFDKLIIGVLVN-VDKKGLFEIEERVELIKKVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H        V V+SF GL ++  K  +A++I++GLR ++DF+YE +M  +N  L P+I T
Sbjct: 60  HI-----KNVEVLSFNGLLIDFLKASNAKIILKGLRAVSDFEYEFKMALMNNKLDPDIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + +       Y++S+ ++ +      I   VP  +
Sbjct: 115 VFMMTSAQYSYLSSSSVKQVAKFGGCIEGLVPKEI 149


>gi|310659143|ref|YP_003936864.1| pantetheine-phosphate adenylyltransferase [Clostridium sticklandii
           DSM 519]
 gi|308825921|emb|CBH21959.1| pantetheine-phosphate adenylyltransferase [Clostridium sticklandii]
          Length = 162

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 93/162 (57%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + AVY GSFDPITNGH+D+I +A    + L++A+  N  K K   ++ ER +++K SI
Sbjct: 1   MAKIAVYPGSFDPITNGHIDVIKRASKVFDHLIVAVLVNDSK-KSMFTLDERLDILKHSI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                D+ + VS  SF GL V+  K+     IVRGLR ++DF++E++M  +NR L  E  
Sbjct: 60  -----DNLDNVSFDSFSGLLVDYCKEKQLSAIVRGLRAISDFEFELQMAQMNRQLYDETE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+     E   Y++S+L++ +      I   +PD   + +K 
Sbjct: 115 TVFFTTSEQYSYLSSSLVKEVAKFGGKIDGLIPDYAIIKMKQ 156


>gi|330718742|ref|ZP_08313342.1| pantetheine-phosphate adenylyltransferase [Leuconostoc fallax KCTC
           3537]
          Length = 161

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 97/160 (60%), Gaps = 7/160 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA++ GSFDP+TNGH+DII +A    +++VI +G N+ K K   S  E+ +LI+ +  
Sbjct: 1   MAKALFPGSFDPLTNGHLDIIARASKLFDEVVIGVGTNTSK-KALFSATEKLQLIEGATT 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F     + VSV    GL V+   +I+A+ +VRGLR+ TD++YE  +  +NR L   I T
Sbjct: 60  QF-----DNVSVSLMSGLTVDFMAEINAEYLVRGLRNATDYEYERDIAEMNRQLAG-IET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           I L AK  ++ ++S++++ +    A+I   VPD +   L+
Sbjct: 114 ILLMAKPVNQNISSSILKEVAKFGANIDHLVPDNINKALQ 153


>gi|226227293|ref|YP_002761399.1| phosphopantetheine adenylyltransferase [Gemmatimonas aurantiaca
           T-27]
 gi|226090484|dbj|BAH38929.1| phosphopantetheine adenylyltransferase [Gemmatimonas aurantiaca
           T-27]
          Length = 188

 Score =  110 bits (275), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 100/168 (59%), Gaps = 6/168 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y GSFDPIT+GH D+I + L+F + L++A+  N+V  +   S+ ER   I++ +    
Sbjct: 27  ALYAGSFDPITHGHDDLIKRTLTFADRLIVAV-ANNVNKQPLFSVDERMHFIREVMA--- 82

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                R+ + SF GL V+ A+++ A+V VRGLR ++DF+YE ++  +NR L P++ TI +
Sbjct: 83  --DDPRIEIRSFSGLLVDFAREVGARVNVRGLRAVSDFEYEFQIALMNRHLYPDLETIFM 140

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDS 172
                + Y++S+++R +     D+T  V   V   ++    +L + D+
Sbjct: 141 TPSLDTTYISSSMVREVARFGGDVTGLVHPLVADAMRERFAALQRGDA 188


>gi|293393615|ref|ZP_06637925.1| pantetheine-phosphate adenylyltransferase [Serratia odorifera DSM
           4582]
 gi|291423950|gb|EFE97169.1| pantetheine-phosphate adenylyltransferase [Serratia odorifera DSM
           4582]
          Length = 161

 Score =  110 bits (275), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 94/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +++AI  +  K K   +++ER  L  Q  
Sbjct: 1   MTSKAIYPGTFDPMTNGHLDLVTRASLMFDRVILAIAASPSK-KPLFTLEERVALATQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F  L  + A   +A ++VRGLR ++DF+YE+++ ++NR L P++ 
Sbjct: 60  SHL-----DNVEVLGFSELMAHFAAHQNANILVRGLRAVSDFEYELQLANMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E   +++S+L++ +     DI+ F+PD V 
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHGGDISPFLPDVVT 151


>gi|77463518|ref|YP_353022.1| phosphopantetheine adenylyltransferase [Rhodobacter sphaeroides
           2.4.1]
 gi|126462374|ref|YP_001043488.1| phosphopantetheine adenylyltransferase [Rhodobacter sphaeroides
           ATCC 17029]
 gi|123591852|sp|Q3J263|COAD_RHOS4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189082582|sp|A3PK50|COAD_RHOS1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|77387936|gb|ABA79121.1| pantetheine-phosphate adenylyltransferase [Rhodobacter sphaeroides
           2.4.1]
 gi|126104038|gb|ABN76716.1| pantetheine-phosphate adenylyltransferase [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 162

 Score =  110 bits (275), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 92/154 (59%), Gaps = 3/154 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII +A++ V+ LVI +  N  K   F S++ER  +++    
Sbjct: 1   MRIGLYPGTFDPLTLGHLDIIQRAMALVDRLVIGVAINRDKGPLF-SLEERVRMVETEC- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             I  +   + V  FE L ++ A+D+ A VIVRGLR + DF+YE +M  +NR L   I T
Sbjct: 59  RAIAANGGEIVVHPFENLLIDCARDVGASVIVRGLRAVADFEYEFQMVGMNRALDAGIET 118

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV-PD 154
           + L A    + + S L++ +  +  D++SFV PD
Sbjct: 119 VFLMADARRQAIASKLVKEIARLGGDVSSFVTPD 152


>gi|189218440|ref|YP_001939081.1| Phosphopantetheine adenylyltransferase [Methylacidiphilum
           infernorum V4]
 gi|226706700|sp|B3DYW1|COAD_METI4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189185298|gb|ACD82483.1| Phosphopantetheine adenylyltransferase [Methylacidiphilum
           infernorum V4]
          Length = 173

 Score =  110 bits (275), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 104/161 (64%), Gaps = 4/161 (2%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++ +Y G+FDPIT GH+D+I +A    +++V+ +   + K   F  ++ER EL+++++ 
Sbjct: 1   MKRVLYPGTFDPITLGHVDVISKAARLFDEVVVGVAAQTPKETLF-ELEERMELVERTLK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           HF    SN ++ + + GL V+ AK+++   I+RGLR ++DF+ E ++  +NR L PEI T
Sbjct: 60  HF--SFSNAIA-LPYTGLTVDFAKELNCCAIIRGLRAVSDFETEFQLALMNRRLKPEIET 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L  +++  Y++S+L++ +  +  +I++FVP  V   LK 
Sbjct: 117 LFLMPEDNHIYLSSSLVKEISRLGGEISAFVPTVVMEALKQ 157


>gi|168188109|ref|ZP_02622744.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum C
           str. Eklund]
 gi|169294059|gb|EDS76192.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum C
           str. Eklund]
          Length = 161

 Score =  110 bits (275), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 60/163 (36%), Positives = 101/163 (61%), Gaps = 9/163 (5%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDPIT GH+DII +A    +++++++  N  K KG  SI+ER +LI++   
Sbjct: 1   MRVAIYPGSFDPITEGHLDIIKRASKVFDEVIVSVLVNPDK-KGLFSIEERVKLIEK--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             + +  + V   SFEGL V+  K  +A+VI++GLR ++DF+YE++M  +N+ L P I T
Sbjct: 57  --VTEDIDNVRAESFEGLLVDYMKSKNAKVIIKGLRVVSDFEYELQMAHMNKKLEPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + +       Y++S+ I+ ++     I   VP+ +   +K+IV
Sbjct: 115 VFMMTNAKYSYLSSSSIKQVVMFGGCIEGLVPNKI---IKDIV 154


>gi|330685100|gb|EGG96766.1| pantetheine-phosphate adenylyltransferase [Staphylococcus
           epidermidis VCU121]
          Length = 161

 Score =  110 bits (275), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 58/158 (36%), Positives = 98/158 (62%), Gaps = 6/158 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KAV  GSFDPIT GH+DII ++    +++ + +  NS K  G  ++ ER +LI+ S+ H 
Sbjct: 5   KAVIPGSFDPITYGHLDIIERSADRFDEIHVCVLKNSSKG-GTFNLDERMDLIRGSVAHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V V  + GL V+  K + A+ I+RGLR ++DF+YE+R+TS+N+ L  +I T+ 
Sbjct: 64  -----SNVEVHHYNGLLVDFCKQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNSDIETMY 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +    +  +++S++++ + +  ADI+ FVP  V   LK
Sbjct: 119 MMTSTNYSFISSSIVKEVAAYKADISEFVPPNVAKALK 156


>gi|317405496|gb|EFV85805.1| phosphopantetheine adenylyltransferase [Achromobacter xylosoxidans
           C54]
          Length = 167

 Score =  110 bits (275), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 96/158 (60%), Gaps = 6/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A +  + +V+ I  +S   K F SI ER ++ ++ + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRAATLFDKVVVGI-AHSRNKKPFFSIDERVDIAREVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V SF GL  +  +D   +VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VEVQSFGGLLKDFVRDQGGRVIVRGLRAVSDFEYEFQMAGMNRHLLPDVETLFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
              +  ++++ T++R +  +  D++ FV   V  +L+ 
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLQE 155


>gi|257063716|ref|YP_003143388.1| Phosphopantetheine adenylyltransferase [Slackia heliotrinireducens
           DSM 20476]
 gi|256791369|gb|ACV22039.1| Phosphopantetheine adenylyltransferase [Slackia heliotrinireducens
           DSM 20476]
          Length = 159

 Score =  110 bits (275), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 97/152 (63%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++A+  G+FDPITNGH+D++ ++    +++++ +  +  K   F ++ ER  L +++  
Sbjct: 1   MKRALVPGTFDPITNGHIDVVERSADIFDEVIVGVAQSRKKGPTF-NLDERIALAQEATA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V+ F+ L VN AK I+A VIV+GLR +TDF+YE +MTS+N  L   I T
Sbjct: 60  H-LPN----VKVMGFDDLLVNFAKKINAHVIVKGLRAITDFEYEFQMTSMNYALDESIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + + ++    Y++S+++R L +   DI + VP
Sbjct: 115 LFIMSQPQHMYLSSSIVRELAAFHGDIKALVP 146


>gi|300313427|ref|YP_003777519.1| phosphopantetheine adenylyltransferase [Herbaspirillum seropedicae
           SmR1]
 gi|124483606|emb|CAM32676.1| Phosphopantetheine adenylyltransferase (pantetheine-Phosphate
           adenylyltransferase) protein [Herbaspirillum
           seropedicae]
 gi|300076212|gb|ADJ65611.1| phosphopantetheine adenylyltransferase (pantetheine-Phosphate
           adenylyltransferase) protein [Herbaspirillum seropedicae
           SmR1]
          Length = 160

 Score =  110 bits (275), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDP+T GH D++ +A    + LV+ +  +S   K F S++ER  +  + + 
Sbjct: 1   MVTAVYPGTFDPLTRGHEDLVRRASGLFDKLVVGV-ADSKNKKPFFSLEERLSIANEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+ P+    V V SF GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HY-PN----VQVESFSGLLKDFVRQNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L   +  ++++ T++R +  +  D++ FV   V  +LK 
Sbjct: 115 LFLTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLKE 155


>gi|73662972|ref|YP_301753.1| putative phosphopantetheine adenyltransferase [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
 gi|123642310|sp|Q49WP9|COAD_STAS1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|72495487|dbj|BAE18808.1| putative phosphopantetheine adenyltransferase [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
          Length = 161

 Score =  110 bits (275), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 96/150 (64%), Gaps = 6/150 (4%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KAV  GSFDPIT GH+DII ++    ++L I +  NS K+ G  SI+ER  LI++S+ H 
Sbjct: 5   KAVIPGSFDPITYGHIDIIDRSADRFDELHICVLKNSGKS-GTFSIEERIALIEESVKHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                N V+V  F GL V+    I A+ I+RGLR ++DF+YE+R+TS+N+ L   + T+ 
Sbjct: 64  -----NNVTVHHFNGLLVDFCDKIGAETIIRGLRAVSDFEYELRLTSMNKKLNSNVETMY 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVP 153
           +    +  +++S++++ + +  A+++ FVP
Sbjct: 119 MMTSTNYSFISSSVVKEVAAYKANVSDFVP 148


>gi|317495522|ref|ZP_07953890.1| pantetheine-phosphate adenylyltransferase [Gemella moribillum M424]
 gi|316914336|gb|EFV35814.1| pantetheine-phosphate adenylyltransferase [Gemella moribillum M424]
          Length = 163

 Score =  110 bits (275), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 98/157 (62%), Gaps = 8/157 (5%)

Query: 2   MRK--AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQS 59
           M+K  A+  GSFDPIT GH+DII ++    +++++AI  N  K K   +++ER  +I ++
Sbjct: 1   MKKKIAIVPGSFDPITYGHIDIITRSAQLFDEVIVAILVNPDK-KYLFTLEERESMIHET 59

Query: 60  IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
           I        + V V SF GL VN AK + + VIVRGLR ++DF+YEM++T +N+ L  +I
Sbjct: 60  I-----KGLDNVRVDSFSGLLVNYAKKVGSSVIVRGLRAVSDFEYEMQLTFMNKALDDDI 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
            T  + A +   +++S++++ +    AD++ FVP  V
Sbjct: 115 ETFYMMANKQYSFISSSIVKGVSGFGADLSKFVPKNV 151


>gi|315611865|ref|ZP_07886784.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           ATCC 49296]
 gi|315316043|gb|EFU64076.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           ATCC 49296]
          Length = 162

 Score =  110 bits (275), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 55/159 (34%), Positives = 94/159 (59%), Gaps = 7/159 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+TNGH+DII +A    + L + +  N  K +GFL ++ R   +++++ H  
Sbjct: 6   GLFTGSFDPMTNGHLDIIERASKLFDKLYVGVFYNPHK-QGFLPVENRKRAVEKAVAHL- 63

Query: 65  PDSSNRVSVI-SFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V V+ S + L V++A+ + A+ +VRGLR+ TD  YE      N  L PEI TI 
Sbjct: 64  ----DNVEVLASHDQLVVDVARRLGAKTLVRGLRNTTDLQYESSFDYYNHQLAPEIETIY 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           L+++    Y++S+ +R L+    +I  +VP+ V   L++
Sbjct: 120 LYSRPEHLYISSSAVRELLKFGQEIQQYVPNSVVEELEH 158


>gi|254475347|ref|ZP_05088733.1| pantetheine-phosphate adenylyltransferase [Ruegeria sp. R11]
 gi|214029590|gb|EEB70425.1| pantetheine-phosphate adenylyltransferase [Ruegeria sp. R11]
          Length = 164

 Score =  110 bits (275), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 89/151 (58%), Gaps = 1/151 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F S++ER  +I+    
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRASALVDKLVIGVAINRDKGPLF-SLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ A+D+ AQ+IVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  KLSEQTGTEIVAHPFENLLIDCARDVGAQIIVRGLRAVADFEYEFQMVGMNRALDSSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L A+   + + S L++ +  +  D+++FV
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLGGDVSNFV 150


>gi|123966199|ref|YP_001011280.1| phosphopantetheine adenylyltransferase [Prochlorococcus marinus
           str. MIT 9515]
 gi|166216573|sp|A2BWL2|COAD_PROM5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123200565|gb|ABM72173.1| putative pantetheine-phosphate adenylyltransferase [Prochlorococcus
           marinus str. MIT 9515]
          Length = 159

 Score =  110 bits (275), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 58/158 (36%), Positives = 97/158 (61%), Gaps = 6/158 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K +Y G+FDP+TNGH+D+I +A     ++V+A+  N+ K   F  +  R   I  +I H 
Sbjct: 2   KILYPGTFDPLTNGHLDLIQRAEKLFGNVVVAVLENTSKKPTF-ELSRRLIQINNAISHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                +++SVIS+EGL V+ A+D++A +I+RGLR M+DF+YE+++   N+ L  EI TI 
Sbjct: 61  -----SKISVISYEGLTVDCAQDVNANLILRGLRAMSDFEYELQIAHTNKSLNSEIETIF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           L    +  +++S+L++ +     +I   VP+ V   LK
Sbjct: 116 LSTNTNFSFLSSSLVKEVAKFGGEINHMVPEAVERDLK 153


>gi|21673793|ref|NP_661858.1| lipopolysaccharide core biosynthesis protein KdtB [Chlorobium
           tepidum TLS]
 gi|29427821|sp|Q8KDS9|COAD_CHLTE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|21646922|gb|AAM72200.1| lipopolysaccharide core biosynthesis protein KdtB [Chlorobium
           tepidum TLS]
          Length = 165

 Score =  110 bits (275), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 95/152 (62%), Gaps = 5/152 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDP TNGH+D++ +AL+  E + + +  NS K   F S++ER +++++ +
Sbjct: 1   MSKKAIYPGTFDPFTNGHLDVLERALNIFEHVDVVLAENSQKQTLF-SVEERFDMVRE-V 58

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +P+ S  V V+  EGL  + A+   A  IVRG+R + DF+YE +M+ +NR L PE+ 
Sbjct: 59  VRDLPNVS--VDVLR-EGLLADYARQAGASAIVRGVRQVKDFEYEFQMSLLNRHLYPEVT 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           T+ L       YV ST+IR +  +  D++ FV
Sbjct: 116 TVFLMPNVKYTYVASTIIREVSMLGGDVSKFV 147


>gi|256823446|ref|YP_003147409.1| pantetheine-phosphate adenylyltransferase [Kangiella koreensis DSM
           16069]
 gi|256796985|gb|ACV27641.1| pantetheine-phosphate adenylyltransferase [Kangiella koreensis DSM
           16069]
          Length = 160

 Score =  110 bits (275), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 98/156 (62%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  +Y G+FDPIT GHMD++ +A    + ++IAI  +S   K   S+ ER ++++  I
Sbjct: 1   MKKTVLYPGTFDPITKGHMDLVNRACRLFDKVIIAI-AHSPSKKPLFSLDERVDMVRM-I 58

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
           F   P    +V V+ F GL  N AK+ SA  I+RG+R ++DF++E ++ ++NR L P++ 
Sbjct: 59  FADNP----QVEVLGFRGLLANFAKENSAIAILRGIRAVSDFEFEFQLANMNRHLDPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           +I L   E   Y++S+L+R + S+  DI++FV + V
Sbjct: 115 SIFLTPSEKYSYISSSLVREVASLGGDISAFVDERV 150


>gi|149189223|ref|ZP_01867510.1| phosphopantetheine adenylyltransferase [Vibrio shilonii AK1]
 gi|148836977|gb|EDL53927.1| phosphopantetheine adenylyltransferase [Vibrio shilonii AK1]
          Length = 164

 Score =  110 bits (275), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 89/152 (58%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           + + +Y G+FDPITNGH+D+I +A +  ++++IAI  +  K   F ++ ER E  ++   
Sbjct: 6   LSRVIYPGTFDPITNGHLDLIERAATMFDEVIIAIAASPSKNTMF-TLDERVEFAREVTK 64

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H        VS   F GL VN A+D  A V++RGLR   DF+YE  +T++ R L P + +
Sbjct: 65  HL-----ENVSAKGFSGLLVNFAEDEKANVLIRGLRTTVDFEYEFGLTNMYRRLLPGLES 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + L   E   +++STL+R +     D++ FVP
Sbjct: 120 VFLTPAEEHAFISSTLVREVAIHGGDVSQFVP 151


>gi|289578490|ref|YP_003477117.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           italicus Ab9]
 gi|297544766|ref|YP_003677068.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|289528203|gb|ADD02555.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           italicus Ab9]
 gi|296842541|gb|ADH61057.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
          Length = 159

 Score =  110 bits (275), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 98/161 (60%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH+DII +  +  + L++A+  N  K K   S++ER EL+K ++ 
Sbjct: 1   MKTAIYPGSFDPVTYGHIDIIKRGANLFDKLIVAVLLNPSK-KPLFSVEERIELLK-AVT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           + IP+    V +  F+GL V  AK ++A  I++GLR ++DF+YE +M  +N+ L P + T
Sbjct: 59  YDIPN----VEIDYFDGLLVEYAKRVNANAIIKGLRMVSDFEYEFQMALINKKLNPSVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L       Y++S++++ +      ++ FVP+ V   LK 
Sbjct: 115 VFLMTSAKYGYLSSSVVKEIAQFGGCLSEFVPEIVAQKLKE 155


>gi|167835371|ref|ZP_02462254.1| phosphopantetheine adenylyltransferase [Burkholderia thailandensis
           MSMB43]
          Length = 166

 Score =  110 bits (275), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 101/168 (60%), Gaps = 6/168 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F S++ER E+  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRAKKPFFSLEERLEIANEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+ F GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VKVMGFTGLLKDFVRANNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDS 172
              +  ++++ T++R +  +  D++ FV   V  +L   V ++ +  S
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMAQGPS 165


>gi|77919239|ref|YP_357054.1| phosphopantetheine adenylyltransferase [Pelobacter carbinolicus DSM
           2380]
 gi|123574129|sp|Q3A423|COAD_PELCD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|77545322|gb|ABA88884.1| Phosphopantetheine adenylyltransferase [Pelobacter carbinolicus DSM
           2380]
          Length = 166

 Score =  110 bits (275), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 97/151 (64%), Gaps = 6/151 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY GSFDPITNGH+DII++ L+  ++L++A+  N  KT G  SI ER +LI++++  
Sbjct: 4   RIAVYPGSFDPITNGHLDIILRGLNIFDELIVAVAHNVAKT-GLFSIDERLDLIRETVKD 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
           +      +V V +F+GL V+     +A++++RGLR ++DF+ E ++  +N  +  ++ T+
Sbjct: 63  Y-----PQVRVDTFKGLLVDYLTRQNARIVLRGLRAVSDFENEFQLAQMNHTMNTQLETL 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVP 153
            +    S  Y++S++++ + +   DI  FVP
Sbjct: 118 FMMTSVSYGYLSSSIVKEVAAWGGDIDDFVP 148


>gi|291459593|ref|ZP_06598983.1| pantetheine-phosphate adenylyltransferase [Oribacterium sp. oral
           taxon 078 str. F0262]
 gi|291417871|gb|EFE91590.1| pantetheine-phosphate adenylyltransferase [Oribacterium sp. oral
           taxon 078 str. F0262]
          Length = 164

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 92/155 (59%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDP+T GH+DII ++    + L + +  NSVKT  F S++ER  +I   I 
Sbjct: 1   MRIALYPGSFDPVTFGHLDIIERSAKIFDRLFVGVLVNSVKTPLF-SMEERVRMISVLI- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    V V SF GL V+ A+ + A VIVRGLR +TDF+YE++++  N+ +  +I T
Sbjct: 59  ----KGLKNVEVRSFSGLTVDYARSLGATVIVRGLRAVTDFEYELQLSQTNKVMAADIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L       Y++S+ ++ + S   DI  FVP+ V
Sbjct: 115 VFLTTNLKYSYLSSSTVKEIASYGGDIRPFVPENV 149


>gi|116327009|ref|YP_796729.1| pantetheine-phosphate adenylyltransferase [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
 gi|116332325|ref|YP_802043.1| pantetheine-phosphate adenylyltransferase [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
 gi|122279948|sp|Q04P85|COAD_LEPBJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|122285143|sp|Q056E9|COAD_LEPBL RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|116119753|gb|ABJ77796.1| Pantetheine-phosphate adenylyltransferase [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
 gi|116126014|gb|ABJ77285.1| Pantetheine-phosphate adenylyltransferase [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
          Length = 160

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 94/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M   A+Y GSFDP+TNGH+DI+ ++L   + ++IAI  NS K+  F SI+ER E I    
Sbjct: 1   MKHLAIYPGSFDPLTNGHLDILQRSLGLFDKVIIAIAVNSNKSTLF-SIEERLEFI---- 55

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +      + + +F+GL V+    + A  I+RGLR +TDFDYE  ++ +N+ L P + 
Sbjct: 56  -HKVTQGLKGLEIDTFQGLTVDYCNKVGANSIIRGLRAVTDFDYEYAISLMNKKLAPNVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           T+ L +     +++ST+++ +     D+++ VP+ V
Sbjct: 115 TVFLMSSGEYSFISSTIVKEVARHGRDVSNQVPEIV 150


>gi|171778739|ref|ZP_02919835.1| hypothetical protein STRINF_00687 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282696|gb|EDT48120.1| hypothetical protein STRINF_00687 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 165

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 62/174 (35%), Positives = 102/174 (58%), Gaps = 11/174 (6%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  + TGSFDP+TNGH+DII +A    + L + I  N  K+  F +I ER +++++++
Sbjct: 1   MAKIGLVTGSFDPVTNGHLDIIARASKLFDTLYVGILYNRNKSCLF-TIAERKQMLEEAV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             +    SN   V + + LAV++A+++ A  +VRG+RD  D +YE  M   N  L  +I 
Sbjct: 60  EPY----SNVSVVTAHDSLAVDVARELKAAYLVRGIRDAKDLEYEGGMDFFNHHLASDIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIK 174
           ++ L      +YV+S+ +R LI   ADI++FVPD V   ++       KYD++K
Sbjct: 116 SVYLLTSPEWQYVSSSRVRELIHFQADISAFVPDSVVKKVEE------KYDNLK 163


>gi|163736597|ref|ZP_02144016.1| Coenzyme A biosynthesis protein [Phaeobacter gallaeciensis BS107]
 gi|163742757|ref|ZP_02150142.1| pantetheine-phosphate adenylyltransferase [Phaeobacter
           gallaeciensis 2.10]
 gi|161384012|gb|EDQ08396.1| pantetheine-phosphate adenylyltransferase [Phaeobacter
           gallaeciensis 2.10]
 gi|161390467|gb|EDQ14817.1| Coenzyme A biosynthesis protein [Phaeobacter gallaeciensis BS107]
          Length = 164

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 88/151 (58%), Gaps = 1/151 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F S++ER  +I+    
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRASALVDKLVIGVAINRDKGPLF-SLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ A+D+ AQ+IVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  KLSEQTGTEIVAHPFENLLIDCARDVGAQIIVRGLRAVADFEYEFQMVGMNRALDSSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L A+   + + S L++ +  +  D++ FV
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLGGDVSKFV 150


>gi|311277445|ref|YP_003939676.1| pantetheine-phosphate adenylyltransferase [Enterobacter cloacae
           SCF1]
 gi|308746640|gb|ADO46392.1| pantetheine-phosphate adenylyltransferase [Enterobacter cloacae
           SCF1]
          Length = 159

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 89/156 (57%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K    + ER  L +Q+ 
Sbjct: 1   MSTKAIYPGTFDPITNGHLDIVTRASCMFDSVILAIAASPSK-KPMFDLAERVALAQQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A+   A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARAQQANILIRGLRAVADFEYEMQLAHMNRHLMPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           ++ L   +   +++S+L++ +     D+  F+P  V
Sbjct: 115 SVFLMPSKEWSFISSSLVKEVARHGGDVAHFLPPAV 150


>gi|225630150|ref|YP_002726941.1| phosphopantetheine adenylyltransferase [Wolbachia sp. wRi]
 gi|254764188|sp|C0R2K8|COAD_WOLWR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|225592131|gb|ACN95150.1| phosphopantetheine adenylyltransferase [Wolbachia sp. wRi]
          Length = 168

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 93/159 (58%), Gaps = 5/159 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            +Y G+FDPIT GH+DII +A   V+ L+I +  N  K   F   + R+ + +  I    
Sbjct: 8   GIYPGTFDPITFGHLDIIKRACKLVDKLIIGVAENVNKHTAF-DTKLRTSMAENEIKGLG 66

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
            D+     VISF GL V  AK+ +A VI+RGLR ++DFDYE +M+ VN  L PEI TI L
Sbjct: 67  IDAD----VISFNGLLVKFAKEQNASVIIRGLRAVSDFDYEFQMSWVNYKLLPEIETIFL 122

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
            A E +++++S  ++ +  +  D++ FV   V   L N+
Sbjct: 123 PASEDTQFISSGFVKEIARLGEDVSKFVSKGVQNELINL 161


>gi|308047859|ref|YP_003911425.1| pantetheine-phosphate adenylyltransferase [Ferrimonas balearica DSM
           9799]
 gi|307630049|gb|ADN74351.1| pantetheine-phosphate adenylyltransferase [Ferrimonas balearica DSM
           9799]
          Length = 161

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 100/162 (61%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y G+FDPITNGH+D+I +A    + +++ I  +  K +   ++++R EL+   +
Sbjct: 1   MSQTAIYPGTFDPITNGHLDLIQRASRMFDRVIVGIAASPSK-RPLFTLEQRVELVNAVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V V+ F GL  + A++ +A+V++RGLR ++DF+YE ++ ++NR L PE+ 
Sbjct: 60  AEL-----GNVEVVGFSGLLADFAREQNARVLIRGLRAVSDFEYEFQLANMNRRLNPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           ++ L   E + +++S+L++ +     ++T F+P+ V   LK+
Sbjct: 115 SVFLTPSEENSFISSSLVKEVALHGGNVTEFLPEVVQNALKD 156


>gi|294637899|ref|ZP_06716168.1| pantetheine-phosphate adenylyltransferase [Edwardsiella tarda ATCC
           23685]
 gi|291088925|gb|EFE21486.1| pantetheine-phosphate adenylyltransferase [Edwardsiella tarda ATCC
           23685]
          Length = 161

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 95/157 (60%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y G+FDP+TNGH+DI+ +A    E +++AI  +  K   F +++ER  + +   
Sbjct: 1   MSRTAIYPGTFDPLTNGHLDIVTRAAHMFERVILAIAASPSKHPLF-TLEERVAMARDVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V  F  L  + A+   A ++VRGLR ++DF+YE+++ ++NR L P + 
Sbjct: 60  AH-LPN----VEVQGFSELMAHFAQRQQADILVRGLRAVSDFEYELQLANMNRHLMPSLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E+  +++S+L++ +     D+ +F+P PV 
Sbjct: 115 SVFLMPAEAWSFISSSLVKEVARHGGDVDAFLPPPVA 151


>gi|254495423|ref|ZP_05108347.1| Phosphopantetheine adenylyltransferase [Polaribacter sp. MED152]
 gi|85819778|gb|EAQ40935.1| Phosphopantetheine adenylyltransferase [Polaribacter sp. MED152]
          Length = 152

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 97/157 (61%), Gaps = 7/157 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+KAV+ GSFDPIT GH DII + +   ++L+IAIG N+ K K   S++ER   I+++  
Sbjct: 1   MKKAVFPGSFDPITLGHFDIIERGVKLFDELIIAIGINADK-KYMFSLEERKSFIEETF- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +  ++ V++++GL VN  K+ +A+ I+RGLR+  DF++E  +   NR L  EI T
Sbjct: 59  ----KNEPKIKVVTYQGLTVNFCKEQNAEFILRGLRNPADFEFEKAIAHTNRKLS-EIET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           + L       Y++S+++R +I  + D T  VPD V V
Sbjct: 114 VFLLTSSGKSYISSSIVRDVIRNNGDYTGLVPDAVRV 150


>gi|146277435|ref|YP_001167594.1| phosphopantetheine adenylyltransferase [Rhodobacter sphaeroides
           ATCC 17025]
 gi|189082583|sp|A4WSC5|COAD_RHOS5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|145555676|gb|ABP70289.1| pantetheine-phosphate adenylyltransferase [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 162

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 93/154 (60%), Gaps = 3/154 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII +A++ V+ LVI +  N  K   F S++ER  ++ +S  
Sbjct: 1   MRIGLYPGTFDPLTLGHLDIIQRAMALVDRLVIGVAINRDKGPLF-SLEERVRMV-ESEC 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             I  +   + V  FE L ++ A+D+ A VI+RGLR + DF+YE +M  +NR L   I T
Sbjct: 59  RAIAANGGEIVVHPFENLLIDCARDVGASVILRGLRAVADFEYEFQMVGMNRALDAGIET 118

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV-PD 154
           + L A    + + S L++ +  +  D++SFV PD
Sbjct: 119 VFLMADARRQAIASKLVKEIARLGGDVSSFVTPD 152


>gi|319744508|gb|EFV96863.1| pantetheine-phosphate adenylyltransferase [Streptococcus agalactiae
           ATCC 13813]
          Length = 161

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 99/156 (63%), Gaps = 5/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA++TGSFDP+TNGH+DII +A S++ D V    C +++ +G+ SI+ R ++++++I
Sbjct: 1   MTKKALFTGSFDPVTNGHLDIIERA-SYLFDHVYIGLCYNLEKQGYFSIECRKKMLEEAI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F     N   +++ + LAV+LA+++ A+  VRGLR+  DFDYE  +   N+ L  +I 
Sbjct: 60  RQF----KNVSVLVAQDRLAVDLAREVGAKYFVRGLRNSQDFDYEANLEFFNKQLADDIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           T+ L    S   ++S+ IR LI   A + SFVP  V
Sbjct: 116 TVYLSTSPSLSPISSSRIRELIHFKASVKSFVPKSV 151


>gi|288553185|ref|YP_003425120.1| lipopolysaccharide core biosynthesis [Bacillus pseudofirmus OF4]
 gi|288544345|gb|ADC48228.1| lipopolysaccharide core biosynthesis [Bacillus pseudofirmus OF4]
          Length = 161

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 92/157 (58%), Gaps = 6/157 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AV  GSFDP+T GH+DII +     + +++A+  N  K   F S +ER +L+K+   H  
Sbjct: 5   AVCPGSFDPVTYGHLDIITRGAKVFDQVIVAVLHNRNKQPMF-SAEERVQLLKEVTSHL- 62

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
               + V + SF GL +N  ++  A  I+RGLR ++DF+YEM+  S+N+ L PEI T  +
Sbjct: 63  ----DNVVIDSFNGLLINYMQEKKANTIIRGLRAVSDFEYEMQAASINKKLGPEIETFFM 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
                  Y++S++++ +   +AD++  VPD V   LK
Sbjct: 119 MTNNHYSYLSSSIVKEVAKYEADVSDIVPDIVAEALK 155


>gi|119387181|ref|YP_918236.1| pantetheine-phosphate adenylyltransferase [Paracoccus denitrificans
           PD1222]
 gi|189082578|sp|A1BAJ6|COAD_PARDP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|119377776|gb|ABL72540.1| pantetheine-phosphate adenylyltransferase [Paracoccus denitrificans
           PD1222]
          Length = 164

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 88/151 (58%), Gaps = 1/151 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH DII +AL  V+ LVI +  N  K+  F ++++R  ++++   
Sbjct: 1   MRIGLYPGTFDPITLGHQDIIQRALELVDRLVIGVAINRDKSPLF-ALEDRVAMVREECD 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +      + V  FE L ++ A+D+ A VIVRGLR + DF+YE +M  +NR +   I T
Sbjct: 60  RIVAKRGGEIVVHPFENLLIDCARDVGATVIVRGLRAVADFEYEFQMVGMNRAMDDSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L A    + + S L++ +  +  D++ FV
Sbjct: 120 VFLMADARRQAIASKLVKEIARLGGDVSKFV 150


>gi|304316955|ref|YP_003852100.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778457|gb|ADL69016.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 159

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 95/155 (61%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP+TNGH+D+I +A    + L++A+  N  KT  F S++ER E++++  F
Sbjct: 1   MNIAVYPGSFDPVTNGHLDVIKRAAKVFDKLIVAVLINPSKTPMF-SVEERVEMLREVTF 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D  N V +  F GL +   + +++++IV+GLR ++DF+YE +M  +N+ L PE+ T
Sbjct: 60  ----DIEN-VEIDCFSGLLIEYLEKVNSKIIVKGLRMVSDFEYEFQMALINKKLNPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           I         Y++S++++ + S    ++  VPD V
Sbjct: 115 IFFMTSNKYGYLSSSIVKEVASFGGCLSDLVPDSV 149


>gi|47779379|gb|AAT38608.1| predicted phosphopantetheine adenylyltransferase [uncultured gamma
           proteobacterium eBACHOT4E07]
          Length = 160

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/161 (40%), Positives = 100/161 (62%), Gaps = 7/161 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDPIT GHMDII +A    + ++IAI  +  K   F S+++R +L      
Sbjct: 1   MKVAIYPGSFDPITFGHMDIIDRASGLFDKIIIAIAKSETKNPLF-SLEDRIKLANT--- 56

Query: 62  HFIPDSSNRVSVISF-EGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             I   +++V VI F   L V++AK+ +A  I+RGLR ++DF+YE ++ ++NR L P+I 
Sbjct: 57  --IYKDNDKVDVIGFPRQLTVDVAKEHNACAIIRGLRAVSDFEYEFQLATMNRSLAPDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +I L  KES  YV+S+LI+ +  +  DI+ FV   V   LK
Sbjct: 115 SIFLTPKESLIYVSSSLIKEICDLKGDISKFVHPSVEQALK 155


>gi|118580606|ref|YP_901856.1| pantetheine-phosphate adenylyltransferase [Pelobacter propionicus
           DSM 2379]
 gi|118503316|gb|ABK99798.1| Phosphopantetheine adenylyltransferase [Pelobacter propionicus DSM
           2379]
          Length = 160

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/156 (36%), Positives = 94/156 (60%), Gaps = 7/156 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + AVY GSFDPIT GH+DII + L   +++++A+ CNS K K   SI+ER  LI++ +
Sbjct: 1   MKKIAVYPGSFDPITYGHLDIINRGLKVFDEIIVAVACNSQK-KSLFSIEERMALIRRVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   +RV V +F GL ++     +A VI+RGLR ++DF+YE ++  +N  L  +I 
Sbjct: 60  ------DQDRVRVDTFTGLLIDYVTRQNADVIIRGLRAISDFEYEFQIAQMNSSLGHDIE 113

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           T+ +       Y++S++++ +  +  +I  FVP  V
Sbjct: 114 TLFMMTSLQYGYLSSSIVKEVCGLRGNIDGFVPPEV 149


>gi|68249229|ref|YP_248341.1| phosphopantetheine adenylyltransferase [Haemophilus influenzae
           86-028NP]
 gi|81336367|sp|Q4QMR6|COAD_HAEI8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|68057428|gb|AAX87681.1| phosphopantetheine adenylyltransferase [Haemophilus influenzae
           86-028NP]
          Length = 156

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 91/160 (56%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M   +Y G+FDPITNGH+DII ++      +++A+  NS   K   S++ER EL++QS+ 
Sbjct: 1   MTSVIYPGTFDPITNGHLDIIERSAVIFPRVLVAV-ANSPSKKPLFSLEERVELVRQSVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + V V  F  L  N+ K  +   I+RG+R  TDF+YE+++ ++NR L   + +
Sbjct: 60  HL-----SNVEVFGFSDLLANVIKQHNISAIIRGVRTTTDFEYELQLAALNRLLTKGVDS 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +     E   +V+ST++R +     D+   VP+PV   LK
Sbjct: 115 LFFPPAEKWAFVSSTIVREIYLHGGDVAELVPEPVFNALK 154


>gi|283954335|ref|ZP_06371856.1| posphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794134|gb|EFC32882.1| posphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 154

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 96/157 (61%), Gaps = 6/157 (3%)

Query: 6   VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIP 65
           +Y G+FDPITNGH+D+I +AL   ++++IAI   S   K F  +++R EL   +      
Sbjct: 4   LYPGTFDPITNGHLDVIKRALKIFDEVIIAI-AKSEHKKPFYDLEKRKELALLAT----- 57

Query: 66  DSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALF 125
            + N + +I+F+ L V+LAK++    I+RGLR ++DF+YE+++   N  L  +I TI L 
Sbjct: 58  QNLNNIKIIAFDNLLVDLAKELKVNTIIRGLRAVSDFEYELQIGYANHALWEDIETIYLM 117

Query: 126 AKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
                 +++S+++R +++   D++S V   +  FLK+
Sbjct: 118 PSLKHAFISSSIVRSIVAHGGDVSSLVSKEILPFLKD 154


>gi|319786797|ref|YP_004146272.1| pantetheine-phosphate adenylyltransferase [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465309|gb|ADV27041.1| pantetheine-phosphate adenylyltransferase [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 166

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 91/150 (60%), Gaps = 6/150 (4%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPITNGH+D++ +A    E +++ +  +  K    LS++ R +L ++++  
Sbjct: 5   RIAVYPGTFDPITNGHIDLVDRAAPLFEKVIVGVAASQAKGP-TLSLELRVKLAREAL-- 61

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V V  F+ L  +  +D+ A V++RGLR ++DF+YE +M S+NR L PE+ T+
Sbjct: 62  ---AGHPNVEVRGFDSLLAHFVRDVGAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL 118

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFV 152
            L   E   +++S+L+R +  +  D++ FV
Sbjct: 119 FLTPAEQYSFISSSLVREIARLGGDVSGFV 148


>gi|46198868|ref|YP_004535.1| phosphopantetheine adenylyltransferase [Thermus thermophilus HB27]
 gi|55980898|ref|YP_144195.1| phosphopantetheine adenylyltransferase [Thermus thermophilus HB8]
 gi|61212639|sp|Q72K87|COAD_THET2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|81600459|sp|Q5SJS9|COAD_THET8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|29726926|pdb|1OD6|A Chain A, The Crystal Structure Of Phosphopantetheine
           Adenylyltransferase From Thermus Thermophilus In Complex
           With 4'-Phosphopantetheine
 gi|46196491|gb|AAS80908.1| phosphopantetheine adenylyltransferase [Thermus thermophilus HB27]
 gi|55772311|dbj|BAD70752.1| phosphopantetheine adenylyltransferase [Thermus thermophilus HB8]
          Length = 160

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 90/157 (57%), Gaps = 6/157 (3%)

Query: 6   VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFL-SIQERSELIKQSIFHFI 64
           VY GSFDP+TNGH+D+I +A    E + +A+  N  K   +L S +ER  +I+++  H  
Sbjct: 4   VYPGSFDPLTNGHLDVIQRASRLFEKVTVAVLENPSKRGQYLFSAEERLAIIREATAHLA 63

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                 V   +F GL V+  + + AQ IV+GLR ++D++YE++M  +NR L P + T+ +
Sbjct: 64  -----NVEAATFSGLLVDFVRRVGAQAIVKGLRAVSDYEYELQMAHLNRQLYPGLETLFI 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            A     +V+ST+++ +     D++  VP      LK
Sbjct: 119 LAATRYSFVSSTMVKEIARYGGDVSKLVPPATLRALK 155


>gi|206576018|ref|YP_002236004.1| pantetheine-phosphate adenylyltransferase [Klebsiella pneumoniae
           342]
 gi|288933011|ref|YP_003437070.1| pantetheine-phosphate adenylyltransferase [Klebsiella variicola
           At-22]
 gi|290511804|ref|ZP_06551172.1| pantetheine-phosphate adenylyltransferase [Klebsiella sp. 1_1_55]
 gi|226709009|sp|B5XTG9|COAD_KLEP3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|206565076|gb|ACI06852.1| pantetheine-phosphate adenylyltransferase [Klebsiella pneumoniae
           342]
 gi|288887740|gb|ADC56058.1| pantetheine-phosphate adenylyltransferase [Klebsiella variicola
           At-22]
 gi|289775594|gb|EFD83594.1| pantetheine-phosphate adenylyltransferase [Klebsiella sp. 1_1_55]
          Length = 159

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 93/162 (57%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPITNGH+DI+ +A S  + +V+AI  +  K K   ++ ER  L  Q+ 
Sbjct: 1   MSTKAIYPGTFDPITNGHIDIVTRAASMFDKVVLAIAASPSK-KPMFTLDERIALATQAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +      V VI F  L  + A+   A +++RGLR + DF+YEM++  +NR L P + 
Sbjct: 60  AHLV-----NVEVIGFSDLMASFARAQQANILIRGLRAVADFEYEMQLAHMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           ++ L   +   +++S+L++ +     D++ F+P  V   L N
Sbjct: 115 SVFLMPCKEWSFISSSLVKEVARHQGDVSHFLPANVHQALLN 156


>gi|260575235|ref|ZP_05843235.1| pantetheine-phosphate adenylyltransferase [Rhodobacter sp. SW2]
 gi|259022495|gb|EEW25791.1| pantetheine-phosphate adenylyltransferase [Rhodobacter sp. SW2]
          Length = 163

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 91/160 (56%), Gaps = 1/160 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII +A+  V+ LVI +  N  K   F S++ER  +++    
Sbjct: 1   MRIGLYPGTFDPVTLGHVDIIQRAMQLVDRLVIGVAINRDKAPLF-SLEERVAMVQAECQ 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             I  +   + V  FE L ++ A+D+ A +I+RGLR + DF+YE +M  +NR L   I T
Sbjct: 60  GIIAKTGGEILVHPFENLLIDCARDVGAGIIIRGLRAVADFEYEFQMVGMNRALDSSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + + A    + + S L++ +  +  D++ FV   V   L+
Sbjct: 120 VFMMADARRQAIASKLVKEIARLGGDVSKFVTPAVQEVLR 159


>gi|254784498|ref|YP_003071926.1| pantetheine-phosphate adenylyltransferase [Teredinibacter turnerae
           T7901]
 gi|259491324|sp|C5BLM4|COAD_TERTT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|237686408|gb|ACR13672.1| pantetheine-phosphate adenylyltransferase [Teredinibacter turnerae
           T7901]
          Length = 162

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 104/173 (60%), Gaps = 12/173 (6%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++ VY G+FDPITNGH+D++ +A    + +VIA+  ++ K   F +++ER  L ++++ 
Sbjct: 1   MKRVVYPGTFDPITNGHIDLVQRASKLFDSVVIAVAASNRKGPLF-TLEERVSLAQKALS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + + V  F+ L  +L ++  A  +VRGLR ++DF+YE ++ ++NR L P + +
Sbjct: 60  HL-----SNIEVCGFDCLLKDLVEEKQAYGVVRGLRAVSDFEYEFQLANMNRALAPSMES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIK 174
           + L   E   Y++S+L++ + S+  D++ FVP  V   L +      KY+ +K
Sbjct: 115 LFLTPAEHLSYISSSLVKEIASLGGDVSKFVPKLVQSALTD------KYNELK 161


>gi|153954011|ref|YP_001394776.1| hypothetical protein CKL_1386 [Clostridium kluyveri DSM 555]
 gi|219854625|ref|YP_002471747.1| hypothetical protein CKR_1282 [Clostridium kluyveri NBRC 12016]
 gi|189082562|sp|A5N7Z7|COAD_CLOK5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254763945|sp|B9E1F8|COAD_CLOK1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|146346892|gb|EDK33428.1| CoaD [Clostridium kluyveri DSM 555]
 gi|219568349|dbj|BAH06333.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 164

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 98/157 (62%), Gaps = 6/157 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDPITNGH+DII +A    ++L++ +  N  K KG  +++ER ELI++ + 
Sbjct: 1   MSRAIYPGSFDPITNGHLDIIDRASKVFDELIVGVLVNPDK-KGLFTVEERVELIER-VV 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V V SF GL ++  K   +QVIV+GLR ++DF+YE +M+ +N+ L P I T
Sbjct: 59  KDIPN----VKVESFSGLLIDFMKKKQSQVIVKGLRAVSDFEYECQMSLMNKKLDPNIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           + + A   + +++S+ ++ +      I   VP+ V +
Sbjct: 115 VFMMASAMNSFLSSSSVKQVAMFGGCIEGLVPEEVII 151


>gi|213961774|ref|ZP_03390040.1| pantetheine-phosphate adenylyltransferase [Capnocytophaga sputigena
           Capno]
 gi|256820199|ref|YP_003141478.1| phosphopantetheine adenylyltransferase [Capnocytophaga ochracea DSM
           7271]
 gi|213955563|gb|EEB66879.1| pantetheine-phosphate adenylyltransferase [Capnocytophaga sputigena
           Capno]
 gi|256581782|gb|ACU92917.1| pantetheine-phosphate adenylyltransferase [Capnocytophaga ochracea
           DSM 7271]
          Length = 150

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/157 (36%), Positives = 96/157 (61%), Gaps = 7/157 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++A++ GSFDPIT GH DII +AL   +++V+AIG N  K   F ++++R E I+++  
Sbjct: 1   MKRALFPGSFDPITLGHYDIIKRALDLFDEIVVAIGVNGDKNYMF-TVEQRKEFIEKAF- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                   +V V +++GL V+  K+I AQ I+RGLR+  DF++E  +   NR L  +I T
Sbjct: 59  ----ADEPKVKVTTYQGLTVDFCKEIDAQFILRGLRNPADFEFEKAIAHTNRKLS-QIET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           + L     + +++S+++R +I    D T  VP+ V V
Sbjct: 114 VFLLTAARTSFISSSIVRDVIRNHGDYTVLVPESVRV 150


>gi|302342193|ref|YP_003806722.1| pantetheine-phosphate adenylyltransferase [Desulfarculus baarsii
           DSM 2075]
 gi|301638806|gb|ADK84128.1| pantetheine-phosphate adenylyltransferase [Desulfarculus baarsii
           DSM 2075]
          Length = 164

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 92/155 (59%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDPITNGH+ I+ +AL     +V+AIG NS K K   ++ ER E+I +   
Sbjct: 1   MTLAVYPGSFDPITNGHLSILRRALEIFPRIVVAIGRNSEK-KSLFTVDERLEIIGE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +  + N V   SF+GL ++    + + V++RG+R M+DF+YE +M  +NR +  ++ T
Sbjct: 57  --VTRNMNGVRAESFDGLLMDYVTGLGSNVVLRGMRAMSDFEYEFQMALMNRKINKDVQT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L       YV+ST+I+   S+  +I+  VP  V
Sbjct: 115 VFLMTDYKWFYVSSTIIKEAASLGGNISGLVPQLV 149


>gi|119717507|ref|YP_924472.1| pantetheine-phosphate adenylyltransferase [Nocardioides sp. JS614]
 gi|166216568|sp|A1SLV0|COAD_NOCSJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|119538168|gb|ABL82785.1| Phosphopantetheine adenylyltransferase [Nocardioides sp. JS614]
          Length = 159

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 98/155 (63%), Gaps = 7/155 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +AV  GSFDP+TNGH+DI+ +A +  ++LV+A G N  K++ F   +ER E++++ + 
Sbjct: 1   MTRAVCPGSFDPVTNGHLDIVRRAAAIFDELVVATGTNVSKSRLF-DPEERLEMLRE-VC 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P+    V+V+ F GL V+  +DI AQ IV+GLR   D++YE+ M  +N  L   + T
Sbjct: 59  ADLPN----VTVMGFTGLIVDFCRDIDAQAIVKGLRGGNDYEYELPMAQMNAHLT-GVET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L    S  YV+S+L++ + S+  D+++ VP  V
Sbjct: 114 VFLTTHASWGYVSSSLVKEVASLGGDVSALVPPAV 148


>gi|126732616|ref|ZP_01748413.1| pantetheine-phosphate adenylyltransferase [Sagittula stellata E-37]
 gi|126706900|gb|EBA05969.1| pantetheine-phosphate adenylyltransferase [Sagittula stellata E-37]
          Length = 163

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 90/155 (58%), Gaps = 1/155 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +  + V+ LVI +  N  K   F +++ER  +++    
Sbjct: 1   MRTGLYPGTFDPITLGHIDIIRRGATLVDRLVIGVAINRDKGPLF-TLEERVAMVEAECI 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   + V  FE L ++ A+D+ A VIVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  DIARETGCEILVHPFENLLIDCARDVGASVIVRGLRAVADFEYEYQMVGMNRTLDDSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L A+   + + S L++ +  +  D++ FV  PV
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLGGDVSKFVTPPV 154


>gi|88858463|ref|ZP_01133105.1| phosphopantetheine adenylyltransferase [Pseudoalteromonas tunicata
           D2]
 gi|88820080|gb|EAR29893.1| phosphopantetheine adenylyltransferase [Pseudoalteromonas tunicata
           D2]
          Length = 160

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 96/152 (63%), Gaps = 6/152 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPITNGH D++ +A    + +++AI  N  K K F ++ ER  L K+ +
Sbjct: 1   MNVKAIYPGTFDPITNGHSDLVARAAKMFDHVILAIAFNPNK-KPFFTLDERVALAKKVL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H IP+    V +I F GL  +LAK  +A ++VRGLR ++DF++E+++ ++NR L P++ 
Sbjct: 60  GH-IPN----VEIIGFSGLLADLAKQQNANLLVRGLRAVSDFEFELQLANMNRSLNPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           +I L     + +++S+L++ +     +I  FV
Sbjct: 115 SIFLTPSVENSFISSSLVKEVALHQGNIDKFV 146


>gi|167585417|ref|ZP_02377805.1| phosphopantetheine adenylyltransferase [Burkholderia ubonensis Bu]
          Length = 166

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/163 (33%), Positives = 99/163 (60%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F S++ER E+  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRAKKPFFSLEERLEIANEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+ F GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VKVMGFTGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              +  ++++ T++R +  +  D++ FV   V  +L   V ++
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAM 160


>gi|167750939|ref|ZP_02423066.1| hypothetical protein EUBSIR_01924 [Eubacterium siraeum DSM 15702]
 gi|167656118|gb|EDS00248.1| hypothetical protein EUBSIR_01924 [Eubacterium siraeum DSM 15702]
 gi|291531109|emb|CBK96694.1| Phosphopantetheine adenylyltransferase [Eubacterium siraeum 70/3]
 gi|291557424|emb|CBL34541.1| Phosphopantetheine adenylyltransferase [Eubacterium siraeum
           V10Sc8a]
          Length = 162

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 94/153 (61%), Gaps = 4/153 (2%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH++II +A    + +++ +  N +K   F +I ER + +++S+ 
Sbjct: 1   MKTAIYPGSFDPVTYGHLEIISRASKLFDKVIVLVSVNPLKPCSF-TIDERKQFLRESV- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             + +    V V S EGL ++   + +A VIV+GLR ++DF+YE +M   NR LC +  T
Sbjct: 59  --VAEGIGNVEVDSNEGLLIDYFNEHNADVIVKGLRAISDFEYEFQMAQANRKLCYKAET 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           I L +K    Y++S++++ +     DI+ FVP+
Sbjct: 117 IFLTSKSEYTYLSSSMVKQIAMFGGDISDFVPE 149


>gi|253581849|ref|ZP_04859073.1| phosphopantetheine adenylyltransferase [Fusobacterium varium ATCC
           27725]
 gi|251836198|gb|EES64735.1| phosphopantetheine adenylyltransferase [Fusobacterium varium ATCC
           27725]
          Length = 164

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 96/164 (58%), Gaps = 6/164 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  VY GSFDPIT GH D+I ++L   + L++A+  NS K KG+ S++ER  +IK    
Sbjct: 1   MKIGVYAGSFDPITKGHYDVIKKSLKITDKLIVAVMNNSNK-KGWFSLEERKNMIKL--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLC-PEIA 120
             + + ++R+ V SF+GL +N  K+  A +I+RGLR ++D++YE+     N  L   E+ 
Sbjct: 57  -LVGEENDRIEVKSFDGLLINFMKENGADIIIRGLRAVSDYEYELGYAFANHDLSYGEVE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           T+ + A     Y++S+ +R    + A +  FV D +   +K  V
Sbjct: 116 TVFIPAAREYMYLSSSSVREAAMVGARLDIFVDDKIAEIVKEKV 159


>gi|116873488|ref|YP_850269.1| phosphopantetheine adenylyltransferase [Listeria welshimeri serovar
           6b str. SLCC5334]
 gi|123461327|sp|A0AKF8|COAD_LISW6 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|116742366|emb|CAK21490.1| phosphopantetheine adenylyltransferase [Listeria welshimeri serovar
           6b str. SLCC5334]
          Length = 161

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 92/152 (60%), Gaps = 6/152 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AV  G+FDPITNGH+DII +A    + L +A+  NS K K   +++ER E+IKQ   H +
Sbjct: 6   AVIPGTFDPITNGHLDIIERAAKIFDVLYVAVLNNSSK-KPLFTVEERMEMIKQVTAH-L 63

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V+V S  GL V+ A    A  IVRGLR ++DF+YEM++ S+NR L  EI T  +
Sbjct: 64  PN----VAVESASGLTVDYAAKRGATAIVRGLRAVSDFEYEMQIASMNRTLNAEIETFFV 119

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
                  +++S++++ +     DI+  VP+ V
Sbjct: 120 MTNTKYSFLSSSMVKEVAQYQGDISELVPEMV 151


>gi|312865893|ref|ZP_07726114.1| pantetheine-phosphate adenylyltransferase [Streptococcus downei
           F0415]
 gi|311098297|gb|EFQ56520.1| pantetheine-phosphate adenylyltransferase [Streptococcus downei
           F0415]
          Length = 163

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 90/157 (57%), Gaps = 5/157 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++ GSFDP+TNGH+D+I +A   ++ L + I  N  K +GFL +  R  L+++     +
Sbjct: 6   GLFAGSFDPVTNGHLDLIKRASQVLDQLYVGIFYNQNK-EGFLPLSRRQALLEE----VV 60

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
            D  N   + S + LAV +AKD+ A V+VRGLR+  D  YE  M   N+ L  ++ TI L
Sbjct: 61  KDLPNVSVITSHDQLAVTVAKDLGASVLVRGLRNGQDLTYEASMDHFNQDLAQDLETIYL 120

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            AK    Y+ S+ +R L    ADI  +VP+ V + L+
Sbjct: 121 LAKPDLSYIASSRVRELTHFGADIRPYVPEVVALELE 157


>gi|254453363|ref|ZP_05066800.1| pantetheine-phosphate adenylyltransferase [Octadecabacter
           antarcticus 238]
 gi|198267769|gb|EDY92039.1| pantetheine-phosphate adenylyltransferase [Octadecabacter
           antarcticus 238]
          Length = 164

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 88/151 (58%), Gaps = 1/151 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII +A S V+ LVI +  N  K   F S++ER  +I+    
Sbjct: 1   MRVGLYPGTFDPVTLGHLDIIKRACSLVDKLVIGVAINRDKGPLF-SLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ AKD+ A +I+RGLR + DF+YE +M  +NR L   + T
Sbjct: 60  DLSAQTGCEIVAHPFENLLIHCAKDVGATIIIRGLRAVADFEYEYQMVGMNRQLDNTVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L A+   + + S L++ +  +D D++ FV
Sbjct: 120 VFLMAEAQHQAIASKLVKEIARLDGDVSKFV 150


>gi|227115117|ref|ZP_03828773.1| phosphopantetheine adenylyltransferase [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 162

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 94/162 (58%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +V+AI  +  K   F ++ ER  L K + 
Sbjct: 1   MTTKAIYPGTFDPLTNGHLDLLTRASRLFDHVVLAIAASPSKHTLF-TLDERVALAKGAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F  L V+ A+   A ++VRGLR + DF+YE+++  +N  L P + 
Sbjct: 60  QHL-----SNVEVVGFSDLMVHFAQQQKANILVRGLRAVADFEYELQLAKMNHHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           ++ L   E   +++S+L++ +     D++ F+PD +   L++
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHGGDVSHFLPDAIVSALQD 156


>gi|15615152|ref|NP_243455.1| lipopolysaccharide core biosynthesis [Bacillus halodurans C-125]
 gi|14194521|sp|Q9K9Q6|COAD_BACHD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|10175210|dbj|BAB06308.1| pantetheine-phosphate adenylyltransferase [Bacillus halodurans
           C-125]
          Length = 165

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 98/157 (62%), Gaps = 6/157 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AV  GSFDP+T GH+DII +  +  +++++A+  N  K   F S++ER EL+K++  H I
Sbjct: 5   AVCPGSFDPVTLGHLDIIQRGANVFDEVIVAVLHNRNKVPLF-SVEERLELLKKATEH-I 62

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V++ SF GL ++  K   A+ I+RGLR ++DF+YEM+  S+N+ L P++ T  +
Sbjct: 63  PN----VTIDSFNGLLIDYVKQKQAKAIIRGLRAVSDFEYEMQAASINKKLGPDVETFFM 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
                  Y++S++++ +   +AD++  VP  V   LK
Sbjct: 119 MTSNQYSYLSSSIVKEVAKYEADVSDIVPPVVAEALK 155


>gi|323340651|ref|ZP_08080903.1| pantetheine-phosphate adenylyltransferase [Lactobacillus ruminis
           ATCC 25644]
 gi|323091774|gb|EFZ34394.1| pantetheine-phosphate adenylyltransferase [Lactobacillus ruminis
           ATCC 25644]
          Length = 160

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 95/160 (59%), Gaps = 7/160 (4%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K ++ G+FDP+TNGH+D+I++A    +++++ +  N+ K K   S +ER  LI+  I   
Sbjct: 2   KVIFPGTFDPLTNGHLDLIVRASKMFDEVIVLLAENTSK-KTLFSFEERKLLIEDEI--- 57

Query: 64  IPDSSNRVSVISF-EGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
              +   VSVIS    L V+ A+ + A+ IVRG+R+  DF+YE  + S+NR L PEI TI
Sbjct: 58  --KALGNVSVISSPHELTVDAARRLGARGIVRGVRNAVDFEYEKSIASMNRHLAPEIETI 115

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   E   +V+S++I+ +     D+   VP+   + LKN
Sbjct: 116 LLTTDEKYGFVSSSMIKEVAGFGGDLCGLVPEKTALALKN 155


>gi|99080950|ref|YP_613104.1| phosphopantetheine adenylyltransferase [Ruegeria sp. TM1040]
 gi|123378978|sp|Q1GHM4|COAD_SILST RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|99037230|gb|ABF63842.1| Coenzyme A biosynthesis protein [Ruegeria sp. TM1040]
          Length = 165

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 87/151 (57%), Gaps = 1/151 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A   V+ LVI +  N  K   F  ++ER  +I+    
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRATLLVDRLVIGVAINRDKGPLF-DLEERVAMIEAECA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   + V  FE L ++ A+D+ AQVIVRGLR + DF+YE +M  +NR L   I T
Sbjct: 60  KLTEQTGTEIVVHPFENLLIDCARDVGAQVIVRGLRAVADFEYEFQMVGMNRALDDSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L A+   + + S L++ +  +  D++ FV
Sbjct: 120 VFLMAEARHQAIASKLVKEISRLGGDVSKFV 150


>gi|291542206|emb|CBL15316.1| Phosphopantetheine adenylyltransferase [Ruminococcus bromii L2-63]
          Length = 161

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 95/166 (57%), Gaps = 10/166 (6%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  +  GSFDP+T GH+D+I +A    + +++ +  NS K K   SI ER EL+K+  
Sbjct: 1   MNKTVICPGSFDPVTLGHLDVITRASKLFDRVIVGVLVNSSK-KPIFSIDERIELLKEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V ++ F GL     +D     IV+GLR +TDF+YE +M   N+ L P + 
Sbjct: 60  EHL-----DNVEIVGFNGLLAQYCEDHGVDAIVKGLRAVTDFEYEFQMALTNKKLNPNLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP----DPVCVFLKN 162
           T+ L A+  S Y++S+++R + S+  DI++FVP    D +   LKN
Sbjct: 115 TLFLTAEADSMYLSSSMVREIASMGGDISNFVPACIHDRIVERLKN 160


>gi|269137428|ref|YP_003294128.1| phosphopantetheine adenylyltransferase [Edwardsiella tarda EIB202]
 gi|267983088|gb|ACY82917.1| phosphopantetheine adenylyltransferase [Edwardsiella tarda EIB202]
 gi|304557502|gb|ADM40166.1| Phosphopantetheine adenylyltransferase [Edwardsiella tarda FL6-60]
          Length = 161

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 94/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y G+FDP+TNGH+DI+ +A    + +++AI  +  K +   +++ER  + ++  
Sbjct: 1   MSRTAIYPGTFDPLTNGHLDIVTRAAHMFDRVILAIAASPGK-RPLFTLEERVAMAREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V  F  L  + A+   A ++VRGLR ++DF+YE+++ ++NR L P + 
Sbjct: 60  AHLA-----NVEVQGFSELMAHFAQRQRANILVRGLRAVSDFEYELQLANMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E+  +++S+L++ +     D+ +F+P+PV 
Sbjct: 115 SVFLMPAEAWSFISSSLVKEVARHGGDVDAFLPEPVA 151


>gi|50119111|ref|YP_048278.1| phosphopantetheine adenylyltransferase [Pectobacterium atrosepticum
           SCRI1043]
 gi|61212573|sp|Q6DAV2|COAD_ERWCT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|49609637|emb|CAG73070.1| phosphopantetheine adenylyltransferase [Pectobacterium atrosepticum
           SCRI1043]
          Length = 159

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 90/157 (57%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +V+AI  +  K   F ++ ER  L   + 
Sbjct: 1   MTTKAIYPGTFDPLTNGHLDLLTRAARLFDHVVLAIAASPSKNTLF-TLDERVALANDAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V VI F  L V+ A+   A ++VRGLR + DF+YE+++  +N  L P + 
Sbjct: 60  QHL-----SNVEVIGFSDLMVHFAQQQKANILVRGLRAVADFEYELQLAKMNHHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E   +++S+L++ +     D+T F+PD + 
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHGGDVTHFLPDAIV 151


>gi|193212899|ref|YP_001998852.1| phosphopantetheine adenylyltransferase [Chlorobaculum parvum NCIB
           8327]
 gi|229488129|sp|B3QNZ9|COAD_CHLP8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|193086376|gb|ACF11652.1| pantetheine-phosphate adenylyltransferase [Chlorobaculum parvum
           NCIB 8327]
          Length = 166

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 89/152 (58%), Gaps = 5/152 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M RKA+Y G+FDP TNGH+D++ +AL+  + + + +  NS K   F S+ ER E++ + +
Sbjct: 1   MTRKAIYPGTFDPFTNGHLDVLERALNIFDHVEVVLAENSQKQTLF-SVDERLEMVHEVV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F    SN    +   GL  + A+   A  IVRG+R + DF+YE +M+ +NR L PE+ 
Sbjct: 60  REF----SNVSVDVLHAGLLADYARQAGASAIVRGVRQVKDFEYEFQMSLLNRHLYPEVT 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           T+ L       YV ST+IR +  +  D++ FV
Sbjct: 116 TVFLMPNVKYTYVASTIIREVSMLGGDVSKFV 147


>gi|325690227|gb|EGD32231.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           SK115]
          Length = 164

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 93/160 (58%), Gaps = 7/160 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+T GH+D+I +A    + L + I  N  K+ GF +I+ R  ++K+++ H  
Sbjct: 6   GLFTGSFDPMTKGHVDLIERASRLFDKLYVGIFYNREKS-GFFTIEARERMVKEALQHL- 63

Query: 65  PDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V VI+ +  LAV +A+ +  Q  VRGLR+  D DYE  M   N  L  E+ TI 
Sbjct: 64  ----DNVEVITSQNELAVTVARRLGTQAFVRGLRNSQDLDYEANMNFFNHELAGELETIF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L +K   ++++S+ IR LI+   DI ++VP  V   L+ I
Sbjct: 120 LLSKPDYQHISSSRIRELIAFQQDIAAYVPQSVIKELERI 159


>gi|197286979|ref|YP_002152851.1| phosphopantetheine adenylyltransferase [Proteus mirabilis HI4320]
 gi|227354781|ref|ZP_03839198.1| phosphopantetheine adenylyltransferase [Proteus mirabilis ATCC
           29906]
 gi|29427852|sp|Q8RSX4|COAD_PROMI RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229500856|sp|B4F0X7|COAD_PROMH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|18762493|gb|AAL78072.1| phosphopantetheine adenyltransferase [Proteus mirabilis]
 gi|194684466|emb|CAR46217.1| phosphopantetheine adenylyltransferase [Proteus mirabilis HI4320]
 gi|227165099|gb|EEI49930.1| phosphopantetheine adenylyltransferase [Proteus mirabilis ATCC
           29906]
 gi|301072214|gb|ADK56068.1| CoaD [Proteus mirabilis]
 gi|301072236|gb|ADK56089.1| CoaD [Proteus mirabilis]
 gi|312598038|gb|ADQ89972.1| phosphopantetheine adenyltransferase [Proteus mirabilis]
 gi|312598059|gb|ADQ89992.1| phosphopantetheine adenyltransferase [Proteus mirabilis]
          Length = 161

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 98/157 (62%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPIT GH+DI+ +A    + +++AI  ++ K   F S++ER  L K+  
Sbjct: 1   MKNKAIYPGTFDPITYGHIDILTRAAGMFDTVLLAIAASARKNPMF-SLEERVALAKEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V V+ F  L  N AK   A +++RG+R ++DF+YE ++ ++NR   P++ 
Sbjct: 60  QH-LPN----VEVVGFCELMANFAKKQQATILIRGVRSVSDFEYEWQLANMNRHFAPDLD 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   ++  +V+S+LI+ +   D D+++F+P+ V 
Sbjct: 115 SVFLLPSQNLSFVSSSLIKDVARHDGDVSTFLPEVVA 151


>gi|270265224|ref|ZP_06193486.1| phosphopantetheine adenylyltransferase [Serratia odorifera 4Rx13]
 gi|270040858|gb|EFA13960.1| phosphopantetheine adenylyltransferase [Serratia odorifera 4Rx13]
          Length = 161

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 92/157 (58%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +++AI  +  K K   +++ER  L  Q  
Sbjct: 1   MTSKAIYPGTFDPLTNGHLDLVTRASLMFDHVILAIAASPSK-KPLFTLEERVALATQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F  L  + A   +A ++VRGLR ++DF+YE+++ ++NR L P + 
Sbjct: 60  SHL-----DNVEVLGFSELMAHFAAHQNANILVRGLRAVSDFEYELQLANMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E   +++S+L++ +     DI  F+PD V 
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHGGDIAPFLPDVVT 151


>gi|190150460|ref|YP_001968985.1| phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|307263804|ref|ZP_07545410.1| Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|229488113|sp|B3GY20|COAD_ACTP7 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189915591|gb|ACE61843.1| phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|306870925|gb|EFN02663.1| Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 158

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 88/157 (56%), Gaps = 6/157 (3%)

Query: 6   VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIP 65
           +Y G+FDP+TNGH+DII +A      +++A+  N  K   F S++ER+ L++QS  H   
Sbjct: 6   IYAGTFDPMTNGHLDIIERASELFGQVIVAVAKNPSKQPLF-SLEERTALVRQSCAHLA- 63

Query: 66  DSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALF 125
                V  + F GL  + AK   A+ +VRG+R   D +YE+R+  +N  L   + T+ L 
Sbjct: 64  ----NVQAVGFSGLLADFAKQHQAKALVRGIRGSDDIEYEIRLAQLNDKLSGRLDTVFLP 119

Query: 126 AKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
              + RY++ST++R +     D+  FVP+ V   LK 
Sbjct: 120 PSVTWRYLSSTMVREIYRHQGDVAQFVPNAVLCALKE 156


>gi|260435860|ref|ZP_05789830.1| pantetheine-phosphate adenylyltransferase [Synechococcus sp. WH
           8109]
 gi|260413734|gb|EEX07030.1| pantetheine-phosphate adenylyltransferase [Synechococcus sp. WH
           8109]
          Length = 163

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 92/154 (59%), Gaps = 6/154 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           +A+Y GSFDP+TNGHMD+I +A+S   ++V+A+  N  K   F S++ER E I+ +  H 
Sbjct: 2   RALYPGSFDPLTNGHMDLIERAVSLFGEVVVAVLSNPSKRPAF-SVEERIEQIRTATCHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V VISF+GL VN A    A +I+RGLR M+DF+YE+++   NR L  ++ T+ 
Sbjct: 61  -----SGVEVISFDGLTVNCAVTHRADLILRGLRAMSDFEYELQIAHTNRSLADDLETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           +       +++S++++ +      I   VP  V 
Sbjct: 116 MATTARHSFLSSSVVKEVARFGGSIDHMVPPEVA 149


>gi|33594350|ref|NP_881994.1| phosphopantetheine adenylyltransferase [Bordetella pertussis Tohama
           I]
 gi|33595532|ref|NP_883175.1| phosphopantetheine adenylyltransferase [Bordetella parapertussis
           12822]
 gi|33599930|ref|NP_887490.1| phosphopantetheine adenylyltransferase [Bordetella bronchiseptica
           RB50]
 gi|61212734|sp|Q7VTP4|COAD_BORPE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|61212735|sp|Q7W154|COAD_BORPA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|61212741|sp|Q7WNU4|COAD_BORBR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|33564425|emb|CAE43734.1| phosphopantetheine adenylyltransferase [Bordetella pertussis Tohama
           I]
 gi|33565610|emb|CAE40256.1| phosphopantetheine adenylyltransferase [Bordetella parapertussis]
 gi|33567527|emb|CAE31440.1| phosphopantetheine adenylyltransferase [Bordetella bronchiseptica
           RB50]
          Length = 169

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 98/157 (62%), Gaps = 6/157 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A +  + +V+ I  +S   K F +I+ER ++ ++ + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRAATLFDKVVVGI-AHSRNKKPFFTIEERVDIAREVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V SF GL  +  +D + +VI+RGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VEVHSFGGLLKDFVRDQNGRVIIRGLRAVSDFEYEFQMAGMNRHLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
              +  ++++ T++R +  +  D++ FV   V  +L+
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLQ 154


>gi|116334001|ref|YP_795528.1| phosphopantetheine adenylyltransferase [Lactobacillus brevis ATCC
           367]
 gi|122269315|sp|Q03QM5|COAD_LACBA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|116099348|gb|ABJ64497.1| Phosphopantetheine adenylyltransferase [Lactobacillus brevis ATCC
           367]
          Length = 161

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/156 (36%), Positives = 93/156 (59%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AV+ GSFDP+TNGH+D+I +A    + L++ +G N+ K +G  +  ER   I+ +I 
Sbjct: 1   MTIAVFPGSFDPLTNGHVDLITRASRMFDQLIVTVGKNTSK-QGLFTTSERVAFIEAAIA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P+    V+V   +GL V+  K + A V+VRG+R+ TDF+YE  + ++NR L P++ T
Sbjct: 60  A-LPN----VTVQVEQGLTVDFMKSVQATVLVRGIRNSTDFEYEQGIANLNRHLAPQVDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
             L A    +YV+S+L++ +     D+   VP  V 
Sbjct: 115 ACLMADPQYQYVSSSLLKEVARFGGDLKQLVPSMVA 150


>gi|327473426|gb|EGF18846.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           SK408]
          Length = 164

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 95/160 (59%), Gaps = 7/160 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+T GH+D+I +A    + L I I  N  K+ GF +I+ R  ++K+++ H  
Sbjct: 6   GLFTGSFDPMTTGHVDLIERASRLFDKLYIGIFYNREKS-GFFTIEARERMVKEALQHL- 63

Query: 65  PDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V VI+ +  LAV +A+ + A+  VRGLR+  D DYE  M   N+ L  E+ TI 
Sbjct: 64  ----DNVEVITSQNELAVTVARRLGAKAFVRGLRNSQDLDYEANMNFFNQELAGELETIF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L +K   ++++S+ IR LI+   DI ++VP  V   L+ I
Sbjct: 120 LLSKPVYQHISSSRIRELIAFQQDIVAYVPQSVIKELERI 159


>gi|261856151|ref|YP_003263434.1| pantetheine-phosphate adenylyltransferase [Halothiobacillus
           neapolitanus c2]
 gi|261836620|gb|ACX96387.1| pantetheine-phosphate adenylyltransferase [Halothiobacillus
           neapolitanus c2]
          Length = 174

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 99/163 (60%), Gaps = 6/163 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++A+Y G+FDPIT GH+D+  +A    +++++A+   S KT  F ++ +R EL  +++ 
Sbjct: 1   MKRAIYPGTFDPITFGHIDVARRAAHLYDEVIVAVAAASTKTPLF-NLDQRCELALKAL- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               +    + V  F GL V+ A+   +  IVRGLR ++DF+ E++M +VNR L PEI T
Sbjct: 59  ----ECYPNIRVEPFGGLLVDFARQSQSCSIVRGLRAVSDFESEIQMAAVNRRLAPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIV 164
           + L   E   +V+S+++R L  +  ++ SFVP  V   LK I+
Sbjct: 115 VFLSPTEELGFVSSSIVRELARLGGNVASFVPLHVVDALKEII 157


>gi|331265660|ref|YP_004325290.1| phosphopantetheine adenylyltransferase [Streptococcus oralis Uo5]
 gi|326682332|emb|CBY99949.1| phosphopantetheine adenylyltransferase [Streptococcus oralis Uo5]
          Length = 162

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 94/159 (59%), Gaps = 7/159 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+TNGH+D+I +A    + L + +  N  K +GFL ++ R   +++++ H  
Sbjct: 6   GLFTGSFDPMTNGHLDMIERASKLFDKLYVGVFYNPHK-QGFLPVENRKRAVEKAVAHL- 63

Query: 65  PDSSNRVSVI-SFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V V+ S + L V++A+ + A+ +VRGLR+ TD  YE      N  L PEI TI 
Sbjct: 64  ----DNVEVLASHDQLVVDVARRLGAKTLVRGLRNTTDLQYESSFDYYNHQLAPEIETIY 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           L+++    Y++S+ +R L+    +I  +VP+ V   L++
Sbjct: 120 LYSRPEHLYISSSAVRELLKFGQEIQQYVPNSVVEELEH 158


>gi|89894059|ref|YP_517546.1| hypothetical protein DSY1313 [Desulfitobacterium hafniense Y51]
 gi|122483302|sp|Q24XZ0|COAD_DESHY RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|89333507|dbj|BAE83102.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 163

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/155 (36%), Positives = 97/155 (62%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y G+FDP+TNGH+DI+ +A  F +++++A+  +S KT  F S++ER +L++ +  
Sbjct: 1   MRIAIYPGTFDPVTNGHLDILKRATEFFDEVIVAVAVDSNKTTLF-SLEERIQLLETA-- 57

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               +  ++V +  FEGL V  A+   A  I+RGLR M DF+YE ++  +N+ L  +I T
Sbjct: 58  ---AEELSQVKIRGFEGLTVEFARQCGANAIIRGLRAMQDFEYEFQLALMNKKLAADIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           I L  +    +++S+ I+   S+  +I+ FVP  V
Sbjct: 115 IFLMTQSEFSFISSSSIKWAASLKGNISEFVPPHV 149


>gi|260427164|ref|ZP_05781143.1| pantetheine-phosphate adenylyltransferase [Citreicella sp. SE45]
 gi|260421656|gb|EEX14907.1| pantetheine-phosphate adenylyltransferase [Citreicella sp. SE45]
          Length = 163

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 91/160 (56%), Gaps = 1/160 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F  +++R  +I+    
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRAAALVDRLVIGVAINRDKGPLF-PLEDRVAMIEAECR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +   +    FE L ++ A D+ AQ+IVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  ELSEQTGTEIVPHPFENLLIDCAHDVGAQIIVRGLRAVADFEYEFQMVGMNRVLDDSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L A+   + + S L++ +  +  D+++FV  PV   LK
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLGGDVSNFVTPPVHEALK 159


>gi|197122520|ref|YP_002134471.1| phosphopantetheine adenylyltransferase [Anaeromyxobacter sp. K]
 gi|220917305|ref|YP_002492609.1| pantetheine-phosphate adenylyltransferase [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|229488115|sp|B4UCU5|COAD_ANASK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254763922|sp|B8J9D7|COAD_ANAD2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|196172369|gb|ACG73342.1| pantetheine-phosphate adenylyltransferase [Anaeromyxobacter sp. K]
 gi|219955159|gb|ACL65543.1| pantetheine-phosphate adenylyltransferase [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 164

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 92/153 (60%), Gaps = 6/153 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+ II + L+  + LV+A+  N  K+  F ++ ER  LI++++
Sbjct: 1   MNRAAIYPGSFDPLTNGHLAIIQRGLNLFDRLVVAVANNPQKSPMF-TVDERKALIREAV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +  RV V SF+GL V+ A+      ++RGLR ++DF+YE ++ ++N+ L PE  
Sbjct: 60  -----GNDPRVEVDSFDGLMVDYARTRGIPKVLRGLRAVSDFEYEFQLANMNKKLLPEFE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           ++ +   E   +V++ L+R +     ++   VP
Sbjct: 115 SVFVMTGEDYFFVSARLVREVAQFGGNVEGLVP 147


>gi|323705487|ref|ZP_08117062.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535389|gb|EGB25165.1| pantetheine-phosphate adenylyltransferase [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 159

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 93/155 (60%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP+TNGH+D+I +A    + L++A+  N  KT  F S++ER E++K+   
Sbjct: 1   MNIAVYPGSFDPVTNGHLDVIKRAAKVFDKLIVAVLVNPSKTPMF-SLEERVEMLKE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +      V + SF GL +   + +++++IV+GLR ++DF+YE +M  +N+ L PE+ T
Sbjct: 57  --VTADIENVEIDSFSGLLIEYLEKVNSKIIVKGLRMVSDFEYEFQMALINKKLNPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           I         Y++S++++ +      ++  VPD V
Sbjct: 115 IFFMTSNKYGYLSSSIVKEVARFGGFLSDLVPDSV 149


>gi|323484800|ref|ZP_08090157.1| hypothetical protein HMPREF9474_01908 [Clostridium symbiosum
           WAL-14163]
 gi|323691873|ref|ZP_08106127.1| pantetheine-phosphate adenylyltransferase [Clostridium symbiosum
           WAL-14673]
 gi|323401906|gb|EGA94247.1| hypothetical protein HMPREF9474_01908 [Clostridium symbiosum
           WAL-14163]
 gi|323504080|gb|EGB19888.1| pantetheine-phosphate adenylyltransferase [Clostridium symbiosum
           WAL-14673]
          Length = 166

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 92/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDP+T GH DII ++    + L++ +  NS K+  F S++ER  ++K    
Sbjct: 1   MKTAIYPGSFDPVTLGHYDIIERSSKIFDKLIVGVLNNSAKSPLF-SVEERVNMLKDVTS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           HF P+    V V SF GL ++  +   A VIVRGLR +TDF+YE+++  +NR + PEI T
Sbjct: 60  HF-PN----VEVQSFAGLLIDFVRSNDANVIVRGLRAITDFEYELQLAQMNRVIAPEIDT 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L       Y++S++ + +     DI+SF+
Sbjct: 115 LFLTTNLKYAYLSSSMAKEVAMYGGDISSFL 145


>gi|323352767|ref|ZP_08087737.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           VMC66]
 gi|322121803|gb|EFX93549.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           VMC66]
          Length = 164

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 94/160 (58%), Gaps = 7/160 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+T GH+D+I +A    + L + I  N  K+ GF +I+ R  ++K+++ H  
Sbjct: 6   GLFTGSFDPMTKGHVDLIERASRLFDKLYVGIFYNREKS-GFFTIESRERMVKEALQHL- 63

Query: 65  PDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V VI+ +  LAV +A+ +  Q  VRGLR+  D DYE  M   N+ L  E+ TI 
Sbjct: 64  ----DNVEVITSQNELAVTVARRLGTQAFVRGLRNSQDLDYEANMNFFNQELAGEMETIF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L +K   ++++S+ IR LI+   DI ++VP  V   L+ I
Sbjct: 120 LLSKPVYQHISSSRIRELIAFQQDIAAYVPQSVIKELERI 159


>gi|319945303|ref|ZP_08019565.1| pantetheine-phosphate adenylyltransferase [Lautropia mirabilis ATCC
           51599]
 gi|319741873|gb|EFV94298.1| pantetheine-phosphate adenylyltransferase [Lautropia mirabilis ATCC
           51599]
          Length = 168

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 94/153 (61%), Gaps = 8/153 (5%)

Query: 6   VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIP 65
           VY G+FDP+T GH D++ +  +  E +V+AI  +  +T    ++ ER ++ K +I   +P
Sbjct: 5   VYPGTFDPLTLGHQDVVNRVAAHHESVVVAI--SDSRTNTLFTMAERVDMAK-AILVGLP 61

Query: 66  DSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALF 125
           +    V V+SF GL  + A+DI A +IVRGLRD +DFDYE RM S+NR L P I T  + 
Sbjct: 62  N----VRVMSFSGLVTDFARDIGANLIVRGLRDASDFDYERRMASLNRILQPTIDTHFII 117

Query: 126 AKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
             +  + +T TL+R +  +  D+ +FV +PV +
Sbjct: 118 PDDRYQSITGTLVREIAMMGGDVRAFV-NPVVL 149


>gi|302874762|ref|YP_003843395.1| pantetheine-phosphate adenylyltransferase [Clostridium
           cellulovorans 743B]
 gi|307690623|ref|ZP_07633069.1| phosphopantetheine adenylyltransferase [Clostridium cellulovorans
           743B]
 gi|302577619|gb|ADL51631.1| pantetheine-phosphate adenylyltransferase [Clostridium
           cellulovorans 743B]
          Length = 166

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 99/160 (61%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR AVY GSFDPITNGH+DII +++   +++++ +  N  K KG  + +ER ELIK+ + 
Sbjct: 1   MRVAVYPGSFDPITNGHLDIIKRSVKVFDEVIVTVLINPEK-KGLFTPEERVELIKK-VV 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP+    V V SF GL V+  ++ ++ +I++GLR ++DF+YE +M  +N  L   + T
Sbjct: 59  KDIPN----VRVESFFGLLVDFMREKNSNIIIKGLRAVSDFEYEFQMALINNTLDANVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + +     + +++S+ ++ +   + DIT  VP+ V   LK
Sbjct: 115 LFMMTSAQNLFLSSSSVKQVAMFNGDITGLVPEVVAEELK 154


>gi|28210921|ref|NP_781865.1| phosphopantetheine adenylyltransferase [Clostridium tetani E88]
 gi|28203360|gb|AAO35802.1| phosphopantetheine adenylyltransferase [Clostridium tetani E88]
          Length = 175

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 92/155 (59%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDPITNGH+DII +A    + +V+ I  N  K KG  SI+ER +LI +   
Sbjct: 16  MNIAVYPGSFDPITNGHLDIIKRASQVFDKVVVGILVNPDK-KGLFSIEEREKLISR--- 71

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             + D  N V V SF GL V+  K+ + +VI++GLR M+DF+YE +M  +N+ L P+I T
Sbjct: 72  -VVKDMPN-VEVRSFSGLLVDFMKEENIKVIIKGLRAMSDFEYEFQMALMNKKLNPDIET 129

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + +       Y++S+ I+ +      I   VPD +
Sbjct: 130 LFMMTCAQYSYLSSSSIKQVAMFGGCIKGLVPDEI 164


>gi|167856187|ref|ZP_02478924.1| phosphopantetheine adenylyltransferase [Haemophilus parasuis 29755]
 gi|219871557|ref|YP_002475932.1| phosphopantetheine adenylyltransferase [Haemophilus parasuis
           SH0165]
 gi|254764156|sp|B8F6N2|COAD_HAEPS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|167852676|gb|EDS23953.1| phosphopantetheine adenylyltransferase [Haemophilus parasuis 29755]
 gi|219691761|gb|ACL32984.1| phosphopantetheine adenylyltransferase [Haemophilus parasuis
           SH0165]
          Length = 155

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 93/161 (57%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  +Y G+FDPITNGH+DII ++      +++A+  N  K   F S+++R EL++QS 
Sbjct: 1   MNQTVIYAGTFDPITNGHLDIIQRSSRLFGKVIVAVAKNPSKQPLF-SLEQRVELVQQSC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   N V VI F GL V+ AK  +A  ++RG+R   D +YE+++  +N+ L  ++ 
Sbjct: 60  QML-----NNVEVIGFSGLLVDFAKQHNATTLIRGIRGADDIEYEIQLAQLNQKLAGQLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           TI L      RY++ST++R +     D+  FVP+ V   L+
Sbjct: 115 TIFLPPAVEWRYLSSTMVREIYRHQGDVGQFVPEIVLKSLR 155


>gi|31563016|sp|Q895N8|COAD_CLOTE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
          Length = 160

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 92/155 (59%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDPITNGH+DII +A    + +V+ I  N  K KG  SI+ER +LI +   
Sbjct: 1   MNIAVYPGSFDPITNGHLDIIKRASQVFDKVVVGILVNPDK-KGLFSIEEREKLISR--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             + D  N V V SF GL V+  K+ + +VI++GLR M+DF+YE +M  +N+ L P+I T
Sbjct: 57  -VVKDMPN-VEVRSFSGLLVDFMKEENIKVIIKGLRAMSDFEYEFQMALMNKKLNPDIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + +       Y++S+ I+ +      I   VPD +
Sbjct: 115 LFMMTCAQYSYLSSSSIKQVAMFGGCIKGLVPDEI 149


>gi|219668440|ref|YP_002458875.1| phosphopantetheine adenylyltransferase [Desulfitobacterium
           hafniense DCB-2]
 gi|254763947|sp|B8FTK5|COAD_DESHD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|219538700|gb|ACL20439.1| pantetheine-phosphate adenylyltransferase [Desulfitobacterium
           hafniense DCB-2]
          Length = 163

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/155 (36%), Positives = 97/155 (62%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y G+FDP+TNGH+DI+ +A  F +++++A+  +S KT  F S++ER +L++ +  
Sbjct: 1   MRIAIYPGTFDPVTNGHLDILKRATEFFDEVIVAVAVDSNKTTLF-SLEERIQLLETA-- 57

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               +  ++V +  FEGL V  A+   A  I+RGLR M DF+YE ++  +N+ L  +I T
Sbjct: 58  ---AEELSQVKIRGFEGLTVEFARQCGANAIIRGLRAMQDFEYEFQLALMNKKLAADIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           I L  +    +++S+ I+   S+  +I+ FVP  V
Sbjct: 115 IFLMTQSEFSFISSSSIKWAASLKGNISEFVPPHV 149


>gi|187922587|ref|YP_001894229.1| phosphopantetheine adenylyltransferase [Burkholderia phytofirmans
           PsJN]
 gi|229488127|sp|B2SXG0|COAD_BURPP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|187713781|gb|ACD15005.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           phytofirmans PsJN]
          Length = 171

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 101/163 (61%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F +++ER ++  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRNKKPFFTLEERLDIAHEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+SF+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VQVMSFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              +  ++++ T++R +  +  D++ FV   V  +L   V ++
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAM 160


>gi|57239074|ref|YP_180210.1| phosphopantetheine adenylyltransferase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161153|emb|CAH58066.1| putative phosphopantetheine adenylyltransferase [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 165

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 98/161 (60%), Gaps = 5/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y G+FDPIT GH+DII +A + V+ L+I +   S   K   S + R+ELI+    
Sbjct: 1   MKIGIYPGTFDPITFGHIDIIKRAYNLVDKLIIGV-ARSCSKKTIFSAEIRAELIE---- 55

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +   +  V  + F+GL V  A+  +A VI+RGLR ++DFDYE +M+ VN  L   I T
Sbjct: 56  HEMKLLNMMVDTVIFDGLLVYFAQKNNASVIIRGLRAISDFDYEFQMSWVNYKLNQNIET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           I L A E +++++S+ ++ +  +  DI+ FV + V  +LK+
Sbjct: 116 IFLPAAEDTQFISSSFVKEIARLKGDISVFVSENVGQYLKD 156


>gi|8469201|sp|Q9X980|COAD_SERMA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|4753138|gb|AAD28804.1| phosphopantetheine adenylyltransferase CoaD [Serratia marcescens]
 gi|18762511|gb|AAL78079.1| phosphopantetheine adenyltransferase [Yersinia enterocolitica]
          Length = 161

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/157 (33%), Positives = 91/157 (57%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +++AI  +  K K   S+ ER  L  Q  
Sbjct: 1   MTSKAIYPGTFDPMTNGHLDLVTRASLMFDHVILAIAASPSK-KPLFSLDERVALATQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F  L  + A   +A ++VRGLR ++DF+YE+++ ++NR L P + 
Sbjct: 60  SHL-----DNVEVLGFSELMAHFAAHQNANILVRGLRAVSDFEYELQLANMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E   +++S+L++ +     DI  F+PD V 
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHGGDIAPFLPDVVT 151


>gi|186475079|ref|YP_001856549.1| phosphopantetheine adenylyltransferase [Burkholderia phymatum
           STM815]
 gi|229488126|sp|B2JCN4|COAD_BURP8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|184191538|gb|ACC69503.1| pantetheine-phosphate adenylyltransferase [Burkholderia phymatum
           STM815]
          Length = 168

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/163 (33%), Positives = 102/163 (62%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   + F +++ER E+  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRNKRPFFNLEERLEIANEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+SF+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VQVMSFKGLLKDFVRVNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              +  ++++ T++R +  +  D++ FV   V   L++ V +L
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKRLQDKVAAL 160


>gi|53715825|ref|YP_101817.1| phosphopantetheine adenylyltransferase [Bacteroides fragilis YCH46]
 gi|60683746|ref|YP_213890.1| phosphopantetheine adenylyltransferase [Bacteroides fragilis NCTC
           9343]
 gi|253564644|ref|ZP_04842101.1| phosphopantetheine adenylyltransferase [Bacteroides sp. 3_2_5]
 gi|265764693|ref|ZP_06092968.1| pantetheine-phosphate adenylyltransferase [Bacteroides sp. 2_1_16]
 gi|61212531|sp|Q64MK4|COAD_BACFR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|81313207|sp|Q5L7F1|COAD_BACFN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|52218690|dbj|BAD51283.1| phosphopantetheine adenylyltransferase [Bacteroides fragilis YCH46]
 gi|60495180|emb|CAH10001.1| putative phosphopantetheine adenylyltransferase [Bacteroides
           fragilis NCTC 9343]
 gi|251948420|gb|EES88702.1| phosphopantetheine adenylyltransferase [Bacteroides sp. 3_2_5]
 gi|263254077|gb|EEZ25511.1| pantetheine-phosphate adenylyltransferase [Bacteroides sp. 2_1_16]
 gi|301165331|emb|CBW24903.1| putative phosphopantetheine adenylyltransferase [Bacteroides
           fragilis 638R]
          Length = 150

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 95/152 (62%), Gaps = 7/152 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+A++ G+FDP T GH  ++ + L+F++++VI IG N  K   +  I++R E+I++   
Sbjct: 1   MRRAIFPGTFDPFTIGHYSVVQRTLTFMDEVVIGIGINENKNT-YFPIEKRVEMIRK--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F  D   R+ V S++ L ++ A+ + AQ IVRG+R + DF+YE  +  +NR L   I T
Sbjct: 57  -FYKDEP-RIKVESYDCLTIDFARQVDAQFIVRGIRTVKDFEYEETIADINRKLAG-IET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           I LF +     V+ST++R L+  + DI+ F+P
Sbjct: 114 ILLFTEPELTCVSSTIVRELLGYNKDISMFIP 145


>gi|183597228|ref|ZP_02958721.1| hypothetical protein PROSTU_00471 [Providencia stuartii ATCC 25827]
 gi|188023542|gb|EDU61582.1| hypothetical protein PROSTU_00471 [Providencia stuartii ATCC 25827]
          Length = 161

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/157 (36%), Positives = 97/157 (61%), Gaps = 7/157 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPIT+GH+DI+ +A +  + +++AI  NS +     +++ER EL ++  
Sbjct: 1   MKHKAIYPGTFDPITSGHIDIVSRAAAMFDHVLLAI-ANSQRKSPMFTLEERVELAQKVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      N V V+ F  L  N A+   A +++RG+R + DF+YE ++ ++NR   PE+ 
Sbjct: 60  SHL-----NNVEVVGFSELMANFAQKHGANILIRGVRSVADFEYEWQLANMNRHFVPELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           T+ L   +S  +V+S+LI+ +   D DI+SF+P PV 
Sbjct: 115 TVFLLPSQSLSFVSSSLIKDVALHDGDISSFLP-PVV 150


>gi|324990697|gb|EGC22633.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           SK353]
          Length = 164

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 94/160 (58%), Gaps = 7/160 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP++ GH+D+I +A    + L + I  N  K+ GF +I+ R  ++K+++ H  
Sbjct: 6   GLFTGSFDPMSKGHVDLIERASRLFDKLYVGIFYNREKS-GFFTIEARERMVKEALQHL- 63

Query: 65  PDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V VI+ +  LAV +A+ +  Q  VRGLR+  D DYE  M   N+ L  E+ TI 
Sbjct: 64  ----DNVEVITSQNELAVTVARRLGTQAFVRGLRNSQDLDYEANMNFFNQELAEELETIF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L +K   ++++S+ IR LI+   DI ++VP  V   L+ I
Sbjct: 120 LLSKPDYQHISSSRIRELIAFQQDIAAYVPQSVIKELERI 159


>gi|220933485|ref|YP_002512384.1| pantetheine-phosphate adenylyltransferase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|254764184|sp|B8GUN6|COAD_THISH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|219994795|gb|ACL71397.1| pantetheine-phosphate adenylyltransferase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 159

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/157 (36%), Positives = 91/157 (57%), Gaps = 6/157 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDPITNGH DI+ +A    + +V+A+  +  K   F ++ ER  L + ++    
Sbjct: 5   AVYPGTFDPITNGHTDIVRRATRLFDRVVVAVAASPAKQP-FFNLDERVGLARDAL---- 59

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                 V V  F GL     ++  AQVI+RGLR ++DF++E ++  +NR L PE+ T+ L
Sbjct: 60  -SGLGNVEVTGFSGLLAKFMREQQAQVILRGLRAVSDFEHEFQLAGMNRHLAPELETLFL 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
              E   YV+S+L+R + ++  D++ FV  PV   LK
Sbjct: 119 TPAEEFAYVSSSLVREIAALGGDVSHFVSGPVVAALK 155


>gi|171912974|ref|ZP_02928444.1| Phosphopantetheine adenylyltransferase [Verrucomicrobium spinosum
           DSM 4136]
          Length = 171

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 97/162 (59%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI- 60
           MRK +Y GSFDPITNGH+D++ +A    ++LV+A+  ++ K +   ++ ER  +I+++  
Sbjct: 1   MRKGLYPGSFDPITNGHLDVLRRAARLFDELVVAVARDNQK-QSLFTMDERVAMIEETAQ 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H + +    VSV  FEGL V  A    A  ++RGLR ++DF++E +M  +NR L   + 
Sbjct: 60  AHGLAN----VSVQPFEGLLVEFAAREGACAVIRGLRAVSDFEFEFQMALMNRKLDDRVE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ L  +E   Y++S +++ +  +  DI +FVP  V   LK 
Sbjct: 116 TLFLTPQEELTYISSRIVKEIARLGGDIRAFVPAHVAEALKR 157


>gi|83858657|ref|ZP_00952179.1| lipopolysaccharide core biosynthesis protein KdtB [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853480|gb|EAP91332.1| lipopolysaccharide core biosynthesis protein KdtB [Oceanicaulis
           alexandrii HTCC2633]
          Length = 163

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 89/151 (58%), Gaps = 3/151 (1%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y G+FDPITNGH+DII +A+   + LVI +  N  K   F S  ER ++ ++    
Sbjct: 4   RVALYPGTFDPITNGHLDIIGRAVKLYDKLVIGVARNDAKGPLF-SFDERVDMARELAES 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
              D+   + V+ FEGL ++ A+ + A  I+RGLR ++DF+YE +M  +N+ L  +I T+
Sbjct: 63  VAGDTE--IEVLPFEGLLMHFAEKVGASSIIRGLRAVSDFEYEFQMVGMNQRLNADIETV 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVP 153
            L A    + + S L++ +  +  DI  FVP
Sbjct: 121 FLMADPRHQAIASRLVKEIAKLGGDIDPFVP 151


>gi|78777323|ref|YP_393638.1| phosphopantetheine adenylyltransferase [Sulfurimonas denitrificans
           DSM 1251]
 gi|78497863|gb|ABB44403.1| Phosphopantetheine adenylyltransferase [Sulfurimonas denitrificans
           DSM 1251]
          Length = 166

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 97/156 (62%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y G+FDPITNGH DII +AL+  +++++A+  ++ K   ++ + ER  ++K ++
Sbjct: 4   MKKIALYPGTFDPITNGHFDIIERALNLFDEVIVAVALSADKKPMYM-LDERIVMVKAAL 62

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V+V+ F+ L V LAK  +A V++RGLR ++DF+YE+++  +N  L  EI 
Sbjct: 63  MGL-----KNVTVVGFDNLTVELAKSNNATVLIRGLRAVSDFEYELQLGYLNNSLDEEIE 117

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           T+ L  K    +++S+++R+L+  +A     VP  V
Sbjct: 118 TVYLMPKLQHAFISSSIVRNLLKFNAKTEHLVPKEV 153


>gi|325263995|ref|ZP_08130728.1| pantetheine-phosphate adenylyltransferase [Clostridium sp. D5]
 gi|324031033|gb|EGB92315.1| pantetheine-phosphate adenylyltransferase [Clostridium sp. D5]
          Length = 163

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/161 (33%), Positives = 99/161 (61%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +A+Y GSFDP+T GH+D+I ++   V++L++ +  N+ K   F S +ER +++++   
Sbjct: 1   MLRAIYPGSFDPVTYGHLDVIKRSCKIVDELIVGVLNNNAKMPLF-SAEERVKMLEE--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D +N V ++ F+GL ++ A+   A +++RGLR +TDF+YE++M+  N  L P + T
Sbjct: 57  -VTKDLTN-VKIVLFQGLLIDFARQQGADLVIRGLRAITDFEYELQMSQTNHKLEPSVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L       Y++ST ++ + +   DI+ FVP+ V   L+ 
Sbjct: 115 MFLTTSIEYSYLSSTTVKEIAAFGGDISQFVPEAVSEELEK 155


>gi|313680142|ref|YP_004057881.1| phosphopantetheine adenylyltransferase [Oceanithermus profundus DSM
           14977]
 gi|313152857|gb|ADR36708.1| Phosphopantetheine adenylyltransferase [Oceanithermus profundus DSM
           14977]
          Length = 164

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 94/151 (62%), Gaps = 6/151 (3%)

Query: 6   VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFL-SIQERSELIKQSIFHFI 64
           VY GSFDP TNGH+D++ +A    + + +A+  N  K   F+ S+ ER ++I+ S+    
Sbjct: 4   VYPGSFDPFTNGHLDVVRRASRLFDKVTVAVLHNPNKLSSFMFSVGERMQIIRASV---- 59

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
            D  N V V +F+GL  +  +   A++IV+GLR ++D++YE++M  +NR L PE+ T+ +
Sbjct: 60  ADMDN-VEVDAFDGLLADYMRARGARIIVKGLRAVSDYEYELQMAHLNRQLNPEVETLFI 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDP 155
            A     +++S++I+ +     D++ FVP+P
Sbjct: 119 LAATRWSFISSSMIKEIARHGGDVSRFVPEP 149


>gi|172057984|ref|YP_001814444.1| phosphopantetheine adenylyltransferase [Exiguobacterium sibiricum
           255-15]
 gi|229500790|sp|B1YIV1|COAD_EXIS2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|171990505|gb|ACB61427.1| pantetheine-phosphate adenylyltransferase [Exiguobacterium
           sibiricum 255-15]
          Length = 164

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 97/162 (59%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+  GSFDPITNGH+DII +A    +++++A+  NS K   F S+QER ELI +  
Sbjct: 1   MKRIAICPGSFDPITNGHLDIIERAAPIFDEIIVAVLNNSSKQPLF-SVQERMELISEVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P     + V +F GL V+ A  + A VIVRGLR ++DF+YEM++ S+N+ +  +I 
Sbjct: 60  EH-LP----HIKVDAFNGLLVDYASTVGADVIVRGLRAVSDFEYEMQVASINKKMNDQIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ +       +++S++++      A +   VP  V   L++
Sbjct: 115 TLFMMTNNQYSFLSSSIVKEAAKYGASVAGLVPPAVEEALRH 156


>gi|315648196|ref|ZP_07901297.1| pantetheine-phosphate adenylyltransferase [Paenibacillus vortex
           V453]
 gi|315276842|gb|EFU40185.1| pantetheine-phosphate adenylyltransferase [Paenibacillus vortex
           V453]
          Length = 171

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 94/159 (59%), Gaps = 6/159 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY GSFDP+T GHMDII +A S   DL+I    N++      +++ER+EL++Q+  H
Sbjct: 10  RVAVYPGSFDPVTMGHMDIITRA-SKQFDLLIVGVLNNLSKNPLFTVEERTELLRQATKH 68

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
            +P+    V + SF  L  N  +  +AQVIVRG+R +TDF+YE+++ S N  L P+  TI
Sbjct: 69  -LPN----VEIDSFRDLLANYIRQKNAQVIVRGIRTVTDFEYELQLASTNHKLNPDAETI 123

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            +       +++S+L++ +   + D T  V   V   L+
Sbjct: 124 FMMTHPKYSFLSSSLVKEIAHFNGDTTDLVSREVDAALR 162


>gi|297568527|ref|YP_003689871.1| pantetheine-phosphate adenylyltransferase [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924442|gb|ADH85252.1| pantetheine-phosphate adenylyltransferase [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 175

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 93/160 (58%), Gaps = 5/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDPIT GH+DII +AL+  + +++AI  N  K   F S+ ER ++I+ S   
Sbjct: 15  RIAVYPGTFDPITMGHIDIIKRALTLFDRVIVAIAVNPAKQPLF-SLAERKQMIRDSF-- 71

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
              D ++R+ V    GL V+ A    A+ IVRGLR ++DFDYE ++  +NR +  E+ T+
Sbjct: 72  --TDVNDRIEVDEVSGLLVDYAYRRGARAIVRGLRAVSDFDYEFQLALMNRRIEREVETV 129

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L       Y++S++I+       D+   VPD VC  L+ 
Sbjct: 130 FLMTGFRWIYISSSIIKDAARHGGDVGGLVPDHVCDRLRE 169


>gi|50085927|ref|YP_047437.1| phosphopantetheine adenylyltransferase [Acinetobacter sp. ADP1]
 gi|61211481|sp|Q6F8K0|COAD_ACIAD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|49531903|emb|CAG69615.1| phosphopantetheine adenylyltransferase [Acinetobacter sp. ADP1]
          Length = 163

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 91/154 (59%), Gaps = 6/154 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D++ +A    +++V+AI     K K   S++ER +L + S+ H 
Sbjct: 5   RVIYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHK-KPLFSLEERVKLAQLSLSHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V  + F+GL VN  ++ +A  ++RGLR ++DF+YE ++ ++NR L      + 
Sbjct: 64  -----HNVEFVGFDGLLVNFFREQNATAVLRGLRAVSDFEYEFQLANMNRQLDHHFEAVF 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           L   E   +++STL+R +  +  D+  FVP  V 
Sbjct: 119 LTPSEQYSFISSTLVREIARLRGDVAKFVPQAVV 152


>gi|319953856|ref|YP_004165123.1| phosphopantetheine adenylyltransferase [Cellulophaga algicola DSM
           14237]
 gi|319422516|gb|ADV49625.1| Phosphopantetheine adenylyltransferase [Cellulophaga algicola DSM
           14237]
          Length = 151

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 96/157 (61%), Gaps = 7/157 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+A++ GSFDP+T GH DII + ++  ++L+IAIG NS K K   S+++R   IK++  
Sbjct: 1   MRRAIFPGSFDPLTLGHYDIIQRGITLFDELIIAIGVNSDK-KYMFSLEDRKRFIKEAF- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                +  ++ V+++EGL V+  K I+A  I+RGLR+  DF++E  +   NR L  EI T
Sbjct: 59  ----ANEPKIKVLTYEGLTVDFCKKINANFILRGLRNPGDFEFEKAIAHTNRKLS-EIET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           + L       Y++S+++R +I    D T  VPD V V
Sbjct: 114 VFLLTSSGKSYISSSIVRDVIKNGGDYTGLVPDAVRV 150


>gi|254469175|ref|ZP_05082580.1| pantetheine-phosphate adenylyltransferase [Pseudovibrio sp. JE062]
 gi|211961010|gb|EEA96205.1| pantetheine-phosphate adenylyltransferase [Pseudovibrio sp. JE062]
          Length = 154

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 93/150 (62%), Gaps = 2/150 (1%)

Query: 14  ITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF-HFIPDSSNRVS 72
           +T+GH+DI+ Q+L   +++V+AIG  + K   F S +ER ELI+ +    F  +++ R+ 
Sbjct: 1   MTHGHLDILEQSLVLADEVVVAIGIQASKAPLF-SFEERVELIRLACEEQFGKENAARIR 59

Query: 73  VISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALFAKESSRY 132
            +SF GL V+ A++  + ++VRGLRD TD +YEM+M  +N  + P+I T+   +    R 
Sbjct: 60  TVSFTGLVVDAAREHGSNILVRGLRDSTDLNYEMQMAGMNGAMAPDIKTVFFPSSPVMRP 119

Query: 133 VTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           +T+TL+R +  +  D +SFVP  V   LK 
Sbjct: 120 ITATLVRQIAKMGGDYSSFVPKCVEAALKK 149


>gi|227889784|ref|ZP_04007589.1| phosphopantetheine adenylyltransferase [Lactobacillus johnsonii
           ATCC 33200]
 gi|227849648|gb|EEJ59734.1| phosphopantetheine adenylyltransferase [Lactobacillus johnsonii
           ATCC 33200]
          Length = 166

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 97/161 (60%), Gaps = 7/161 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA++ GSFDPITNGH+++I  A    E L + I  N+ K K   + +ER EL ++ +F
Sbjct: 1   MTKAIFPGSFDPITNGHVEVIEGASHMFEKLYVVIMTNTSK-KYLFNEKERLELARK-VF 58

Query: 62  HFIPDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
               +++ +V VI+    L V +A ++ A  IVRGLR+  DF+YE  +  +N+ L P++ 
Sbjct: 59  ----ENNEKVEVIARPAELTVEVAHELGASAIVRGLRNTADFNYERDIAGINKTLDPDLN 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ LF +    +++S++I+  +    D+++ VP PV   L+
Sbjct: 115 TVLLFTRPEDSFISSSMIKETVFFGGDVSTLVPKPVAAALE 155


>gi|224537368|ref|ZP_03677907.1| hypothetical protein BACCELL_02246 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224520993|gb|EEF90098.1| hypothetical protein BACCELL_02246 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 150

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 94/153 (61%), Gaps = 7/153 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+A++ G+FDP T GH  ++ +AL+F+++++I IG N  K   +  I++R E+I Q  +
Sbjct: 1   MRRAIFPGTFDPFTIGHSSVVTRALTFMDEVIIGIGINENKNT-YFPIEKRVEII-QKFY 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
              P    R+ V S++ L ++ A+ + AQ IVRG+R + DF+YE  +  +NR L   I T
Sbjct: 59  RNEP----RIKVYSYDCLTIDFARQVDAQFIVRGIRTVKDFEYEETIADINRKLAG-IET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           I LF +     ++ST +R L+    DI+ F+P+
Sbjct: 114 ILLFTEPELTCISSTTVRELLQFGKDISQFIPE 146


>gi|115352918|ref|YP_774757.1| phosphopantetheine adenylyltransferase [Burkholderia ambifaria
           AMMD]
 gi|134297003|ref|YP_001120738.1| phosphopantetheine adenylyltransferase [Burkholderia vietnamiensis
           G4]
 gi|161523674|ref|YP_001578686.1| phosphopantetheine adenylyltransferase [Burkholderia multivorans
           ATCC 17616]
 gi|170701092|ref|ZP_02892068.1| pantetheine-phosphate adenylyltransferase [Burkholderia ambifaria
           IOP40-10]
 gi|172061766|ref|YP_001809418.1| phosphopantetheine adenylyltransferase [Burkholderia ambifaria
           MC40-6]
 gi|189351557|ref|YP_001947185.1| phosphopantetheine adenylyltransferase [Burkholderia multivorans
           ATCC 17616]
 gi|221199979|ref|ZP_03573022.1| pantetheine-phosphate adenylyltransferase [Burkholderia multivorans
           CGD2M]
 gi|221206866|ref|ZP_03579878.1| pantetheine-phosphate adenylyltransferase [Burkholderia multivorans
           CGD2]
 gi|221211187|ref|ZP_03584166.1| pantetheine-phosphate adenylyltransferase [Burkholderia multivorans
           CGD1]
 gi|254251375|ref|ZP_04944693.1| Coenzyme A biosynthesis protein [Burkholderia dolosa AUO158]
 gi|122322179|sp|Q0BBQ0|COAD_BURCM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216530|sp|A4JI00|COAD_BURVG RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488122|sp|B1YN57|COAD_BURA4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488125|sp|A9AEW9|COAD_BURM1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|115282906|gb|ABI88423.1| pantetheine-phosphate adenylyltransferase [Burkholderia ambifaria
           AMMD]
 gi|124893984|gb|EAY67864.1| Coenzyme A biosynthesis protein [Burkholderia dolosa AUO158]
 gi|134140160|gb|ABO55903.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           vietnamiensis G4]
 gi|160341103|gb|ABX14189.1| pantetheine-phosphate adenylyltransferase [Burkholderia multivorans
           ATCC 17616]
 gi|170133993|gb|EDT02345.1| pantetheine-phosphate adenylyltransferase [Burkholderia ambifaria
           IOP40-10]
 gi|171994283|gb|ACB65202.1| pantetheine-phosphate adenylyltransferase [Burkholderia ambifaria
           MC40-6]
 gi|189335579|dbj|BAG44649.1| pantetheine-phosphate adenylyltransferase [Burkholderia multivorans
           ATCC 17616]
 gi|221168548|gb|EEE01016.1| pantetheine-phosphate adenylyltransferase [Burkholderia multivorans
           CGD1]
 gi|221173521|gb|EEE05956.1| pantetheine-phosphate adenylyltransferase [Burkholderia multivorans
           CGD2]
 gi|221180218|gb|EEE12622.1| pantetheine-phosphate adenylyltransferase [Burkholderia multivorans
           CGD2M]
 gi|325524748|gb|EGD02730.1| phosphopantetheine adenylyltransferase [Burkholderia sp. TJI49]
          Length = 165

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 100/163 (61%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F S++ER ++  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRAKKPFFSLEERLKIANEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+ F+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VKVMGFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              +  ++++ T++R +  +  D++ FV   V  +L   V ++
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAM 160


>gi|240947964|ref|ZP_04752390.1| phosphopantetheine adenylyltransferase [Actinobacillus minor NM305]
 gi|240297720|gb|EER48181.1| phosphopantetheine adenylyltransferase [Actinobacillus minor NM305]
          Length = 163

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 90/160 (56%), Gaps = 9/160 (5%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M RK +Y G+FDPIT GH+DII +A S  + +++AI  N  K   F S++ER+ L+ +S 
Sbjct: 1   MSRKVIYAGTFDPITKGHLDIIQRAASLFDQVIVAIAKNPSKQPLF-SLEERTALVSESC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPE-I 119
            H      + V  + F GL  + A +  AQ ++RG+R   D +YE+++  +N  L  E +
Sbjct: 60  LHL-----SNVQAVGFSGLLADFALEHQAQALIRGIRGSDDLEYEIQLAQLNHKLAHEHL 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVF 159
            TI        RY++ST++R +     DI+ FVP   CV 
Sbjct: 115 ETIFFPPSVELRYISSTMVREIYKHHGDISHFVPP--CVL 152


>gi|325102970|ref|YP_004272624.1| pantetheine-phosphate adenylyltransferase [Pedobacter saltans DSM
           12145]
 gi|324971818|gb|ADY50802.1| pantetheine-phosphate adenylyltransferase [Pedobacter saltans DSM
           12145]
          Length = 157

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 96/160 (60%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A++ GSFDPIT  H+DI+ +++S  + + I IG N  K K  L  + R E+IK ++F
Sbjct: 1   MKIALFPGSFDPITKAHVDILERSMSLFDKIYIGIGINGNK-KPHLEPETRLEMIK-AVF 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
              P    ++ V+++EGL +   K + A+ ++RG+R ++DF+YE  ++ +N  L PEI +
Sbjct: 59  GKDP----KIEVLTYEGLTIEFCKQLKAKYMIRGIRTVSDFEYEKAISQMNHALEPEIES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           I + +K     ++ST++R ++     +  FVP     FLK
Sbjct: 115 IFILSKPGYSSISSTIVRDILRHGGKVEKFVPPAAMPFLK 154


>gi|30248971|ref|NP_841041.1| coenzyme A biosynthesis protein:cytidylyltransferase [Nitrosomonas
           europaea ATCC 19718]
 gi|61212746|sp|Q820N3|COAD_NITEU RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|30138588|emb|CAD84879.1| Coenzyme A biosynthesis protein:Cytidylyltransferase [Nitrosomonas
           europaea ATCC 19718]
          Length = 159

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 88/151 (58%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M K +Y G+FDPIT GH D+I +A    + +V+A+  NS K+  F S++ER E+ +  + 
Sbjct: 1   MDKVIYPGTFDPITRGHEDLIQRASRLFDQVVVAVAANSGKSPCF-SLEERVEMARAVLA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +       V V  F GL +   +   A VIVRGLR ++DF+YE ++  +NR L P++ T
Sbjct: 60  EYA-----NVEVTGFSGLLMEFTRQQQAHVIVRGLRAVSDFEYEFQLAGMNRSLYPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           I L   E   ++++T++R +  +  D + FV
Sbjct: 115 IFLTPSEQYMFISATIVREIARLGGDASKFV 145


>gi|320331645|gb|EFW87583.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 159

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 93/151 (61%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+   S K K    +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVVIAVAA-SPKKKPLFPLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V+ F  L  + A++ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  H-LPN----VEVVGFSTLLAHFAEEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++  DIT FV
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFV 145


>gi|306830164|ref|ZP_07463348.1| pantetheine-phosphate adenylyltransferase [Streptococcus mitis ATCC
           6249]
 gi|304427690|gb|EFM30786.1| pantetheine-phosphate adenylyltransferase [Streptococcus mitis ATCC
           6249]
          Length = 162

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 93/159 (58%), Gaps = 7/159 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+TNGH+D+I +A    + L + +  N  K +GFL ++ R   +++++ H  
Sbjct: 6   GLFTGSFDPMTNGHLDMIERASKLFDKLYVGVFYNPHK-QGFLPVENRKRAVEKAVAHL- 63

Query: 65  PDSSNRVSVI-SFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V V+ S + L V +A+ + A+ +VRGLR+ TD  YE      N  L PEI TI 
Sbjct: 64  ----DNVEVLASHDELVVEVARRLGAKTLVRGLRNATDLQYEASFDYYNHQLAPEIETIY 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           L+++    Y++S+ +R L+    +I  +VP+ V   L++
Sbjct: 120 LYSRPEHLYISSSAMRELLKFGQEIQQYVPNSVVEELEH 158


>gi|303256297|ref|ZP_07342313.1| pantetheine-phosphate adenylyltransferase [Burkholderiales
           bacterium 1_1_47]
 gi|302861026|gb|EFL84101.1| pantetheine-phosphate adenylyltransferase [Burkholderiales
           bacterium 1_1_47]
          Length = 165

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 94/163 (57%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A Y G+FDP+T GH+D+I +A      L++A+   S +     +++ER ++ K+++  F 
Sbjct: 4   ATYPGTFDPLTKGHLDLIRRACWIFPKLIVAV-AESKRKHTLFTLEERVQMAKEAVKGF- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+ FEGL V+  +   +  IVRG R ++DF+YE +M  +N+ L PE+ TI L
Sbjct: 62  PN----VEVVGFEGLLVDFVRRHGSTCIVRGARAVSDFEYEFQMAGMNQKLMPEVETIFL 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              E  ++++ T +R +  +  D++ FVP  +   L+   I L
Sbjct: 118 TPAEQFQFISGTFVREIAMMGGDVSGFVPQNIRAALERKRIEL 160


>gi|284048739|ref|YP_003399078.1| pantetheine-phosphate adenylyltransferase [Acidaminococcus
           fermentans DSM 20731]
 gi|283952960|gb|ADB47763.1| pantetheine-phosphate adenylyltransferase [Acidaminococcus
           fermentans DSM 20731]
          Length = 164

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 89/153 (58%), Gaps = 5/153 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKAV  GSFDP+T GH+DI  +A    ++L+I++  N  K K   S++ER  +I+Q+  
Sbjct: 1   MRKAVCPGSFDPVTMGHLDIFERASKMFDELIISVFVNPAKDKAMFSMEERVAMIRQATA 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H IP+    V V SF GL     +   A+ IVRGLR  TDF+YE +   + + +  ++ T
Sbjct: 61  H-IPN----VRVTSFSGLLNEFCEKEGARFIVRGLRAFTDFEYEFQRALLMKEIDEQLET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           + +       Y++S+ +R ++    DI+ FVPD
Sbjct: 116 VFIMTNAKYSYLSSSGVREMVYFGGDISGFVPD 148


>gi|330965064|gb|EGH65324.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 159

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 92/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+   S K      +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDQVVIAVAA-SPKKNPLFPLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  H-LPN----VEVVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++  DIT FV
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFV 145


>gi|253682412|ref|ZP_04863209.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum D
           str. 1873]
 gi|253562124|gb|EES91576.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum D
           str. 1873]
          Length = 161

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/155 (36%), Positives = 95/155 (61%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY+GSFDPIT GH+DII +A +  +++++++  N  KT G  +I+ER  LIK+   
Sbjct: 1   MKTAVYSGSFDPITEGHLDIIRRAANIFDEVIVSVLINPSKT-GLFNIEERVGLIKK--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +      V V SF GL V+  K+ +A+VI++GLR ++DF+YE++M  +N+ L   I T
Sbjct: 57  --VTKDIKNVKVESFHGLLVDYMKNKNAKVIIKGLRAVSDFEYELQMAQMNKKLDASIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + +       Y++S+ I+ ++     I   VP+ V
Sbjct: 115 VFMMTDPKYSYLSSSSIKQVVMFGGCIKGMVPEQV 149


>gi|168182570|ref|ZP_02617234.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum
           Bf]
 gi|237795932|ref|YP_002863484.1| phosphopantetheine adenylyltransferase [Clostridium botulinum Ba4
           str. 657]
 gi|259491301|sp|C3L0J4|COAD_CLOB6 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|182674153|gb|EDT86114.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum
           Bf]
 gi|229260794|gb|ACQ51827.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum
           Ba4 str. 657]
          Length = 164

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 90/155 (58%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDPIT GH++II +A    + L++A+  N  K KG  S+ ER E+IK+   
Sbjct: 1   MKTAVYPGSFDPITKGHLNIIKRASKVCDKLIVAVLVNPEK-KGLFSVDERVEMIKR--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +  + + V V  F GL ++  K+  ++VI++GLR M+DF+YE +M  +N  L P I T
Sbjct: 57  --VTKNHSNVEVQCFSGLLIDFMKEKKSKVIIKGLRTMSDFEYEFKMALMNNKLDPNIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + +       Y++S+ ++ +      I   VPD +
Sbjct: 115 VFMMTNAKYSYLSSSSVKQVAMFGGCIKDLVPDEI 149


>gi|145631682|ref|ZP_01787445.1| phosphopantetheine adenylyltransferase [Haemophilus influenzae
           R3021]
 gi|144982705|gb|EDJ90241.1| phosphopantetheine adenylyltransferase [Haemophilus influenzae
           R3021]
          Length = 156

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 90/160 (56%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M   +Y G+FDPITNGH+DII ++      +++A+  NS   K   S+ ER EL++QS+ 
Sbjct: 1   MTSVIYPGTFDPITNGHLDIIERSAVIFPRVLVAV-ANSPSKKTLFSLDERVELVRQSVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + V V  F  L  N+ K  +   I+RG+R  TDF+YE+++ ++NR L   + +
Sbjct: 60  HL-----SNVEVFGFSDLLANVIKQHNISAIIRGVRTTTDFEYELQLAALNRLLTKGVDS 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +     E   +V+ST++R +     D+   VP+PV   LK
Sbjct: 115 LFFPPAEKWAFVSSTIVREIYLHGGDVAELVPEPVFNALK 154


>gi|83593078|ref|YP_426830.1| phosphopantetheine adenylyltransferase [Rhodospirillum rubrum ATCC
           11170]
 gi|123526584|sp|Q2RTK2|COAD_RHORT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|83575992|gb|ABC22543.1| Coenzyme A biosynthesis protein [Rhodospirillum rubrum ATCC 11170]
          Length = 172

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 93/151 (61%), Gaps = 2/151 (1%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY G+FDP+TNGH+DII +A   V+ L + +  N+ K   F S++ER E+++ ++  
Sbjct: 6   RIAVYPGTFDPVTNGHLDIISRAARLVDRLTVGVAVNAGKGPLF-SLEERVEMVRVAV-D 63

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
            +P +   ++V+ F  L ++ A    A +I RGLR ++DF+YE +M  +N  L  ++ T+
Sbjct: 64  KLPTNGATITVVPFANLLMDFACAQGASMIFRGLRAISDFEYEFQMCGMNSRLNSKVETV 123

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVP 153
            L A E S++++S  ++ +  +  DI  FVP
Sbjct: 124 FLMASERSQFISSRFVKEIGRLGGDIGGFVP 154


>gi|330902165|gb|EGH33410.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 149

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 92/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+   S K      +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDQVVIAVAA-SPKKNPLFPLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  H-LPN----VEVVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++  DIT FV
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFV 145


>gi|83643885|ref|YP_432320.1| phosphopantetheine adenylyltransferase [Hahella chejuensis KCTC
           2396]
 gi|123534648|sp|Q2SN79|COAD_HAHCH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|83631928|gb|ABC27895.1| pantetheine-phosphate adenylyltransferase [Hahella chejuensis KCTC
           2396]
          Length = 161

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 91/156 (58%), Gaps = 7/156 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M   +Y G+FDPITNGH D+I +A    + +V+A+   S K     S++ER +L++Q + 
Sbjct: 1   MNTVIYPGTFDPITNGHKDLIARASRIFDKVVVAVAA-SPKKNPLFSLEERVDLVRQVVK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F P+    V V  F  L  +  +   A +I+RGLR ++DF+YE ++  +NR L P + +
Sbjct: 60  PF-PN----VDVKGFSNLLADFVQQNQANIILRGLRAVSDFEYEFQLADMNRKLAPNVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + L       Y++STLIR + ++  D+T FV DP+ 
Sbjct: 115 LFLTPANHLSYISSTLIREIAALGGDVTEFV-DPIV 149


>gi|66047982|ref|YP_237823.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           syringae B728a]
 gi|289672460|ref|ZP_06493350.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           syringae FF5]
 gi|302188122|ref|ZP_07264795.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           syringae 642]
 gi|75500244|sp|Q4ZM37|COAD_PSEU2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|63258689|gb|AAY39785.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related
           [Pseudomonas syringae pv. syringae B728a]
 gi|330944156|gb|EGH46275.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           pisi str. 1704B]
 gi|330954988|gb|EGH55248.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae Cit 7]
 gi|330980016|gb|EGH78282.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 159

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 92/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+   S K      +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDQVVIAVAA-SPKKNPLFPLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  H-LPN----VEVVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++  DIT FV
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFV 145


>gi|28867647|ref|NP_790266.1| pantetheine-phosphate adenylyltransferase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213967809|ref|ZP_03395956.1| pantetheine-phosphate adenylyltransferase [Pseudomonas syringae pv.
           tomato T1]
 gi|301382446|ref|ZP_07230864.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           tomato Max13]
 gi|302061162|ref|ZP_07252703.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           tomato K40]
 gi|302132045|ref|ZP_07258035.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|31563013|sp|Q88AH3|COAD_PSESM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|28850882|gb|AAO53961.1| pantetheine-phosphate adenylyltransferase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927585|gb|EEB61133.1| pantetheine-phosphate adenylyltransferase [Pseudomonas syringae pv.
           tomato T1]
 gi|330874687|gb|EGH08836.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|331014960|gb|EGH95016.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 159

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 92/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+   S K      +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDQVVIAVAA-SPKKNPLFPLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  H-LPN----VEVVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++  DIT FV
Sbjct: 115 LFLTPSERYSFISSTLVREIATLGGDITKFV 145


>gi|330719523|gb|EGG98129.1| Phosphopantetheine adenylyltransferase [gamma proteobacterium
           IMCC2047]
          Length = 161

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 90/161 (55%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y G+FDPITNGH D++ +A    + +++AI  N+ K    L +  R  L  + +
Sbjct: 1   MKRTAIYPGTFDPITNGHTDLVERAARLFDHVIVAIAANT-KKGPMLDLDVRIALASKVL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V  F  L    A+   A +I+RGLR ++DF+YE ++ ++NR   P+I 
Sbjct: 60  GHL-----ENVEVCGFACLLTKFAEKRGANIIIRGLRAVSDFEYEFQLANMNRAQSPDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +I L   E   +V+STLIR + S+D D++ FV   V   LK
Sbjct: 115 SIFLTPSEQYSFVSSTLIREIASLDGDVSKFVHPAVNDALK 155


>gi|171320169|ref|ZP_02909231.1| pantetheine-phosphate adenylyltransferase [Burkholderia ambifaria
           MEX-5]
 gi|171094583|gb|EDT39635.1| pantetheine-phosphate adenylyltransferase [Burkholderia ambifaria
           MEX-5]
          Length = 165

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 94/148 (63%), Gaps = 6/148 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F S++ER ++  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRAKKPFFSLEERLKIANEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+ F+GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VKVMGFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFV 152
              +  ++++ T++R +  +  D++ FV
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFV 145


>gi|86158157|ref|YP_464942.1| coenzyme A biosynthesis protein, cytidyltransferase-related
           [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123497714|sp|Q2IIM3|COAD_ANADE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|85774668|gb|ABC81505.1| Coenzyme A biosynthesis protein, Cytidyltransferase-related protein
           [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 164

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 95/161 (59%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+ II + L+  + LV+A+  N  K+  F ++ ER  LI++++
Sbjct: 1   MNRAAIYPGSFDPLTNGHLAIIQRGLNLFDRLVVAVANNPQKSPMF-TVDERKALIREAV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 +  RV V SF+GL V+ A+      ++RGLR ++DF+YE ++ ++N+ L PE  
Sbjct: 60  -----GNDPRVEVDSFDGLMVDYARTRGIPKVLRGLRAVSDFEYEFQLANMNKKLLPEFE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           ++ +   E   +V++ L+R +     ++   VP  V   L+
Sbjct: 115 SVFVMTGEDYFFVSARLVREVAVFGGNVEGLVPPNVLEALQ 155


>gi|312131935|ref|YP_003999275.1| phosphopantetheine adenylyltransferase [Leadbetterella byssophila
           DSM 17132]
 gi|311908481|gb|ADQ18922.1| Phosphopantetheine adenylyltransferase [Leadbetterella byssophila
           DSM 17132]
          Length = 147

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 87/153 (56%), Gaps = 6/153 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A + GSFDP T GH DI+ + L   ++++I IG NS K K +  I E    IK++ 
Sbjct: 1   MKRVAFFPGSFDPFTKGHEDIVRRGLKLFDEIIIGIGTNSAK-KRYFEIPEIESAIKRAF 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                    RV V+ ++ L   +A+   A+ I+RGLR+ TDF+YE  ++ VNR L  ++ 
Sbjct: 60  -----QDDERVKVVHYDDLTAAVAQQYGARFIIRGLRNTTDFEYENTISQVNRQLVADLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           T+ L        ++ST++R L    ADI+S++P
Sbjct: 115 TVFLITSPEFAPISSTIVRELHKFGADISSYIP 147


>gi|322391342|ref|ZP_08064812.1| pantetheine-phosphate adenylyltransferase [Streptococcus peroris
           ATCC 700780]
 gi|321145768|gb|EFX41159.1| pantetheine-phosphate adenylyltransferase [Streptococcus peroris
           ATCC 700780]
          Length = 162

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 89/158 (56%), Gaps = 5/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+T GH+DII +A  F + L + I  N  K  GFL I+ R E +++++ H  
Sbjct: 6   GLFTGSFDPMTTGHLDIIERASKFFDKLYVGIFYNPNKN-GFLPIESRLETVEKAVGHL- 63

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
               N   + S + L V++A+ +   V+VRGLR+  D  YE      N  L  EI T+ L
Sbjct: 64  ---KNVQVIASHDELVVDVARKLGVHVLVRGLRNAADLQYEASFDFYNHQLVGEIETVYL 120

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            ++    Y++S+ +R L+    DI+ +VP+ V   LKN
Sbjct: 121 HSRPEHVYISSSAVRELLKFGQDISKYVPNAVLEELKN 158


>gi|187778912|ref|ZP_02995385.1| hypothetical protein CLOSPO_02507 [Clostridium sporogenes ATCC
           15579]
 gi|187772537|gb|EDU36339.1| hypothetical protein CLOSPO_02507 [Clostridium sporogenes ATCC
           15579]
          Length = 179

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 89/155 (57%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDPIT GH++II +A    + L++A+  N  K KG  S+ ER E+IK+   
Sbjct: 16  MKTAVYPGSFDPITKGHLNIIKRASKVCDKLIVAVLVNPEK-KGLFSVDERVEMIKR--- 71

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +  +   V V  F GL ++  K+  ++VI++GLR M+DF+YE +M  +N  L P I T
Sbjct: 72  --VTKNHRNVEVQCFSGLLIDFMKEKKSKVIIKGLRTMSDFEYEFKMALMNNKLDPNIET 129

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + +       Y++S+ ++ +      I   VPD +
Sbjct: 130 VFMMTNAKYSYLSSSSVKQVAMFGGCIKDLVPDEI 164


>gi|157373070|ref|YP_001481059.1| phosphopantetheine adenylyltransferase [Serratia proteamaculans
           568]
 gi|167009047|sp|A8GLE1|COAD_SERP5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|157324834|gb|ABV43931.1| pantetheine-phosphate adenylyltransferase [Serratia proteamaculans
           568]
          Length = 161

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 90/153 (58%), Gaps = 6/153 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M RKA+Y G+FDP+TNGH+D++ +A    + +++AI  +  K K   ++ ER  L  Q  
Sbjct: 1   MTRKAIYPGTFDPMTNGHLDLVTRASLMFDHVILAIAASPSK-KPLFTLDERVALASQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F  L  + A   +A ++VRGLR ++DF+YE+++ ++NR L P + 
Sbjct: 60  SHL-----DNVEVLGFSELMAHFAAHQNANILVRGLRAVSDFEYELQLANMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           ++ L   E   +++S+L++ +     DI  F+P
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHGGDIAPFLP 147


>gi|302392172|ref|YP_003827992.1| phosphopantetheine adenylyltransferase [Acetohalobium arabaticum
           DSM 5501]
 gi|302204249|gb|ADL12927.1| Phosphopantetheine adenylyltransferase [Acetohalobium arabaticum
           DSM 5501]
          Length = 161

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 99/161 (61%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R AVY GSFDPITNGH+DII +  +  +++++A+  N  K   F S +ER ++I+++I
Sbjct: 1   MGRAAVYPGSFDPITNGHLDIIERTANIFDNVIVAVSNNPNKDHLF-SREERVQMIEEAI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             +       + V +F+GL ++  ++  A++IVRGLR ++DF+ E +M S+N+ L  +I 
Sbjct: 60  VDY-----EEIEVDAFDGLLIDYIREQKAEIIVRGLRAVSDFEAEFQMASMNKKLDSDIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           TI +  K    Y++S++IR +  +   I   VP+ V   L+
Sbjct: 115 TIFMMTKNQYVYLSSSIIREVSELGGCIEGLVPENVIPKLR 155


>gi|327458794|gb|EGF05142.1| pantetheine-phosphate adenylyltransferase [Streptococcus sanguinis
           SK1057]
          Length = 164

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 93/160 (58%), Gaps = 7/160 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+T GH+D+I +A    + L + I  N  K+ GF +I+ R  ++K+++ H  
Sbjct: 6   GLFTGSFDPMTKGHVDLIERASRLFDKLYVGIFYNREKS-GFFTIEARERMVKEALQHL- 63

Query: 65  PDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V VI+ +  LAV +A+ +  Q  VRGLR+  D DYE  M   N  L  E+ TI 
Sbjct: 64  ----DNVEVITSQNELAVTVARRLGVQAFVRGLRNSQDLDYEANMNFFNHELAGELETIF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L +K   ++++S+ IR LI+   DI ++VP  V   L+ I
Sbjct: 120 LLSKPVYQHISSSRIRELIAFQQDIAAYVPQSVIKELERI 159


>gi|148380447|ref|YP_001254988.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum A
           str. ATCC 3502]
 gi|153931465|ref|YP_001384670.1| phosphopantetheine adenylyltransferase [Clostridium botulinum A
           str. ATCC 19397]
 gi|153936443|ref|YP_001388191.1| phosphopantetheine adenylyltransferase [Clostridium botulinum A
           str. Hall]
 gi|168180624|ref|ZP_02615288.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum
           NCTC 2916]
 gi|226949846|ref|YP_002804937.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum A2
           str. Kyoto]
 gi|166216537|sp|A7FW59|COAD_CLOB1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216538|sp|A5I4S1|COAD_CLOBH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254763943|sp|C1FSR3|COAD_CLOBJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|148289931|emb|CAL84044.1| putative phosphopantetheine adenylyltransferase [Clostridium
           botulinum A str. ATCC 3502]
 gi|152927509|gb|ABS33009.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum A
           str. ATCC 19397]
 gi|152932357|gb|ABS37856.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum A
           str. Hall]
 gi|182668590|gb|EDT80569.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum
           NCTC 2916]
 gi|226842461|gb|ACO85127.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum A2
           str. Kyoto]
 gi|322806760|emb|CBZ04329.1| phosphopantetheine adenylyltransferase [Clostridium botulinum
           H04402 065]
          Length = 164

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 89/155 (57%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDPIT GH++II +A    + L++A+  N  K KG  S+ ER E+IK+   
Sbjct: 1   MKTAVYPGSFDPITKGHLNIIKRASKVCDKLIVAVLVNPEK-KGLFSVDERVEMIKR--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +    + V V  F GL ++  K+  ++VI++GLR M+DF+YE +M  +N  L P I T
Sbjct: 57  --VTKKHSNVEVQCFSGLLIDFMKEKKSKVIIKGLRTMSDFEYEFKMALMNNKLDPNIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + +       Y++S+ ++ +      I   VPD +
Sbjct: 115 VFMMTNAKYSYLSSSSVKQVAMFGGCIKDLVPDEI 149


>gi|78212895|ref|YP_381674.1| phosphopantetheine adenylyltransferase [Synechococcus sp. CC9605]
 gi|123578174|sp|Q3AJW3|COAD_SYNSC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|78197354|gb|ABB35119.1| coenzyme A biosynthesis protein [Synechococcus sp. CC9605]
          Length = 163

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 91/154 (59%), Gaps = 6/154 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           +A+Y GSFDP+TNGHMD+I +A+S   ++V+A+  N  K   F S+ ER E I+ +  H 
Sbjct: 2   RALYPGSFDPLTNGHMDLIERAVSLFGEVVVAVLSNPSKRPAF-SVDERIEQIRTATCHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V VISF+GL VN A    A +I+RGLR M+DF+YE+++   NR L  ++ T+ 
Sbjct: 61  -----SGVEVISFDGLTVNCAVTHRADLILRGLRAMSDFEYELQIAHTNRSLADDLETVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           +       +++S++++ +      I   VP  V 
Sbjct: 116 MATTARHSFLSSSVVKEVARFGGSIDHMVPPEVA 149


>gi|313901491|ref|ZP_07834942.1| Phosphopantetheine adenylyltransferase [Thermaerobacter
           subterraneus DSM 13965]
 gi|313468243|gb|EFR63706.1| Phosphopantetheine adenylyltransferase [Thermaerobacter
           subterraneus DSM 13965]
          Length = 163

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 94/153 (61%), Gaps = 6/153 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+  GSFDPITNGH+DII +A    + +++ +  NS K   F + +ER EL +Q+  
Sbjct: 1   MTIALCPGSFDPITNGHLDIIERASRLFDQVLVTVFINSSKQPWF-TPEERVELARQATA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    VSV +++GL V  A+   A+VIV+GLR ++DF+YE +M  +N+ L  E+ T
Sbjct: 60  H-LPN----VSVDAYDGLLVEYARRKGARVIVKGLRAVSDFEYEFQMAQINKQLAGELET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           + +  +  + Y++S++++ L     D    VPD
Sbjct: 115 LFMMTRPENAYLSSSIVKELARYGVDPAGLVPD 147


>gi|329921302|ref|ZP_08277740.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners SPIN
           1401G]
 gi|328934594|gb|EGG31098.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners SPIN
           1401G]
          Length = 160

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 98/161 (60%), Gaps = 7/161 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKA++ GSFDP+TNGH++ +  A +  + +   I  N+ K K   + +ER E+ K ++F
Sbjct: 1   MRKAIFPGSFDPLTNGHVETVNIATTIFDKVFFVIMTNTNK-KYLFTEEERLEIAK-TVF 58

Query: 62  HFIPDSSNRVSVISF-EGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
               D+S +V VI+  + LAVN+A  + A  IVRGLR+  DF+YE  + ++N+ L P++ 
Sbjct: 59  K---DNS-KVEVIARPQELAVNVAMKLGANTIVRGLRNDADFNYEREIAAINKTLAPQLN 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           TI L     + +++ST+I+   +   DIT  VPD V   LK
Sbjct: 115 TILLLTGPENSFISSTMIKETATFGGDITKLVPDIVSEALK 155


>gi|257482984|ref|ZP_05637025.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289624662|ref|ZP_06457616.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289648502|ref|ZP_06479845.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298485254|ref|ZP_07003347.1| Phosphopantetheine adenylyltransferase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298160242|gb|EFI01270.1| Phosphopantetheine adenylyltransferase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320326364|gb|EFW82417.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|330871126|gb|EGH05835.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330891345|gb|EGH24006.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           mori str. 301020]
 gi|330985916|gb|EGH84019.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011776|gb|EGH91832.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 159

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 92/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+   S K      +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVVIAVAA-SPKKNPLFPLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  H-LPN----VEVVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++  DIT FV
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFV 145


>gi|89092447|ref|ZP_01165401.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related
           [Oceanospirillum sp. MED92]
 gi|89083535|gb|EAR62753.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related
           [Oceanospirillum sp. MED92]
          Length = 159

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 89/151 (58%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDPITNGH D+I +A    + +V+AI   S K +  L ++ R  L+ +   
Sbjct: 1   MNTAVYPGTFDPITNGHSDLIERAAKLFDKVVVAI-AESPKKRPMLPLETRVALVAEVTA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + V ++ F+ L   L    +A +I+RGLR ++DF+YE ++ ++NR L P + +
Sbjct: 60  HL-----DNVEIVGFDCLLAELLAQQNANIILRGLRAVSDFEYEFQLAAMNRHLAPNVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           I L   E   +V+STLIR + S+  D++ FV
Sbjct: 115 IFLTPAEHLSFVSSTLIREISSLGGDVSKFV 145


>gi|312875463|ref|ZP_07735466.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners LEAF
           2053A-b]
 gi|325912862|ref|ZP_08175240.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners UPII
           60-B]
 gi|311088974|gb|EFQ47415.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners LEAF
           2053A-b]
 gi|325477855|gb|EGC80989.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners UPII
           60-B]
          Length = 160

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 98/161 (60%), Gaps = 7/161 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKA++ GSFDP+TNGH++ +  A +  + +   I  N+ K K   + +ER E+ K ++F
Sbjct: 1   MRKAIFPGSFDPLTNGHVETVNIATTIFDKVFFVIMTNTNK-KYLFTEEERLEIAK-TVF 58

Query: 62  HFIPDSSNRVSVISF-EGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
               D+S +V VI+  + LAVN+A  + A  IVRGLR+  DF+YE  + ++N+ L P++ 
Sbjct: 59  K---DNS-KVEVIARPQELAVNVAMKLGANTIVRGLRNDADFNYEREIAAINKTLAPQLN 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           TI L     + +++ST+I+   +   DIT  VPD V   LK
Sbjct: 115 TILLLTGPENSFISSTMIKETATFGGDITKLVPDIVSRALK 155


>gi|91226565|ref|ZP_01261289.1| phosphopantetheine adenylyltransferase [Vibrio alginolyticus 12G01]
 gi|269965916|ref|ZP_06180009.1| phosphopantetheine adenylyltransferase [Vibrio alginolyticus 40B]
 gi|91189039|gb|EAS75321.1| phosphopantetheine adenylyltransferase [Vibrio alginolyticus 12G01]
 gi|269829469|gb|EEZ83710.1| phosphopantetheine adenylyltransferase [Vibrio alginolyticus 40B]
          Length = 160

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 93/155 (60%), Gaps = 6/155 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K +Y G+FDP+TNGH+++I +     +++VI +  +  K   F S++ER  L++  + H 
Sbjct: 2   KVIYPGTFDPVTNGHLNLIERTHEMFDEVVIGVAASPSKNTMF-SLEERVALMQDVVAH- 59

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           +P     V+V  F GL V+ A+D  A+V++RGLR   DF+YE  +T++ R L P I ++ 
Sbjct: 60  LPG----VTVKGFSGLLVDFARDEKAKVLIRGLRTTVDFEYEFGLTNMYRKLLPGIESVF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           L  +E   +++ST++R +      I  FVP PV +
Sbjct: 116 LTPEEEFAFLSSTIVREVAIHGGSIEQFVPKPVAI 150


>gi|253573472|ref|ZP_04850815.1| pantetheine-phosphate adenylyltransferase [Paenibacillus sp. oral
           taxon 786 str. D14]
 gi|251847000|gb|EES75005.1| pantetheine-phosphate adenylyltransferase [Paenibacillus sp. oral
           taxon 786 str. D14]
          Length = 170

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 93/160 (58%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY GSFDP+T GHMDII +A    + L++A+  N++  K   ++ ER  L+++   H
Sbjct: 8   RVAVYPGSFDPVTKGHMDIIQRASRQFDKLIVAV-LNNLSKKPLFTVDERKALLREVTGH 66

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
            +P+    V + SF  L VN      A VIVRG+R +TDF+YE+++ S N  L  E+ TI
Sbjct: 67  -LPN----VEIDSFRDLLVNYMDYKQAHVIVRGIRSVTDFEYELQLASTNHKLNSEVETI 121

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            +       Y++S++++ + S   D++  VP  V + L+ 
Sbjct: 122 FMMTHPKYSYLSSSVVKEIASFHGDVSDLVPPEVEMALRE 161


>gi|126664283|ref|ZP_01735274.1| phosphopantetheine adenylyltransferase [Flavobacteria bacterium
           BAL38]
 gi|126623703|gb|EAZ94400.1| phosphopantetheine adenylyltransferase [Flavobacteria bacterium
           BAL38]
          Length = 151

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 94/155 (60%), Gaps = 7/155 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+KA++ GSFDPITNGH DII + +S  +++++AIG N+ K K   S++ER   I+++  
Sbjct: 1   MKKAIFPGSFDPITNGHADIIKRGVSLFDEIIVAIGVNAEK-KYMFSLEERMRFIEETF- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                   +V VI++ GL ++L K   A+ I+RGLR+  DF++E  +   NR +  +I T
Sbjct: 59  ----KDEPKVRVITYTGLTIDLCKKEKAEFILRGLRNPADFEFEKAIAHANRTMS-KIET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L     + +++S+++R +I    D +  VP  V
Sbjct: 114 VFLLTAARTSFISSSIVRDVIRNGGDASKLVPSSV 148


>gi|238898873|ref|YP_002924555.1| CMP-deoxy-D-manno-octulosonate-lipid A transferase
           (phosphopantetheine adenylyltransferase) [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|259491316|sp|C4K764|COAD_HAMD5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229466633|gb|ACQ68407.1| CMP-deoxy-D-manno-octulosonate-lipid A transferase
           (phosphopantetheine adenylyltransferase) [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 156

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 93/155 (60%), Gaps = 8/155 (5%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           + +Y G+FDPITNGH+D++ +A +  + +++AI   S   K   S+ ER +L K +  H 
Sbjct: 4   RVIYPGTFDPITNGHLDLLSRACALFDHVILAIA-ESPNKKTLFSLNERVDLAKGATAHL 62

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                N + V SF GL ++ A+  +  +++RG+R ++DF+ E ++  +N  + PE+ T+ 
Sbjct: 63  -----NNIEVTSFHGLLIHFAQQKNIPILLRGIRSLSDFEQEWQLCHMNHRIMPELETLF 117

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           L   E   +++S+L++ +     D+++FVPD  CV
Sbjct: 118 LMPSEKWAFISSSLVKEIAQYRGDVSAFVPD--CV 150


>gi|145629664|ref|ZP_01785461.1| phosphopantetheine adenylyltransferase [Haemophilus influenzae
           22.1-21]
 gi|144978175|gb|EDJ87948.1| phosphopantetheine adenylyltransferase [Haemophilus influenzae
           22.1-21]
          Length = 156

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 90/160 (56%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M   +Y G+FDPITNGH+DII ++      +++A+  NS   K   S++ER EL++QS+ 
Sbjct: 1   MTSVIYPGTFDPITNGHLDIIERSAVIFPRVLVAV-ANSPSKKTLFSLEERVELVRQSVT 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + V V  F  L  N+ K  +   I+RG+R  TDF+YE+++ ++NR L   + +
Sbjct: 60  HL-----SNVEVFGFSDLLANVIKQHNISAIIRGVRTTTDFEYELQLAALNRLLTKGVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +     E   +V+ST++R +     D+   VP PV   LK
Sbjct: 115 LFFPPAEKWAFVSSTIVREIYLHGGDVAELVPVPVFNALK 154


>gi|330812392|ref|YP_004356854.1| putative phosphopantetheine adenylyltransferase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327380500|gb|AEA71850.1| putative phosphopantetheine adenylyltransferase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 159

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 92/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+   S K      +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERAARLFDHVIIAVAA-SPKKNPLFPLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  H-LPN----VEVVGFSTLLAHFAKEKNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++  DIT FV
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFV 145


>gi|148827829|ref|YP_001292582.1| phosphopantetheine adenylyltransferase [Haemophilus influenzae
           PittGG]
 gi|166216551|sp|A5UHE3|COAD_HAEIG RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|148719071|gb|ABR00199.1| phosphopantetheine adenylyltransferase [Haemophilus influenzae
           PittGG]
          Length = 156

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 90/160 (56%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M   +Y G+FDPITNGH+DII ++      +++A+  NS   K   S++ER EL++QS+ 
Sbjct: 1   MTSVIYPGTFDPITNGHLDIIERSAVIFPRVLVAV-ANSPSKKTLFSLEERVELVRQSVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + V V  F  L  N+ K  +   I+RG+R  TDF+YE+++ ++NR L   + +
Sbjct: 60  HL-----SNVEVFGFSDLLANVIKQHNISAIIRGVRTTTDFEYELQLAALNRLLTKGVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +     E   +V+ST++R +     D+   VP PV   LK
Sbjct: 115 LFFPPAEKWAFVSSTIVREIYLHGGDVAELVPVPVFNALK 154


>gi|148360797|ref|YP_001252004.1| phosphopantetheine adenylyltransferase [Legionella pneumophila str.
           Corby]
 gi|166216557|sp|A5IH08|COAD_LEGPC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|148282570|gb|ABQ56658.1| phosphopantetheine adenylyltransferase [Legionella pneumophila str.
           Corby]
          Length = 163

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDP T  H+DII +A +   +L++A+  N  K   F+  + R+ L+++S+
Sbjct: 1   MKQKAIYPGTFDPCTKWHIDIITRASTIFPELIVAVASNKNKAAYFI-WESRNSLLEESV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V  + F+ L  +   + +A +I+RGLR ++DF+YE ++  +NR L  ++ 
Sbjct: 60  GHLTG-----VRGVGFDNLLNDFVLEQNAGIILRGLRAVSDFEYEFQLAGMNRKLSKKVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ L   E   Y++STL+R + +++ DI+ FVP  V   LK
Sbjct: 115 TLFLTPAEHLMYISSTLVREIAALNGDISQFVPPNVVRELK 155


>gi|83311481|ref|YP_421745.1| phosphopantetheine adenylyltransferase [Magnetospirillum magneticum
           AMB-1]
 gi|82946322|dbj|BAE51186.1| Phosphopantetheine adenylyltransferase [Magnetospirillum magneticum
           AMB-1]
          Length = 168

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 88/150 (58%), Gaps = 1/150 (0%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  +Y G+FDP+TNGHMDI+ +A   V+ L++A+  N+ K   F +++ER  + +  +  
Sbjct: 4   RVGLYPGTFDPVTNGHMDIVARAARVVDHLIVAVAANAGKGPLF-TLEERVAMAELEMAE 62

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   + V SF+ L V+      A +IVRGLR ++DF+YE +M  +N  L P+I TI
Sbjct: 63  LAQSIGASIEVRSFDTLLVDFTAGCGANLIVRGLRAVSDFEYEFQMAGMNARLSPDIETI 122

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFV 152
            L A E  ++++S  ++ +  +  DI+ FV
Sbjct: 123 FLMASERCQFISSRFVKEIGRLGGDISQFV 152


>gi|84503060|ref|ZP_01001156.1| pantetheine-phosphate adenylyltransferase [Oceanicola batsensis
           HTCC2597]
 gi|84388604|gb|EAQ01476.1| pantetheine-phosphate adenylyltransferase [Oceanicola batsensis
           HTCC2597]
          Length = 164

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 89/151 (58%), Gaps = 1/151 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F  +++R  +I+ +  
Sbjct: 1   MRTGLYPGTFDPITLGHLDIIRRATALVDRLVIGVAINRDKGPLF-DLEDRVSMIQNACE 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               +++  + V  FE L ++ A D+ A +IVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  DMQAETNTEIVVHPFENLLIHCAHDVGATLIVRGLRAVADFEYEYQMVGMNRSLDSSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L A    + + S L++ +  +D D++ FV
Sbjct: 120 VFLMADAKRQAIASKLVKEICRLDGDVSKFV 150


>gi|83590705|ref|YP_430714.1| phosphopantetheine adenylyltransferase [Moorella thermoacetica ATCC
           39073]
 gi|123524125|sp|Q2RHB8|COAD_MOOTA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|83573619|gb|ABC20171.1| Phosphopantetheine adenylyltransferase [Moorella thermoacetica ATCC
           39073]
          Length = 160

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 60/155 (38%), Positives = 96/155 (61%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY G+FDPITNGH+DII +A+S  + +V+ +  ++ K K   S++ER EL++ ++ 
Sbjct: 1   MKVAVYPGTFDPITNGHLDIIRRAVSIFDRVVVGVAADNYK-KTLFSLEERVELVR-TVT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             IP     V+V SF GL V+ A+   A  IVRGLR ++DF+YE +M+ +N+ L  ++ T
Sbjct: 59  RDIPG----VTVKSFSGLLVDFARREEAVAIVRGLRAVSDFEYEFQMSIMNKKLASDLET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L       +++S++IR   S+   I   VP  V
Sbjct: 115 VFLMTATEYSFLSSSIIRQAASLGGCIHGLVPPEV 149


>gi|16272594|ref|NP_438811.1| phosphopantetheine adenylyltransferase [Haemophilus influenzae Rd
           KW20]
 gi|260581372|ref|ZP_05849187.1| pantetheine-phosphate adenylyltransferase [Haemophilus influenzae
           RdAW]
 gi|1170640|sp|P44805|COAD_HAEIN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|1573650|gb|AAC22310.1| lipopolysaccharide core biosynthesis protein (kdtB) [Haemophilus
           influenzae Rd KW20]
 gi|260091967|gb|EEW75915.1| pantetheine-phosphate adenylyltransferase [Haemophilus influenzae
           RdAW]
          Length = 156

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 90/160 (56%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M   +Y G+FDPITNGH+DII ++      +++A+  NS   K   S++ER EL++QS+ 
Sbjct: 1   MTSVIYPGTFDPITNGHLDIIERSAVIFPRVLVAV-ANSPSKKPLFSLEERVELVRQSVV 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + V V  F  L  N+ K  +   I+RG+R  TDF+YE+++ ++NR L   + +
Sbjct: 60  HL-----SNVEVFGFSDLLANVIKQHNISAIIRGVRTTTDFEYELQLAALNRLLTKGVDS 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +     E   +V+ST++R +     D+   VP PV   LK
Sbjct: 115 LFFPPAEKWAFVSSTIVREIYLHGGDVAELVPVPVFNALK 154


>gi|152978354|ref|YP_001343983.1| phosphopantetheine adenylyltransferase [Actinobacillus succinogenes
           130Z]
 gi|171704244|sp|A6VM51|COAD_ACTSZ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|150840077|gb|ABR74048.1| pantetheine-phosphate adenylyltransferase [Actinobacillus
           succinogenes 130Z]
          Length = 161

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 91/156 (58%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y G+FDPITNGH+DII +       +++A+  +  K K    +Q+R +L ++S+ 
Sbjct: 1   MKTVIYPGTFDPITNGHLDIIERTAVLFPQVIVAVAASPTK-KPLFDLQDRVQLAEESVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V VI F GL  +  K+     I+RG+R   DF+YE+++  +NR L   + +
Sbjct: 60  H-LPN----VRVIGFSGLLADAVKEHDITAIIRGMRTTMDFEYELQLAHLNRVLSQGVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + L + E   YV+ST++R +   + ++  FVP PV 
Sbjct: 115 LFLPSTEQWSYVSSTIVREIYLHNGNVDQFVPPPVL 150


>gi|319649690|ref|ZP_08003846.1| phosphopantetheine adenylyltransferase [Bacillus sp. 2_A_57_CT2]
 gi|317398852|gb|EFV79534.1| phosphopantetheine adenylyltransferase [Bacillus sp. 2_A_57_CT2]
          Length = 159

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 95/157 (60%), Gaps = 6/157 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AV  GSFDPIT GH+DII +A    E + + +  NS K K   +++ER +LI++     +
Sbjct: 5   AVCPGSFDPITYGHLDIIKRAAKVFEQVYVVVLNNSSK-KPLFTVEERIQLIEE-----V 58

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                 V V SF+GL ++ AK ++A  ++RGLR ++DF+YEM++TS+NR L  E+ T  +
Sbjct: 59  TKDLKNVKVDSFQGLLMDYAKSVNASAVIRGLRAVSDFEYEMQITSMNRVLNDEVETFFI 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
                  +++S++++ +   + +I+  VPD V   LK
Sbjct: 119 MTNNQYSFLSSSIVKEVAKYNGNISELVPDTVEKALK 155


>gi|78067606|ref|YP_370375.1| phosphopantetheine adenylyltransferase [Burkholderia sp. 383]
 gi|123567612|sp|Q39CT5|COAD_BURS3 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|77968351|gb|ABB09731.1| Coenzyme A biosynthesis protein [Burkholderia sp. 383]
          Length = 165

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/163 (33%), Positives = 99/163 (60%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F S++ER  +  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRAKKPFFSLEERLTIANEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+SF GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VKVMSFTGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              +  ++++ T++R +  +  D++ FV   V  +L   V ++
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAM 160


>gi|27364268|ref|NP_759796.1| phosphopantetheine adenylyltransferase [Vibrio vulnificus CMCP6]
 gi|37678476|ref|NP_933085.1| phosphopantetheine adenylyltransferase [Vibrio vulnificus YJ016]
 gi|320157661|ref|YP_004190040.1| phosphopantetheine adenylyltransferase [Vibrio vulnificus MO6-24/O]
 gi|29427710|sp|Q8DDY6|COAD_VIBVU RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|61212680|sp|Q7MPS0|COAD_VIBVY RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|27360386|gb|AAO09323.1| pantetheine-phosphate adenylyltransferase [Vibrio vulnificus CMCP6]
 gi|37197216|dbj|BAC93056.1| phosphopantetheine adenylyltransferase [Vibrio vulnificus YJ016]
 gi|319932973|gb|ADV87837.1| phosphopantetheine adenylyltransferase [Vibrio vulnificus MO6-24/O]
          Length = 164

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 91/156 (58%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           + + VY G+FDPITNGH+D+I +A    ++++IA+  +  K   F +++ER +  +Q   
Sbjct: 6   LSRVVYPGTFDPITNGHLDLIERAAKMFDEVIIAVAASPSKNTMF-TLEERVDFARQVTR 64

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + V+   F GL V+ A+ + A V++RGLR   DF+YE  +T++ R L P + +
Sbjct: 65  HL-----DNVTAQGFSGLMVDFARAVDANVLIRGLRTTVDFEYEFGLTNMYRRLLPGLES 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + L   E   +++ST++R +     D+T FVP  V 
Sbjct: 120 VFLTPSEEHAFISSTIVREVAIHGGDVTQFVPTVVA 155


>gi|163790319|ref|ZP_02184751.1| hypothetical protein CAT7_07663 [Carnobacterium sp. AT7]
 gi|159874390|gb|EDP68462.1| hypothetical protein CAT7_07663 [Carnobacterium sp. AT7]
          Length = 161

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 94/162 (58%), Gaps = 7/162 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A++ GSFDP TNGH+D + +A    + +VIA+  NS K     S++E+   IK+++
Sbjct: 1   MDKIALFPGSFDPFTNGHLDTVERASKLFDQVVIAVATNSTKN-ALFSLEEKITFIKKAV 59

Query: 61  FHFIPDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
            H        VSV    G L VNLAK I A  ++RGLR+  DF+YE  + ++N+    +I
Sbjct: 60  EHI-----ENVSVTEHSGGLTVNLAKKIGAVTLLRGLRNNADFEYESTIATMNKIQHKDI 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            T+ L + E  R+++S+LI+ +     D++S VP  V   +K
Sbjct: 115 ETMFLMSNEKYRFLSSSLIKEVAMFGGDVSSLVPAGVNEAIK 156


>gi|268319678|ref|YP_003293334.1| hypothetical protein FI9785_1206 [Lactobacillus johnsonii FI9785]
 gi|262398053|emb|CAX67067.1| coaD [Lactobacillus johnsonii FI9785]
          Length = 166

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 97/161 (60%), Gaps = 7/161 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA++ GSFDPITNGH+++I  A    E L + I  N+ K K   + +ER EL ++ +F
Sbjct: 1   MTKAIFPGSFDPITNGHVEVIEGASHMFEKLYVVIMTNTSK-KYLFNERERLELARK-VF 58

Query: 62  HFIPDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
               +++ +V VI+    L V +A ++ A  IVRGLR+  DF+YE  +  +N+ L P++ 
Sbjct: 59  ----ENNEKVEVIARPAELTVEVAHELGAGAIVRGLRNTADFNYERDIAGINKTLDPDLN 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ LF +    +++S++I+  +    D+++ VP PV   L+
Sbjct: 115 TVLLFTRPEDSFISSSMIKETVFFGGDVSTLVPKPVAAALE 155


>gi|153940416|ref|YP_001391789.1| phosphopantetheine adenylyltransferase [Clostridium botulinum F
           str. Langeland]
 gi|170756472|ref|YP_001782036.1| phosphopantetheine adenylyltransferase [Clostridium botulinum B1
           str. Okra]
 gi|170760174|ref|YP_001787808.1| phosphopantetheine adenylyltransferase [Clostridium botulinum A3
           str. Loch Maree]
 gi|166216539|sp|A7GG79|COAD_CLOBL RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488133|sp|B1IIK4|COAD_CLOBK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488134|sp|B1KX43|COAD_CLOBM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|152936312|gb|ABS41810.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum F
           str. Langeland]
 gi|169121684|gb|ACA45520.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum B1
           str. Okra]
 gi|169407163|gb|ACA55574.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum A3
           str. Loch Maree]
 gi|295319815|gb|ADG00193.1| pantetheine-phosphate adenylyltransferase [Clostridium botulinum F
           str. 230613]
          Length = 164

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 90/155 (58%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ AVY GSFDPIT GH++II +A    + L++A+  N  K KG  S+ ER E+IK+   
Sbjct: 1   MKTAVYPGSFDPITKGHLNIIKRASKVCDKLIVAVLVNPEK-KGLFSVDERVEMIKR--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +  + + + V  F GL ++  K+  ++VI++GLR M+DF+YE +M  +N  L P I T
Sbjct: 57  --VTKNHSNIEVQCFSGLLIDFMKEKKSKVIIKGLRTMSDFEYEFKMALMNNKLDPNIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + +       Y++S+ ++ +      I   VPD +
Sbjct: 115 VFMMTNAKYSYLSSSSVKQVAMFGGCIKDLVPDEI 149


>gi|119475396|ref|ZP_01615749.1| pantetheine-phosphate adenylyltransferase [marine gamma
           proteobacterium HTCC2143]
 gi|119451599|gb|EAW32832.1| pantetheine-phosphate adenylyltransferase [marine gamma
           proteobacterium HTCC2143]
          Length = 159

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 90/152 (59%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M   +Y G+F+PITNGH+D++ +A      +V+AI  +  K   F S+ ER +L +Q++ 
Sbjct: 1   MNTVIYPGTFNPITNGHIDLVERASKLFGKVVLAIAYSERKQPMF-SLDERIDLCQQALS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + + V  F  L V  A+  ++  ++RG+R M DF+YE++M  +NR + P   T
Sbjct: 60  HL-----DNIEVCGFNNLLVEFAQSKNSNTVLRGVRSMKDFEYEIQMADMNRAMTPGFET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + L   +   Y++STL+R + ++  D++SFVP
Sbjct: 115 VFLTPSDGLSYISSTLVREISTMGGDVSSFVP 146


>gi|256032928|pdb|3IKZ|A Chain A, Crystal Structure Of Phosphopantetheine
           Adenylyltransferase From Burkholderia Pseudomallei
 gi|262368174|pdb|3K9W|A Chain A, Crystal Structure Of Phosphopantetheine
           Adenylyltransferase From Burkholderia Pseudomallei With
           Hydrolyzed 3'-Dephospho Coenzyme A
 gi|315364797|pdb|3PXU|A Chain A, Crystal Structure Of Phosphopantetheine
           Adenylyltransferase From Burkholderia Pseudomallei Bound
           To Dephospho-Coenzyme A
          Length = 170

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/168 (32%), Positives = 100/168 (59%), Gaps = 6/168 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F S++ER ++  + + H+ 
Sbjct: 8   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRAKKPFFSLEERLKIANEVLGHY- 65

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+ F GL  +  +   A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 66  PN----VKVMGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 121

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDS 172
              +  ++++ T++R +  +  D++ FV   V  +L   V ++ +  S
Sbjct: 122 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMAQGPS 169


>gi|261250520|ref|ZP_05943095.1| phosphopantetheine adenylyltransferase [Vibrio orientalis CIP
           102891]
 gi|260939089|gb|EEX95076.1| phosphopantetheine adenylyltransferase [Vibrio orientalis CIP
           102891]
          Length = 160

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 92/157 (58%), Gaps = 8/157 (5%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y G+FDP+TNGH D++ +A S  + LVI +  +  K   F S++ER  L++++  
Sbjct: 1   MRIAIYPGTFDPVTNGHYDLVKRAASMFDHLVIGVAESPSKNTLF-SLEERVALLRETCS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                  N VSV  F GL V+ A +  A ++VRGLR   DF+YE  +T++ R L PE+ +
Sbjct: 60  EL-----NNVSVDGFSGLLVDFATEKKATILVRGLRTTMDFEYEFGLTTMYRRLKPELES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           + L   E   +++STL+R +     ++  FVP   CV
Sbjct: 115 LFLTPAEEYAFLSSTLVREVAIHGGEVEQFVPK--CV 149


>gi|71736330|ref|YP_276889.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71556883|gb|AAZ36094.1| pantetheine-phosphate adenylyltransferase [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 187

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 92/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+   S K      +++R EL ++   
Sbjct: 29  MNRVLYPGTFDPITKGHGDLVERASRLFDHVVIAVAA-SPKKNPLFPLEQRVELAREVTK 87

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 88  H-LPN----VEVVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 142

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++  DIT FV
Sbjct: 143 LFLTPSERYSFISSTLVREIAALGGDITKFV 173


>gi|281357724|ref|ZP_06244210.1| pantetheine-phosphate adenylyltransferase [Victivallis vadensis
           ATCC BAA-548]
 gi|281315671|gb|EFA99698.1| pantetheine-phosphate adenylyltransferase [Victivallis vadensis
           ATCC BAA-548]
          Length = 165

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 94/156 (60%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y GSFDP TNGH D++ +A    + +++A+  NS K+  F +++ER ELI++S  
Sbjct: 1   MKTVLYPGSFDPFTNGHRDLVARAGLLFDQVIVAVAVNSEKSPMF-TLEERKELIEKSCA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P     V V++F GL V+  +  +AQ ++RGLR  +DF+YE++M  +NR L  E  T
Sbjct: 60  D-LP----HVKVVAFRGLVVDAIEKYNAQAVLRGLRAFSDFEYELQMALMNRSLRRECET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           I +     + YV S L++ + ++  +   +VP+ V 
Sbjct: 115 IFMMPTLENSYVASRLVKEVAALKGNYRQYVPEVVA 150


>gi|125717482|ref|YP_001034615.1| phosphopantetheine adenylyltransferase [Streptococcus sanguinis
           SK36]
 gi|166216611|sp|A3CLL0|COAD_STRSV RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|125497399|gb|ABN44065.1| Phosphopantetheine adenylyltransferase [Streptococcus sanguinis
           SK36]
          Length = 164

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 93/160 (58%), Gaps = 7/160 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+T GH+D+I +A    + L + I  N  K+ GF +I+ R  ++K+++ H  
Sbjct: 6   GLFTGSFDPMTKGHVDLIERASRLFDKLYVGIFYNREKS-GFFTIEARERIVKEALQHL- 63

Query: 65  PDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                 V VI+ +  LAV +A+ +  Q  VRGLR+  D DYE  M   N+ L  E+ TI 
Sbjct: 64  ----RNVEVITSQNELAVTVARRLGTQAFVRGLRNSQDLDYEANMNFFNQELAGEMETIF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           L +K   ++++S+ IR LI+   DI ++VP  V   L+ I
Sbjct: 120 LLSKPVYQHISSSRIRELIAFQQDIAAYVPQSVIKELERI 159


>gi|291276512|ref|YP_003516284.1| phosphopantetheine adenylyltransferase [Helicobacter mustelae
           12198]
 gi|290963706|emb|CBG39539.1| Putative Phosphopantetheine adenylyltransferase [Helicobacter
           mustelae 12198]
          Length = 162

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 95/156 (60%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y G+FDP+TNGH+D+I ++    ++L++A+  NS K+  F S+++R E++  + 
Sbjct: 1   MRRLAIYPGTFDPLTNGHLDVIKRSAELFDNLIVAVAKNSAKSPLF-SLEDRIEMLGLAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             F     + VS + F+ L  + AK   A+V++RGLR M+DF+YE++M   N  L  E+ 
Sbjct: 60  RDF-----SNVSCVGFDNLLADFAKQNGARVLIRGLRVMSDFEYELQMGYANASLNTELE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           TI       + +++S+++R+++     I+  VP  V
Sbjct: 115 TIYFMPSLKNAFISSSIVRNILEYGGKISHIVPHAV 150


>gi|293115339|ref|ZP_05791004.2| pantetheine-phosphate adenylyltransferase [Butyrivibrio crossotus
           DSM 2876]
 gi|292810501|gb|EFF69706.1| pantetheine-phosphate adenylyltransferase [Butyrivibrio crossotus
           DSM 2876]
          Length = 174

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 94/150 (62%), Gaps = 6/150 (4%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KAVY GSFDPIT GH+DII +A   V++LV+ I  N+ K   F ++ ER E++++++   
Sbjct: 8   KAVYPGSFDPITYGHLDIITRASRIVDELVVGILVNNTKRPMF-TMDERLEMLRETV--- 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
             D  N V V +FEG+ ++ A+   A+VI+RGLR ++D++ EM++   NR L PEI T+ 
Sbjct: 64  -KDLHN-VEVKTFEGMTIDFARQNGAKVIIRGLRVISDYETEMQIAQTNRSLDPEIETLF 121

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVP 153
           L       +++ST+ + +   +A +   VP
Sbjct: 122 LSTGLEYSFLSSTIAKEVAFYNAGVEKLVP 151


>gi|307546574|ref|YP_003899053.1| phosphopantetheine adenylyltransferase [Halomonas elongata DSM
           2581]
 gi|307218598|emb|CBV43868.1| phosphopantetheine adenylyltransferase [Halomonas elongata DSM
           2581]
          Length = 159

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 92/161 (57%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY G+FDPITNGH D+I +A    + +V+AI  +  K    L I  R  L ++ + 
Sbjct: 1   MNTAVYPGTFDPITNGHYDLIERAARLFDHIVVAIASSPGKAPT-LDIDARIALARKVV- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               +  + V V+ F GL     +   A++++RGLR ++DF+YE+++ ++NR   PE+ T
Sbjct: 59  ----EQHDNVEVVGFSGLLTEFMRQRQARILLRGLRAVSDFEYELQLANMNRAQMPELET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L  +  + Y++STL+R +  +  D++  V   V   LKN
Sbjct: 115 VFLTPEVENSYISSTLVREIARLGGDVSQHVHPEVAEALKN 155


>gi|212696073|ref|ZP_03304201.1| hypothetical protein ANHYDRO_00609 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212676702|gb|EEB36309.1| hypothetical protein ANHYDRO_00609 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 163

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 95/161 (59%), Gaps = 6/161 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K +Y GSFDPIT GH+DII +     +++V+AI  N  K   F SI+ER +LI++ I   
Sbjct: 2   KVIYPGSFDPITIGHLDIIKRLDQMFDEVVVAILINEAKHSLF-SIKERKQLIEEEIKE- 59

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
             +    V V +FEGL V+ AK  +++ IVRG+R +TD++YE+ +   N  L P + TI 
Sbjct: 60  --NKLKNVKVKTFEGLLVDFAKKENSKTIVRGIRAVTDYEYEINIAQFNANLYPGLETIF 117

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPV--CVFLKN 162
           L +     +++S+ IR L S   D++ FV   V   ++ KN
Sbjct: 118 LLSNPKFSFISSSGIRELASFGGDVSKFVSKNVKKAIYEKN 158


>gi|162449985|ref|YP_001612352.1| pantetheine-phosphate adenylyltransferase [Sorangium cellulosum 'So
           ce 56']
 gi|161160567|emb|CAN91872.1| Pantetheine-phosphate adenylyltransferase [Sorangium cellulosum 'So
           ce 56']
          Length = 165

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 91/157 (57%), Gaps = 6/157 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY GSFDPIT GH+D+I +A     +++IA+G +  K   F +  ER EL++Q+     
Sbjct: 7   AVYAGSFDPITFGHLDLIQRASKLFGEVIIAVGRHPTKHPLF-TYSERLELLRQTT---- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                   + SFEGL +   + + A+VIVRGLR  TDF+YE+++   N  + P + T+ L
Sbjct: 62  -SEVTNARIDSFEGLLIQYCQRVGARVIVRGLRAATDFEYELQIAHANADMLPGVDTVFL 120

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
             +    +V+++L+R + S   D++ + P  VC  L+
Sbjct: 121 PTRTHYGFVSASLVREIASHGGDVSHYAPAAVCDALR 157


>gi|53718156|ref|YP_107142.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           K96243]
 gi|53724089|ref|YP_104609.1| phosphopantetheine adenylyltransferase [Burkholderia mallei ATCC
           23344]
 gi|67643443|ref|ZP_00442189.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei GB8
           horse 4]
 gi|76810814|ref|YP_332162.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           1710b]
 gi|83721501|ref|YP_441027.1| phosphopantetheine adenylyltransferase [Burkholderia thailandensis
           E264]
 gi|121600724|ref|YP_991444.1| phosphopantetheine adenylyltransferase [Burkholderia mallei SAVP1]
 gi|124385558|ref|YP_001027480.1| phosphopantetheine adenylyltransferase [Burkholderia mallei NCTC
           10229]
 gi|126438597|ref|YP_001057617.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           668]
 gi|126449072|ref|YP_001082446.1| phosphopantetheine adenylyltransferase [Burkholderia mallei NCTC
           10247]
 gi|126453101|ref|YP_001064863.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           1106a]
 gi|134279804|ref|ZP_01766516.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 305]
 gi|167001050|ref|ZP_02266851.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei
           PRL-20]
 gi|167579756|ref|ZP_02372630.1| phosphopantetheine adenylyltransferase [Burkholderia thailandensis
           TXDOH]
 gi|167617832|ref|ZP_02386463.1| phosphopantetheine adenylyltransferase [Burkholderia thailandensis
           Bt4]
 gi|167718010|ref|ZP_02401246.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           DM98]
 gi|167737027|ref|ZP_02409801.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           14]
 gi|167822661|ref|ZP_02454132.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           9]
 gi|167844232|ref|ZP_02469740.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           B7210]
 gi|167892742|ref|ZP_02480144.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           7894]
 gi|167901238|ref|ZP_02488443.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           NCTC 13177]
 gi|167909456|ref|ZP_02496547.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           112]
 gi|167917484|ref|ZP_02504575.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           BCC215]
 gi|217419679|ref|ZP_03451185.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 576]
 gi|226199572|ref|ZP_03795129.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei Pakistan 9]
 gi|237810767|ref|YP_002895218.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei MSHR346]
 gi|242314120|ref|ZP_04813136.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 1106b]
 gi|254175299|ref|ZP_04881960.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei ATCC
           10399]
 gi|254181870|ref|ZP_04888467.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 1655]
 gi|254187804|ref|ZP_04894316.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254201696|ref|ZP_04908060.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei FMH]
 gi|254207030|ref|ZP_04913381.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei JHU]
 gi|254260707|ref|ZP_04951761.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 1710a]
 gi|254296078|ref|ZP_04963535.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 406e]
 gi|254357509|ref|ZP_04973783.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei
           2002721280]
 gi|257140320|ref|ZP_05588582.1| phosphopantetheine adenylyltransferase [Burkholderia thailandensis
           E264]
 gi|61212521|sp|Q62FB8|COAD_BURMA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|61212527|sp|Q63XM3|COAD_BURPS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123538063|sp|Q2T1C2|COAD_BURTA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|123600328|sp|Q3JW91|COAD_BURP1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216064|sp|A3MQB0|COAD_BURM7 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216065|sp|A2S6B1|COAD_BURM9 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216066|sp|A1UZP1|COAD_BURMS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216067|sp|A3NR92|COAD_BURP0 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216068|sp|A3N5J6|COAD_BURP6 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|52208570|emb|CAH34506.1| phosphopantetheine adenylyltransferase [Burkholderia pseudomallei
           K96243]
 gi|52427512|gb|AAU48105.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei ATCC
           23344]
 gi|76580267|gb|ABA49742.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 1710b]
 gi|83655326|gb|ABC39389.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           thailandensis E264]
 gi|121229534|gb|ABM52052.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei
           SAVP1]
 gi|124293578|gb|ABN02847.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei NCTC
           10229]
 gi|126218090|gb|ABN81596.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 668]
 gi|126226743|gb|ABN90283.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 1106a]
 gi|126241942|gb|ABO05035.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei NCTC
           10247]
 gi|134249004|gb|EBA49086.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 305]
 gi|147747590|gb|EDK54666.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei FMH]
 gi|147752572|gb|EDK59638.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei JHU]
 gi|148026573|gb|EDK84658.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei
           2002721280]
 gi|157805868|gb|EDO83038.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 406e]
 gi|157935484|gb|EDO91154.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160696344|gb|EDP86314.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei ATCC
           10399]
 gi|184212408|gb|EDU09451.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 1655]
 gi|217396983|gb|EEC36999.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 576]
 gi|225928453|gb|EEH24483.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei Pakistan 9]
 gi|237506052|gb|ACQ98370.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei MSHR346]
 gi|238524795|gb|EEP88226.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei GB8
           horse 4]
 gi|242137359|gb|EES23761.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 1106b]
 gi|243063121|gb|EES45307.1| pantetheine-phosphate adenylyltransferase [Burkholderia mallei
           PRL-20]
 gi|254219396|gb|EET08780.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei 1710a]
          Length = 166

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/168 (32%), Positives = 100/168 (59%), Gaps = 6/168 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F S++ER ++  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRAKKPFFSLEERLKIANEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+ F GL  +  +   A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VKVMGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDS 172
              +  ++++ T++R +  +  D++ FV   V  +L   V ++ +  S
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMAQGPS 165


>gi|89071162|ref|ZP_01158355.1| pantetheine-phosphate adenylyltransferase [Oceanicola granulosus
           HTCC2516]
 gi|89043288|gb|EAR49513.1| pantetheine-phosphate adenylyltransferase [Oceanicola granulosus
           HTCC2516]
          Length = 164

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 89/161 (55%), Gaps = 1/161 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+T GH+DII +A   V+ LVI +  N  K   F  ++ R  +I+    
Sbjct: 1   MRIGLYPGTFDPVTLGHLDIIRRACGLVDRLVIGVAINRDKGPAF-DLETRVAMIEAECR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                ++  + V  FE L ++ A D+ AQ+I+RGLR + DF+YE +M  +NR L   + T
Sbjct: 60  ALSEAAATEIVVYPFENLLIDCAHDVGAQLIIRGLRAVADFEYEYQMVGMNRQLDDSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L A+   + + S L++ +  +  D+T FV   V   L+ 
Sbjct: 120 VFLMAEAQHQAIASKLVKEIARLGGDVTKFVTPAVAEALRG 160


>gi|330818357|ref|YP_004362062.1| phosphopantetheine adenylyltransferase [Burkholderia gladioli BSR3]
 gi|327370750|gb|AEA62106.1| phosphopantetheine adenylyltransferase [Burkholderia gladioli BSR3]
          Length = 166

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 99/163 (60%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F S++ER ++  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRAKKPFFSLEERLKIANEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+ F GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VKVMGFTGLLKDFVRANNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              +  ++++ T++R +  +  D++ FV   V  +L   V ++
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAM 160


>gi|311087953|gb|ADP68032.1| phosphopantetheine adenylyltransferase [Buchnera aphidicola str.
           JF98 (Acyrthosiphon pisum)]
          Length = 165

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 90/153 (58%), Gaps = 5/153 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y G+FDPIT GH+DII +A    + + IAI  N  K K   +++ER EL ++  
Sbjct: 1   MNKTAIYPGTFDPITYGHLDIITRATKIFDSITIAISNNFTK-KPIFNLKERIELTRKVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      N   ++ F  L  NLAK   A +++RG+R + DFDYE+++ ++N+ + P++ 
Sbjct: 60  LHL----KNVKKILGFNDLLANLAKKEKANILIRGVRTIFDFDYEIKLAAINKQIYPDLD 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           +I L + +   +++S+ ++ +     DI  ++P
Sbjct: 116 SIFLLSSKEVSFISSSFVKEIAKYKGDIKPYLP 148


>gi|302525046|ref|ZP_07277388.1| pantetheine-phosphate adenylyltransferase [Streptomyces sp. AA4]
 gi|302433941|gb|EFL05757.1| pantetheine-phosphate adenylyltransferase [Streptomyces sp. AA4]
          Length = 160

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 97/152 (63%), Gaps = 7/152 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GS+DP TNGH+DII +A    +++V+A+G N  K KG  S++ER E++++ I 
Sbjct: 1   MRRAVCPGSYDPATNGHLDIIERASKLFDEVVVAVGVNKSK-KGLFSVEERMEILRE-IT 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P+    V V S++GL V+  ++     + +GLR ++DFDYE++M  +NR L   + T
Sbjct: 59  AELPN----VRVDSWQGLLVDYCRENDIAAVAKGLRSVSDFDYELQMAQMNRELTG-LET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + +    +  +V+S+L++ + ++  DI + VP
Sbjct: 114 LLMANNPAYGFVSSSLVKEIAALGGDIENLVP 145


>gi|254196836|ref|ZP_04903260.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei S13]
 gi|169653579|gb|EDS86272.1| pantetheine-phosphate adenylyltransferase [Burkholderia
           pseudomallei S13]
          Length = 174

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 99/165 (60%), Gaps = 6/165 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F S++ER ++  + + H+ 
Sbjct: 12  AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRAKKPFFSLEERLKIANEVLGHY- 69

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+ F GL  +  +   A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 70  PN----VKVMGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 125

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
              +  ++++ T++R +  +  D++ FV   V  +L   V ++ +
Sbjct: 126 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMAQ 170


>gi|330430828|gb|AEC22162.1| phosphopantetheine adenylyltransferase [Pusillimonas sp. T7-7]
          Length = 168

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 92/148 (62%), Gaps = 6/148 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A    + +V+ +  +  K K F ++ ER E+ ++ + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRAAGLFDHVVVGVAHSHAK-KPFFTVDERVEIAQEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
              SN V V SF GL  +  ++ + +VIVRGLR ++DF+YE +M  +NR L PE+ T+ +
Sbjct: 62  ---SN-VEVKSFAGLLKDFVREQNGRVIVRGLRAVSDFEYEFQMAGMNRHLLPEVETLFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFV 152
              +  ++++ T++R +  +  D++ FV
Sbjct: 118 TPSDQYQFISGTIVREIAILGGDVSKFV 145


>gi|86147273|ref|ZP_01065588.1| phosphopantetheine adenylyltransferase [Vibrio sp. MED222]
 gi|85834988|gb|EAQ53131.1| phosphopantetheine adenylyltransferase [Vibrio sp. MED222]
          Length = 159

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 99/168 (58%), Gaps = 10/168 (5%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y G+FDP+TNGH D+I +A    E LVI +  +  K   F S+ ER  L++++  
Sbjct: 1   MKIAIYPGTFDPVTNGHYDLIKRAACMFEKLVIGVAESPSKATLF-SLDERVALLRETC- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    VSV  F GL V+ A + +A ++VRGLR   DF+YE  +T++ R L PE+ +
Sbjct: 59  HELPN----VSVEGFSGLLVDFATEQNASILVRGLRTTMDFEYEFGLTTMYRRLKPELES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L   E   +++STL+R +     +I  FVP   CV     V++ VK
Sbjct: 115 LFLTPSEEFAFLSSTLVREVAIHGGEIEQFVPG--CV--HQAVVAKVK 158


>gi|242373355|ref|ZP_04818929.1| pantetheine-phosphate adenylyltransferase [Staphylococcus
           epidermidis M23864:W1]
 gi|242348718|gb|EES40320.1| pantetheine-phosphate adenylyltransferase [Staphylococcus
           epidermidis M23864:W1]
          Length = 167

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 98/159 (61%), Gaps = 6/159 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           +AV  GSFDPIT GH+DII ++    +++ + +  NS K   F S +ER +LIK S+ H 
Sbjct: 11  RAVIPGSFDPITYGHLDIIERSADRFDEIHVCVLKNSSKGGTFDS-EERIDLIKDSVQHL 69

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V V  F GL V+    + A+ I+RGLR ++DF+YE+R+TS+N+ L  +I T+ 
Sbjct: 70  -----SNVEVHHFNGLLVDFCDQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNSDIETMY 124

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           +       +++S++++ + +  ADI++FVP  V   LK+
Sbjct: 125 MMTSTKYSFISSSIVKEVAAYKADISAFVPPHVEKALKD 163


>gi|147678088|ref|YP_001212303.1| phosphopantetheine adenylyltransferase [Pelotomaculum
           thermopropionicum SI]
 gi|146274185|dbj|BAF59934.1| phosphopantetheine adenylyltransferase [Pelotomaculum
           thermopropionicum SI]
          Length = 177

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 92/160 (57%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+  GSFDP+T GH+DII +A    + +++A+  N  K   F SI+ER E++K+ + 
Sbjct: 1   MRIAICPGSFDPVTYGHLDIIGRASILFDKIIVAVSRNPTKNPIF-SIEERVEMLKEVL- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                S N V V SFEGL VN A +  A+ IVRGLR ++DF+ E RM   N+ L   I T
Sbjct: 59  ----KSYNNVEVDSFEGLTVNYAIERKAKAIVRGLRVISDFENEFRMALTNKKLACHIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L  +    Y++ST ++ + S    + S VP  V   LK
Sbjct: 115 VFLMTRAEFSYISSTTVKEVASFGGSVRSLVPPLVEERLK 154


>gi|15617173|ref|NP_240386.1| lipopolysaccharide core biosynthesis protein kDatB [Buchnera
           aphidicola str. APS (Acyrthosiphon pisum)]
 gi|219681924|ref|YP_002468310.1| lipopolysaccharide core biosynthesis protein kDatB [Buchnera
           aphidicola str. 5A (Acyrthosiphon pisum)]
 gi|219682479|ref|YP_002468863.1| lipopolysaccharide core biosynthesis protein kDatB [Buchnera
           aphidicola str. Tuc7 (Acyrthosiphon pisum)]
 gi|11386687|sp|P57643|COAD_BUCAI RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254763934|sp|B8D8E6|COAD_BUCA5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|254763935|sp|B8D8A3|COAD_BUCAT RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|25318301|pir||H84997 hypothetical protein kdtB [imported] - Buchnera sp. (strain APS)
 gi|10039238|dbj|BAB13272.1| lipopolysaccharide core biosynthesis protein kdtB [Buchnera
           aphidicola str. APS (Acyrthosiphon pisum)]
 gi|219622212|gb|ACL30368.1| lipopolysaccharide core biosynthesis protein kDatB [Buchnera
           aphidicola str. Tuc7 (Acyrthosiphon pisum)]
 gi|219624767|gb|ACL30922.1| lipopolysaccharide core biosynthesis protein kDatB [Buchnera
           aphidicola str. 5A (Acyrthosiphon pisum)]
 gi|311086305|gb|ADP66387.1| phosphopantetheine adenylyltransferase [Buchnera aphidicola str.
           LL01 (Acyrthosiphon pisum)]
          Length = 165

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 90/153 (58%), Gaps = 5/153 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y G+FDPIT GH+DII +A    + + IAI  N  K K   +++ER EL ++  
Sbjct: 1   MNKTAIYPGTFDPITYGHLDIITRATKIFDSITIAISNNFTK-KPIFNLKERIELTRKVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      N   ++ F  L  NLAK   A +++RG+R + DFDYE+++ ++N+ + P++ 
Sbjct: 60  LHL----KNVKKILGFNDLLANLAKKEKANILIRGVRTIFDFDYEIKLAAINKQIYPDLD 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           +I L + +   +++S+ ++ +     DI  ++P
Sbjct: 116 SIFLLSSKEVSFISSSFVKEIAKYKGDIKPYLP 148


>gi|257471633|ref|ZP_05635632.1| phosphopantetheine adenylyltransferase [Buchnera aphidicola str.
           LSR1 (Acyrthosiphon pisum)]
 gi|311087469|gb|ADP67549.1| phosphopantetheine adenylyltransferase [Buchnera aphidicola str.
           JF99 (Acyrthosiphon pisum)]
          Length = 179

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 90/153 (58%), Gaps = 5/153 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y G+FDPIT GH+DII +A    + + IAI  N  K K   +++ER EL ++  
Sbjct: 15  MNKTAIYPGTFDPITYGHLDIITRATKIFDSITIAISNNFTK-KPIFNLKERIELTRKVT 73

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      N   ++ F  L  NLAK   A +++RG+R + DFDYE+++ ++N+ + P++ 
Sbjct: 74  LHL----KNVKKILGFNDLLANLAKKEKANILIRGVRTIFDFDYEIKLAAINKQIYPDLD 129

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           +I L + +   +++S+ ++ +     DI  ++P
Sbjct: 130 SIFLLSSKEVSFISSSFVKEIAKYKGDIKPYLP 162


>gi|253690456|ref|YP_003019646.1| pantetheine-phosphate adenylyltransferase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|259491321|sp|C6DIB6|COAD_PECCP RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|251757034|gb|ACT15110.1| pantetheine-phosphate adenylyltransferase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 159

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 91/157 (57%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +V+AI  +  K   F ++ ER  L K + 
Sbjct: 1   MTTKAIYPGTFDPLTNGHLDLLTRASRLFDHVVLAIAASPSKQTLF-TLDERVALAKGAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V VI F  L  + A+  +A ++VRGLR + DF+YE+++  +N  L P + 
Sbjct: 60  EHL-----SNVDVIGFSDLMAHFAQQQNANILVRGLRAVADFEYELQLAKMNHHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E   +++S+L++ +     D++ F+PD + 
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHGGDVSHFLPDAIV 151


>gi|261823578|ref|YP_003261684.1| phosphopantetheine adenylyltransferase [Pectobacterium wasabiae
           WPP163]
 gi|261607591|gb|ACX90077.1| pantetheine-phosphate adenylyltransferase [Pectobacterium wasabiae
           WPP163]
          Length = 163

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 92/162 (56%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDP+TNGH+D++ +A    + +V+AI  +  K   F ++ ER  L K + 
Sbjct: 1   MTTKAIYPGTFDPLTNGHLDLLTRASRLFDHVVLAIAASPSKHTLF-TLDERVALAKGAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F  L  + A+   A ++VRGLR + DF+YE+++  +N  L P + 
Sbjct: 60  QHL-----SNVEVVGFSDLMAHFAQQQKANILVRGLRAVADFEYELQLAKMNHHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           ++ L   E   +++S+L++ +     D++ F+PD +   L+ 
Sbjct: 115 SVFLMPSEEWSFISSSLVKEVARHGGDVSHFLPDAIVSALEE 156


>gi|56416718|ref|YP_153792.1| phosphopantetheine adenylyltransferase [Anaplasma marginale str.
           St. Maries]
 gi|222475084|ref|YP_002563499.1| phosphopantetheine adenylyltransferase [Anaplasma marginale str.
           Florida]
 gi|254994927|ref|ZP_05277117.1| phosphopantetheine adenylyltransferase [Anaplasma marginale str.
           Mississippi]
 gi|255003062|ref|ZP_05278026.1| phosphopantetheine adenylyltransferase [Anaplasma marginale str.
           Puerto Rico]
 gi|255004186|ref|ZP_05278987.1| phosphopantetheine adenylyltransferase [Anaplasma marginale str.
           Virginia]
 gi|56387950|gb|AAV86537.1| phosphopantetheine adenylyltransferase [Anaplasma marginale str.
           St. Maries]
 gi|222419220|gb|ACM49243.1| phosphopantetheine adenylyltransferase [Anaplasma marginale str.
           Florida]
          Length = 170

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 100/159 (62%), Gaps = 5/159 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           +R  +Y G+FDPIT GH+DII +A + V++LVIA+  + VK   F S   R+ +I + + 
Sbjct: 6   IRLGIYPGTFDPITFGHIDIIKRASNLVDELVIAVAKSVVKETIF-SADMRAAMIGREMQ 64

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                 S +V V  F+GL    A+   AQVI+RGLR ++DFDYE +M+ +N  L P + T
Sbjct: 65  AL--GISAKVEV--FDGLLTYFAQSRGAQVIIRGLRAVSDFDYEFQMSWINYKLVPGVET 120

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L A + +++++S+ ++ +  ++ D++ FVP+ V  +L
Sbjct: 121 VFLPAAKDTQFISSSFVKEVARLNGDVSMFVPENVKKYL 159


>gi|210622472|ref|ZP_03293177.1| hypothetical protein CLOHIR_01125 [Clostridium hiranonis DSM 13275]
 gi|210154185|gb|EEA85191.1| hypothetical protein CLOHIR_01125 [Clostridium hiranonis DSM 13275]
          Length = 167

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 92/160 (57%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           ++KA++ GSFDPITNGH+DII +A     +L + I  N  K K   +++ER  LIK+   
Sbjct: 6   VKKAIFAGSFDPITNGHLDIIRRASKLFGELQVGILINPNK-KALFTLEERIRLIKECTA 64

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                  + V VISF+GL V   +      +VRG+R   D DYE++M  +NR L   I T
Sbjct: 65  DL-----DNVKVISFDGLLVKYCEQNGIDALVRGIRSAADVDYELQMAHMNRELDSSIET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           I L +     +++S+LI+ ++S  ADI + VP+ V   LK
Sbjct: 120 IFLPSNTKFSFISSSLIKEVLSFGADIQNLVPEQVLRELK 159


>gi|114799402|ref|YP_761438.1| pantetheine-phosphate adenylyltransferase [Hyphomonas neptunium
           ATCC 15444]
 gi|114739576|gb|ABI77701.1| pantetheine-phosphate adenylyltransferase [Hyphomonas neptunium
           ATCC 15444]
          Length = 165

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 86/152 (56%), Gaps = 1/152 (0%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R  +Y G+FDP T GH+DI  +A   V+ L+I +  N  K K   S+ ER  +++   
Sbjct: 1   MHRIGLYPGTFDPPTAGHIDIFSRAAKLVDTLIIGVAINEAK-KPLFSLDERVAMVEHEC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            +        + ++   GL ++ A+  +A +IVRGLR + DF+YE +MT++N  L P+I 
Sbjct: 60  ANLKGTGLAEIKILPMRGLLMHFAEKCNANIIVRGLRAVQDFEYEFQMTAMNEQLNPDIE 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           TI L A    + V S L++ + S+  DIT FV
Sbjct: 120 TIFLMADVRHQAVASRLVKEIASLGGDITPFV 151


>gi|85859443|ref|YP_461645.1| phosphopantetheine adenylyltransferase [Syntrophus aciditrophicus
           SB]
 gi|123516625|sp|Q2LTS1|COAD_SYNAS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|85722534|gb|ABC77477.1| phosphopantetheine adenylyltransferase [Syntrophus aciditrophicus
           SB]
          Length = 165

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 91/156 (58%), Gaps = 6/156 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + AVY GSFDPITNGH+DII + LS  ++L++ I  N+ K+  F ++QER E+I++++
Sbjct: 1   MKKIAVYPGSFDPITNGHLDIIKRGLSMFDELIVLIAYNAAKSSLF-TVQERIEMIQEAL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V V S++GL V+  +     VI+RGLR M++F+YE ++  +NR L   I 
Sbjct: 60  -----HDRKGVRVDSYDGLLVDYVRKEGGNVILRGLRAMSEFEYEFQLALMNRRLNRNIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           T+ L       Y +ST+I+    +       VP+ V
Sbjct: 115 TVFLMTGYKWFYTSSTIIKEASRLGGSPKGLVPEVV 150


>gi|257066530|ref|YP_003152786.1| pantetheine-phosphate adenylyltransferase [Anaerococcus prevotii
           DSM 20548]
 gi|256798410|gb|ACV29065.1| pantetheine-phosphate adenylyltransferase [Anaerococcus prevotii
           DSM 20548]
          Length = 160

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 93/153 (60%), Gaps = 4/153 (2%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K +Y GSFDP+T GH+DII +     +++V+A+  N  K K   S++ER E+IK+ +   
Sbjct: 2   KVIYPGSFDPLTLGHIDIIKRLSKMFDEVVVAVLINEHK-KSVFSLEEREEIIKEQM--- 57

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           I D    VS+ SF+GL VN AK+   +++ RGLR++TD++YE  +   N  L   + TI 
Sbjct: 58  IKDGIENVSISSFDGLLVNFAKENDIKIVARGLREVTDYEYEKNIAMFNSKLMDGLETIF 117

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           L +  +  +++S+ +R + +   D++SFV   V
Sbjct: 118 LLSNPNYSFISSSGVREVATFKGDVSSFVSKEV 150


>gi|165976559|ref|YP_001652152.1| phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|303250118|ref|ZP_07336320.1| phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307246048|ref|ZP_07528130.1| Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307250389|ref|ZP_07532337.1| Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307252771|ref|ZP_07534662.1| Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307255030|ref|ZP_07536848.1| Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307259466|ref|ZP_07541191.1| Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307261615|ref|ZP_07543283.1| Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|229488114|sp|B0BQ73|COAD_ACTPJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|165876660|gb|ABY69708.1| phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|302651181|gb|EFL81335.1| phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306852983|gb|EFM85206.1| Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306857599|gb|EFM89707.1| Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306859803|gb|EFM91825.1| Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306861903|gb|EFM93879.1| Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306866402|gb|EFM98265.1| Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306868738|gb|EFN00547.1| Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 158

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 88/157 (56%), Gaps = 6/157 (3%)

Query: 6   VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIP 65
           +Y G+FDP+TNGH+DII +A      +++A+  N  K   F S++ER+ L++QS  H   
Sbjct: 6   IYAGTFDPMTNGHLDIIERASELFGQVIVAVAKNPSKQPLF-SLEERTALVRQSCAHLA- 63

Query: 66  DSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALF 125
                V  + F GL  + AK   A+ +VRG+R   D +YE+++  +N  L   + T+ L 
Sbjct: 64  ----NVQAVGFSGLLADFAKQHQAKALVRGIRGSDDIEYEIQLAQLNDKLSGRLDTVFLP 119

Query: 126 AKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
              + RY++ST++R +     D+  FVP+ V   LK 
Sbjct: 120 PSVTWRYLSSTMVREIYRHQGDVAQFVPNAVLCALKE 156


>gi|70733153|ref|YP_262926.1| phosphopantetheine adenylyltransferase [Pseudomonas fluorescens
           Pf-5]
 gi|229593161|ref|YP_002875280.1| phosphopantetheine adenylyltransferase [Pseudomonas fluorescens
           SBW25]
 gi|312963649|ref|ZP_07778130.1| pantetheine-phosphate adenylyltransferase [Pseudomonas fluorescens
           WH6]
 gi|123652269|sp|Q4K4A7|COAD_PSEF5 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|259491322|sp|C3K3N4|COAD_PSEFS RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|68347452|gb|AAY95058.1| pantetheine-phosphate adenylyltransferase [Pseudomonas fluorescens
           Pf-5]
 gi|229365027|emb|CAY53190.1| phosphopantetheine adenylyltransferase [Pseudomonas fluorescens
           SBW25]
 gi|311282158|gb|EFQ60758.1| pantetheine-phosphate adenylyltransferase [Pseudomonas fluorescens
           WH6]
          Length = 159

 Score =  107 bits (268), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 92/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+   S K      +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVIIAVAA-SPKKNPLFPLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  H-LPN----VEVVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++  DIT FV
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFV 145


>gi|311086879|gb|ADP66960.1| phosphopantetheine adenylyltransferase [Buchnera aphidicola str.
           TLW03 (Acyrthosiphon pisum)]
          Length = 197

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 90/153 (58%), Gaps = 5/153 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y G+FDPIT GH+DII +A    + + IAI  N  K K   +++ER EL ++  
Sbjct: 33  MNKTAIYPGTFDPITYGHLDIITRATKIFDSITIAISNNFTK-KPIFNLKERIELTRKVT 91

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      N   ++ F  L  NLAK   A +++RG+R + DFDYE+++ ++N+ + P++ 
Sbjct: 92  LHL----KNVKKILGFNDLLANLAKKEKANILIRGVRTIFDFDYEIKLAAINKQIYPDLD 147

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           +I L + +   +++S+ ++ +     DI  ++P
Sbjct: 148 SIFLLSSKEVSFISSSFVKEIAKYKGDIKPYLP 180


>gi|114766364|ref|ZP_01445346.1| pantetheine-phosphate adenylyltransferase [Pelagibaca bermudensis
           HTCC2601]
 gi|114541397|gb|EAU44444.1| pantetheine-phosphate adenylyltransferase [Roseovarius sp.
           HTCC2601]
          Length = 165

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 88/155 (56%), Gaps = 1/155 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F  ++ R  +I+    
Sbjct: 1   MRIGLYPGTFDPITLGHIDIIRRAAALVDRLVIGVAINRDKGPLF-DLETRVAMIESECR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   +    FE L ++ A D+ AQ+IVRGLR + DF+YE +M  +NR L   + T
Sbjct: 60  ALSEETGTEIVAHPFENLLIDCAHDVGAQIIVRGLRAVADFEYEFQMVGMNRSLDDSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L A+   + + S L++ +  +  D++ FV  PV
Sbjct: 120 VFLMAEARHQAIASKLVKEIARLGGDVSKFVTPPV 154


>gi|291278591|ref|YP_003495426.1| phosphopantetheine adenylyltransferase [Deferribacter desulfuricans
           SSM1]
 gi|290753293|dbj|BAI79670.1| phosphopantetheine adenylyltransferase [Deferribacter desulfuricans
           SSM1]
          Length = 162

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 96/156 (61%), Gaps = 6/156 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y G+FDP+TNGH+DII +     + L++A+   S + K    + +R  +I++S+ H +
Sbjct: 3   AIYPGTFDPLTNGHLDIIERGAKMFDRLIVAVA-ESKRKKPLFDLNDRVTMIEESVLH-L 60

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V SF  L V+  K+ +A VI+RGLR ++DF+YE+++  +NR L     T+ L
Sbjct: 61  PN----VEVESFSNLLVDFMKEKNADVILRGLRVVSDFEYELQLALMNRKLNANCETVFL 116

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
              +   +++S+++R +  +  D++ FVP PV  F+
Sbjct: 117 MPNKKYIFLSSSMVREIALLGGDVSCFVPKPVNDFI 152


>gi|238028674|ref|YP_002912905.1| phosphopantetheine adenylyltransferase [Burkholderia glumae BGR1]
 gi|237877868|gb|ACR30201.1| Phosphopantetheine adenylyltransferase [Burkholderia glumae BGR1]
          Length = 166

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 93/148 (62%), Gaps = 6/148 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F S++ER ++  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRAKKPFFSLEERLKIANEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+ F GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VKVMGFTGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFV 152
              +  ++++ T++R +  +  D++ FV
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFV 145


>gi|306824479|ref|ZP_07457825.1| pantetheine-phosphate adenylyltransferase [Streptococcus sp. oral
           taxon 071 str. 73H25AP]
 gi|304433266|gb|EFM36236.1| pantetheine-phosphate adenylyltransferase [Streptococcus sp. oral
           taxon 071 str. 73H25AP]
          Length = 162

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 93/159 (58%), Gaps = 7/159 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+TNGH+DII +A    + L + +  N  K +GFL ++ R   +++++ H  
Sbjct: 6   GLFTGSFDPMTNGHLDIIERASKLFDKLYVGVFYNPHK-QGFLPVENRKRAVEKAVAHL- 63

Query: 65  PDSSNRVSVI-SFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V V+ S + L V++A+ + A+ +VRGLR+ TD  YE      N  L PEI T+ 
Sbjct: 64  ----DNVEVLASHDQLVVDVARRLGAKTLVRGLRNGTDLQYEASFDYYNHQLAPEIETVY 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           L ++    Y++S+ +R L+    +I  +VP+ V   L++
Sbjct: 120 LHSRPEHLYISSSAMRELLKFGQEIQQYVPNSVVEELEH 158


>gi|83954349|ref|ZP_00963069.1| pantetheine-phosphate adenylyltransferase [Sulfitobacter sp.
           NAS-14.1]
 gi|83841386|gb|EAP80556.1| pantetheine-phosphate adenylyltransferase [Sulfitobacter sp.
           NAS-14.1]
          Length = 164

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 88/151 (58%), Gaps = 1/151 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F  ++ER   I++   
Sbjct: 1   MRVGLYPGTFDPITLGHIDIIRRAATLVDKLVIGVAINRDKGPLF-ELEERVAQIEEECG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   + V  FE L ++ A D+ AQ+I+RGLR + DF+YE +M  +NR L   + T
Sbjct: 60  KLNQETGTEIVVHPFENLLIDCAHDVGAQMIIRGLRAVADFEYEYQMVGMNRKLDDSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L A+   + + S L++ +  +  D++ FV
Sbjct: 120 VFLMAEAEHQAIASRLVKEIARLGGDVSKFV 150


>gi|237747435|ref|ZP_04577915.1| phosphopantetheine adenylyltransferase [Oxalobacter formigenes
           HOxBLS]
 gi|229378786|gb|EEO28877.1| phosphopantetheine adenylyltransferase [Oxalobacter formigenes
           HOxBLS]
          Length = 165

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 98/163 (60%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A    ++L++ +  +S   K F S++ER  + K+ + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASGLFDELIVGV-ADSRTKKPFFSMEERMAIAKEVLEHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V SF GL  +  ++ +A VI+RGLR ++DF+YE +M  +NR L PE  T+ +
Sbjct: 62  PN----VRVESFTGLLKDFVREHNASVIIRGLRAVSDFEYEFQMAGMNRYLMPEAETLFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              +  ++++ +++R +  +  D++ FV   V  +L+  V  +
Sbjct: 118 TPSDQYQFISGSIVREIAFLGGDVSKFVFPSVEKWLRKKVTEI 160


>gi|87312282|ref|ZP_01094381.1| phosphopantetheine adenylyltransferase [Blastopirellula marina DSM
           3645]
 gi|87285020|gb|EAQ76955.1| phosphopantetheine adenylyltransferase [Blastopirellula marina DSM
           3645]
          Length = 167

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 92/151 (60%), Gaps = 8/151 (5%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVYTGSFDP+T GH+++I ++   V+ L+I IG N  K  G  + +ER EL+++   H +
Sbjct: 9   AVYTGSFDPVTLGHLNLIERSSRLVDRLIIGIGTNDQKV-GLFNAEERVELVRRVTKH-V 66

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    + V+ F GLAV+  + ++A+ ++RG+R +TD   E  M   NR L P I T+ L
Sbjct: 67  PN----IDVLHFSGLAVDFVRSVNARAMIRGIRPLTDIAGEFTMMMANRKLDPGIETVFL 122

Query: 125 FAKESSRYVTSTLIRHLISIDAD--ITSFVP 153
            A E   +V+S+L++ +  +  D  +  FVP
Sbjct: 123 MADEEYGHVSSSLLKQITPLAGDDQLAKFVP 153


>gi|167561481|ref|ZP_02354397.1| phosphopantetheine adenylyltransferase [Burkholderia oklahomensis
           EO147]
 gi|167568711|ref|ZP_02361585.1| phosphopantetheine adenylyltransferase [Burkholderia oklahomensis
           C6786]
          Length = 166

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 55/168 (32%), Positives = 100/168 (59%), Gaps = 6/168 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F S++ER ++  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRAKKPFFSLEERLKIANEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+ F GL  +  +   A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VKVMGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDS 172
              +  ++++ T++R +  +  D++ FV   V  +L   V ++ +  S
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVSAMAQAPS 165


>gi|83816325|ref|YP_446183.1| pantetheine-phosphate adenylyltransferase [Salinibacter ruber DSM
           13855]
 gi|294508109|ref|YP_003572167.1| phosphopantetheine adenylyltransferase [Salinibacter ruber M8]
 gi|83757719|gb|ABC45832.1| pantetheine-phosphate adenylyltransferase [Salinibacter ruber DSM
           13855]
 gi|294344437|emb|CBH25215.1| Phosphopantetheine adenylyltransferase [Salinibacter ruber M8]
          Length = 164

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 90/158 (56%), Gaps = 6/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y G+FDP T GH D++ +AL   + + + +G N ++ +   S QER+ L+++      
Sbjct: 6   ALYPGTFDPFTFGHRDVLERALRVFDRVEVTVGVN-LEKETLFSTQERTALVRRCT---- 60

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
            +  + V V + +GL V+ A+ + A  +VRGLR ++DFD E RM   NR L PE+ T+  
Sbjct: 61  -EDLDGVEVQAHQGLIVDRAQKVGAVALVRGLRQVSDFDAEFRMAFANRKLAPELETVFF 119

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
              E    ++S+++R     D D++ FVP PV   L+ 
Sbjct: 120 MTSEEYALISSSMVRDAHRWDGDVSKFVPPPVVEALEQ 157


>gi|33151673|ref|NP_873026.1| phosphopantetheine adenylyltransferase [Haemophilus ducreyi
           35000HP]
 gi|61212731|sp|Q7VNN7|COAD_HAEDU RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|33147894|gb|AAP95415.1| phosphopantetheine adenylyltransferase [Haemophilus ducreyi
           35000HP]
          Length = 161

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 88/162 (54%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M    +Y G+FDPITNGH+DII +A      +++A+  N  K   F S+ ER+ L+ QS 
Sbjct: 1   MSYTVIYAGTFDPITNGHLDIITRATKLFAKVIVAVAQNPTKQPLF-SLSERTALVAQSC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V  +SF GL  + A+   A+ ++RG+R   D +YE++++ +N  L   + 
Sbjct: 60  SHL-----TNVEAVSFSGLLADFARQHHAKALIRGIRGSDDIEYEIQLSQLNNKLADGLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ L      RY++ST+IR +      + +FVP  V   L+N
Sbjct: 115 TVFLPPAVEWRYLSSTMIREIYYHQGQVNAFVPTAVVQALQN 156


>gi|58579017|ref|YP_197229.1| phosphopantetheine adenylyltransferase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417643|emb|CAI26847.1| Phosphopantetheine adenylyltransferase [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 168

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 60/158 (37%), Positives = 96/158 (60%), Gaps = 5/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            +Y G+FDPIT GH+DII +A + V+ L+I +   S   K   S + R+ELI+    H +
Sbjct: 7   GIYPGTFDPITFGHIDIIKRAYNLVDKLIIGV-ARSCSKKTIFSAEIRAELIE----HEM 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
              +  V  + F+GL V  A+  +A VI+RGLR ++DFDYE +M+ VN  L   I TI L
Sbjct: 62  KLLNMMVDTVIFDGLLVYFAQKNNASVIIRGLRAISDFDYEFQMSWVNYKLNQNIETIFL 121

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            A E +++++S+ ++ +  +  DI+ FV + V  +LK+
Sbjct: 122 PAAEDTQFISSSFVKEIARLKGDISVFVSENVGQYLKD 159


>gi|320450413|ref|YP_004202509.1| pantetheine-phosphate adenylyltransferase [Thermus scotoductus
           SA-01]
 gi|320150582|gb|ADW21960.1| pantetheine-phosphate adenylyltransferase [Thermus scotoductus
           SA-01]
          Length = 161

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 93/157 (59%), Gaps = 6/157 (3%)

Query: 6   VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFL-SIQERSELIKQSIFHFI 64
           VY GSFDP+TNGH+D+I +A    + + +A+  N  K   +L + +ER  +++++  H +
Sbjct: 4   VYPGSFDPLTNGHLDVIQRASRLFDRVTVAVLENPNKRGQYLFTAEERLNIVREATAH-L 62

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+   R    +F GL V+  + + AQ IV+GLR ++D++YE++M  +NR L P + T+ +
Sbjct: 63  PNVEAR----TFSGLLVDFVRQVGAQAIVKGLRAVSDYEYELQMAHLNRQLLPGLETLFI 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            A     +V+ST+++ +     D++  VP      LK
Sbjct: 119 LAATRYSFVSSTMVKEIARYGGDVSKLVPPATLRALK 155


>gi|42518925|ref|NP_964855.1| phosphopantetheine adenylyltransferase [Lactobacillus johnsonii NCC
           533]
 gi|61212660|sp|Q74JV6|COAD_LACJO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|41583211|gb|AAS08821.1| phosphopantetheine adenylyltransferase [Lactobacillus johnsonii NCC
           533]
          Length = 166

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 97/161 (60%), Gaps = 7/161 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA++ GSFDPITNGH+++I  A    E L + I  N+ K K   + +ER EL ++ +F
Sbjct: 1   MIKAIFPGSFDPITNGHVEVIEGASHMFEKLYVVIMTNTSK-KYLFTEKERLELARK-VF 58

Query: 62  HFIPDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
               +++ +V VI+    L V +A ++ A  IVRGLR+  DF+YE  +  +N+ L P++ 
Sbjct: 59  ----ENNEKVEVIARPAELTVEVAHELGAGAIVRGLRNTADFNYERDIAGINKTLDPDLN 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ LF +    +++S++I+  +    D+++ VP PV   L+
Sbjct: 115 TVLLFTRPEDSFISSSMIKETVFFGGDVSTLVPKPVAAALE 155


>gi|320103334|ref|YP_004178925.1| phosphopantetheine adenylyltransferase [Isosphaera pallida ATCC
           43644]
 gi|319750616|gb|ADV62376.1| Phosphopantetheine adenylyltransferase [Isosphaera pallida ATCC
           43644]
          Length = 181

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 61/154 (39%), Positives = 91/154 (59%), Gaps = 8/154 (5%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           RKAV+TG+FDP+T GH+D+I +     + LV+ IG N  KT  F  ++ER  L +    H
Sbjct: 15  RKAVFTGTFDPMTLGHLDVIRRGRLLFDQLVVGIGVNPNKTPLF-DLEERVNLAR----H 69

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
            + +  N V+V  F+ LAV   + I AQVI+RG+R ++D +YE  M+  N+ L PEI T+
Sbjct: 70  IVREYHN-VTVEPFDELAVAFVRRIGAQVILRGVRTLSDMEYEFSMSLTNKRLAPEIETV 128

Query: 123 ALFAKESSRYVTSTLIRHLISIDA--DITSFVPD 154
            L A     +V+S+LI+ L        +  FVP+
Sbjct: 129 FLMADGEYSHVSSSLIKQLARYGGAEALARFVPE 162


>gi|189346704|ref|YP_001943233.1| phosphopantetheine adenylyltransferase [Chlorobium limicola DSM
           245]
 gi|229488128|sp|B3ECH9|COAD_CHLL2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189340851|gb|ACD90254.1| pantetheine-phosphate adenylyltransferase [Chlorobium limicola DSM
           245]
          Length = 170

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 95/153 (62%), Gaps = 7/153 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +KA+Y G+FDP TNGH+D++ +AL+  +++V+ I  NS K   F S++ER  +I++ I
Sbjct: 1   MTQKAIYPGTFDPFTNGHLDVLERALNIFQEVVVVIADNSQKQTLF-SVEERLSMIREII 59

Query: 61  FHFIPDSSNRVSV-ISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
                +    VSV +  +GL  + A+   A+ IVRG+R + DF+YE +++ +NR L PE+
Sbjct: 60  -----EDYPAVSVEVLHDGLLADYARQKGARAIVRGVRQVKDFEYEFQISLLNRHLYPEV 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFV 152
            T+ L       YV S++I+ +  +  D++ FV
Sbjct: 115 TTVFLMPNVKYTYVASSIIKEVAMLGGDVSKFV 147


>gi|262037513|ref|ZP_06010972.1| pantetheine-phosphate adenylyltransferase [Leptotrichia
           goodfellowii F0264]
 gi|261748443|gb|EEY35823.1| pantetheine-phosphate adenylyltransferase [Leptotrichia
           goodfellowii F0264]
          Length = 166

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 94/157 (59%), Gaps = 5/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M++ A+Y GSFDPIT+GH+DII ++ +  + L+I I  NS KTK + S +E+ E+IK+  
Sbjct: 1   MIKTALYPGSFDPITSGHVDIIKRSANLFDKLIIGIFKNSSKTKAWFSDEEKVEMIKE-- 58

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCP-EI 119
              + + +    V  F GL V+        +++RGLR ++D++YE++ T  N+ L   E 
Sbjct: 59  --VLKNENINAEVKIFNGLLVDFISKEKVDILIRGLRALSDYEYELQFTLTNKTLAKSEF 116

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
            TI L A     Y++S+L++ +     D+ +FVP+ V
Sbjct: 117 ETIFLSASRKYLYLSSSLVKEIAQNYGDLRTFVPENV 153


>gi|52426006|ref|YP_089143.1| phosphopantetheine adenylyltransferase [Mannheimia
           succiniciproducens MBEL55E]
 gi|61212537|sp|Q65R52|COAD_MANSM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|52308058|gb|AAU38558.1| CoaD protein [Mannheimia succiniciproducens MBEL55E]
          Length = 159

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 90/160 (56%), Gaps = 6/160 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  +Y G+FDPIT GH+DII ++      +++A+  N  K K    + ER  L ++S+
Sbjct: 1   MTKTVIYPGTFDPITYGHLDIIERSAVLFPQVLVAVASNPTK-KPLFELAERVRLAEESV 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H +P+    V VI F  L  N+ K+     I+RG+R   DF+YE+++  +NR L   + 
Sbjct: 60  AH-LPN----VQVIGFSDLLANVVKERHITAIIRGMRTTMDFEYELQLAHLNRALTDGVE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           ++ L + E   YV+ST++R +     D++ FVP PV   L
Sbjct: 115 SLFLPSTEKWSYVSSTIVREIYLHRGDVSQFVPPPVLTAL 154


>gi|83943214|ref|ZP_00955674.1| pantetheine-phosphate adenylyltransferase [Sulfitobacter sp. EE-36]
 gi|83846222|gb|EAP84099.1| pantetheine-phosphate adenylyltransferase [Sulfitobacter sp. EE-36]
          Length = 164

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 88/151 (58%), Gaps = 1/151 (0%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDPIT GH+DII +A + V+ LVI +  N  K   F  ++ER   I++   
Sbjct: 1   MRVGLYPGTFDPITLGHIDIIRRAATLVDKLVIGVAINRDKGPLF-ELEERVAQIEEECR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               ++   + V  FE L ++ A D+ AQ+I+RGLR + DF+YE +M  +NR L   + T
Sbjct: 60  KLNQETGTEIVVHPFENLLIDCAHDVGAQMIIRGLRAVADFEYEYQMVGMNRKLDDSVET 119

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L A+   + + S L++ +  +  D++ FV
Sbjct: 120 VFLMAEAEHQAIASRLVKEIARLGGDVSKFV 150


>gi|319939642|ref|ZP_08014001.1| phosphopantetheine adenylyltransferase [Streptococcus anginosus
           1_2_62CV]
 gi|319811231|gb|EFW07537.1| phosphopantetheine adenylyltransferase [Streptococcus anginosus
           1_2_62CV]
          Length = 165

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 91/158 (57%), Gaps = 5/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++ GSFDPIT GH+D+I +A    + L + I  N ++ K F SI+ + ++I  ++ H  
Sbjct: 6   GLFAGSFDPITKGHIDLIKRASKLFDCLYVGIFYN-LEKKSFFSIEAKEKMIAAALVHL- 63

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
               N   V S + LAV +A+ +     VRGLR+  D DYE  +   N  L PEI TI L
Sbjct: 64  ---ENVKIVTSHDELAVEVARKLGVTTFVRGLRNSQDLDYEGNLNFFNHELAPEIETIFL 120

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            +K + ++++S+ IR LIS + DI+ +VP+ V   LK 
Sbjct: 121 ISKPAYQHLSSSRIRELISFEQDISKYVPESVIKELKK 158


>gi|329667530|gb|AEB93478.1| phosphopantetheine adenylyltransferase [Lactobacillus johnsonii DPC
           6026]
          Length = 166

 Score =  107 bits (267), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 97/161 (60%), Gaps = 7/161 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA++ GSFDPITNGH+++I  A    E L + I  N+ K K   + +ER EL ++ +F
Sbjct: 1   MIKAIFPGSFDPITNGHVEVIEGASHMFEKLYVVIMTNTSK-KYLFNEKERLELARK-VF 58

Query: 62  HFIPDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
               +++ +V VI+    L V +A ++ A  IVRGLR+  DF+YE  +  +N+ L P++ 
Sbjct: 59  ----ENNEKVEVIARPAELTVEVAHELGAGAIVRGLRNTADFNYERDIAGINKTLDPDLN 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ LF +    +++S++I+  +    D+++ VP PV   L+
Sbjct: 115 TVLLFTRPEDSFISSSMIKETVFFGGDVSTLVPKPVAAALE 155


>gi|218708258|ref|YP_002415879.1| phosphopantetheine adenylyltransferase [Vibrio splendidus LGP32]
 gi|254764187|sp|B7VHL5|COAD_VIBSL RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|218321277|emb|CAV17227.1| Phosphopantetheine adenylyltransferase [Vibrio splendidus LGP32]
          Length = 162

 Score =  107 bits (267), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 63/168 (37%), Positives = 99/168 (58%), Gaps = 10/168 (5%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y G+FDP+TNGH D+I +A    E LVI +  +  K   F S+ ER  L++++ +
Sbjct: 1   MKIAIYPGTFDPVTNGHYDLIKRAACMFEKLVIGVAESPSKATLF-SLDERVALLRETCY 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +P+    VSV  F GL V+ A + +A ++VRGLR   DF+YE  +T++ R L PE+ +
Sbjct: 60  E-LPN----VSVEGFSGLLVDFATEQNASILVRGLRTTMDFEYEFGLTTMYRRLKPELES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
           + L   E   +++STL+R +     +I  FVP   CV     V++ VK
Sbjct: 115 LFLTPSEEFAFLSSTLVREVAIHGGEIEQFVPG--CV--HQAVVAKVK 158


>gi|189464619|ref|ZP_03013404.1| hypothetical protein BACINT_00962 [Bacteroides intestinalis DSM
           17393]
 gi|189436893|gb|EDV05878.1| hypothetical protein BACINT_00962 [Bacteroides intestinalis DSM
           17393]
          Length = 150

 Score =  107 bits (267), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 94/153 (61%), Gaps = 7/153 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+A++ G+FDP T GH  I+ +AL+F+++++I IG N  K   +  I++R  +I Q+ +
Sbjct: 1   MRRAIFPGTFDPFTIGHFSIVTRALTFMDEVIIGIGINENKNT-YFPIEKRVAMI-QNFY 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
              P    R+ V S++ L ++ A+ + AQ I+RG+R + DF+YE  +  +NR L   I T
Sbjct: 59  RNDP----RIKVYSYDCLTIDFAQQVDAQFIIRGIRTVKDFEYEETIADINRKLAG-IET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           I LF +     ++ST +R L+    DI+ F+P+
Sbjct: 114 ILLFTEPELTCISSTTVRELLQFGKDISQFIPE 146


>gi|58585058|ref|YP_198631.1| phosphopantetheine adenylyltransferase [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
 gi|75497583|sp|Q5GRI5|COAD_WOLTR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|58419374|gb|AAW71389.1| Phosphopantetheine adenylyltransferase [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 167

 Score =  107 bits (267), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 90/150 (60%), Gaps = 5/150 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R  +Y G+FDPIT GH+DII +A   V+ L+I +  N  K   F   + R+ + +  I  
Sbjct: 6   RIGIYPGTFDPITFGHIDIIKRACKLVDRLIIGVAENINKHTTF-DAKLRTSMAENEIKR 64

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
              D    V V+SF GL V  AK+ +A VI+RGLR ++DFDYE +M+ VN  L PEI TI
Sbjct: 65  LEID----VDVVSFNGLLVKFAKEQNASVIIRGLRAVSDFDYEFQMSWVNYKLLPEIETI 120

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFV 152
            L A E +++++S+ ++ +  +   ++ FV
Sbjct: 121 FLPASEDTQFISSSFVKEIARLGESVSKFV 150


>gi|157413343|ref|YP_001484209.1| phosphopantetheine adenylyltransferase [Prochlorococcus marinus
           str. MIT 9215]
 gi|167009046|sp|A8G4U2|COAD_PROM2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|157387918|gb|ABV50623.1| putative pantetheine-phosphate adenylyltransferase [Prochlorococcus
           marinus str. MIT 9215]
          Length = 157

 Score =  107 bits (267), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 97/158 (61%), Gaps = 6/158 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K +Y G+FDP+TNGH+D+I +A     +LV+A+  N+ KT  F ++Q R   IK S+ H 
Sbjct: 2   KILYPGTFDPLTNGHIDLIERAEKIFGNLVVAVLENTSKTPTF-NLQRRIIQIKNSLSH- 59

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           +P+    + VIS+ GL V+ A ++ A +I+RGLR M+DF+YE+++   N+ L  +I TI 
Sbjct: 60  LPN----IEVISYSGLTVDCANELKANLILRGLRAMSDFEYELQIAHTNKSLNNDIETIF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           L    +  +++S+L++ +     +I   VP  V   LK
Sbjct: 116 LSTNTNYSFLSSSLVKEVAKFGGEINHMVPPSVERDLK 153


>gi|116750414|ref|YP_847101.1| pantetheine-phosphate adenylyltransferase [Syntrophobacter
           fumaroxidans MPOB]
 gi|116750456|ref|YP_847143.1| pantetheine-phosphate adenylyltransferase [Syntrophobacter
           fumaroxidans MPOB]
 gi|116699478|gb|ABK18666.1| pantetheine-phosphate adenylyltransferase [Syntrophobacter
           fumaroxidans MPOB]
 gi|116699520|gb|ABK18708.1| pantetheine-phosphate adenylyltransferase [Syntrophobacter
           fumaroxidans MPOB]
          Length = 168

 Score =  107 bits (267), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 62/156 (39%), Positives = 88/156 (56%), Gaps = 3/156 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + AVY GSFDPITNGH+D+I + L   + +VIA+  N  K K   + +ER E+I  SI
Sbjct: 1   MKKVAVYPGSFDPITNGHLDLIERGLKIFDSIVIAVAANPGK-KPLFTFEERLEMINASI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 S  R+ V SF GL V+    I A  I+RGLR ++DF+YE +M  +NR L  EI 
Sbjct: 60  EGHPMQS--RIQVGSFNGLLVDYVSSIKANTILRGLRAISDFEYEFQMALMNRKLSTEIE 117

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           T+ L       Y++S +I+ ++     +T  V   V
Sbjct: 118 TLYLMTGMRWIYISSRIIKEVVMSGGCVTGLVSPAV 153


>gi|107023740|ref|YP_622067.1| phosphopantetheine adenylyltransferase [Burkholderia cenocepacia AU
           1054]
 gi|116690827|ref|YP_836450.1| phosphopantetheine adenylyltransferase [Burkholderia cenocepacia
           HI2424]
 gi|170734152|ref|YP_001766099.1| phosphopantetheine adenylyltransferase [Burkholderia cenocepacia
           MC0-3]
 gi|206559192|ref|YP_002229952.1| phosphopantetheine adenylyltransferase [Burkholderia cenocepacia
           J2315]
 gi|254247172|ref|ZP_04940493.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related
           [Burkholderia cenocepacia PC184]
 gi|123244640|sp|Q1BTG1|COAD_BURCA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216063|sp|A0KAN0|COAD_BURCH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488123|sp|B1JYQ4|COAD_BURCC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|229488124|sp|B4EAQ8|COAD_BURCJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|105893929|gb|ABF77094.1| Coenzyme A biosynthesis protein [Burkholderia cenocepacia AU 1054]
 gi|116648916|gb|ABK09557.1| pantetheine-phosphate adenylyltransferase [Burkholderia cenocepacia
           HI2424]
 gi|124871948|gb|EAY63664.1| Coenzyme A biosynthesis protein:Cytidyltransferase-related
           [Burkholderia cenocepacia PC184]
 gi|169817394|gb|ACA91977.1| pantetheine-phosphate adenylyltransferase [Burkholderia cenocepacia
           MC0-3]
 gi|198035229|emb|CAR51103.1| phosphopantetheine adenylyltransferase [Burkholderia cenocepacia
           J2315]
          Length = 165

 Score =  107 bits (267), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 55/163 (33%), Positives = 99/163 (60%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A S  + LV+ +  +S   K F S++ER  +  + + H+ 
Sbjct: 4   AVYPGTFDPLTRGHEDLVRRASSIFDTLVVGV-ADSRAKKPFFSLEERLTIANEVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+SF GL  +  +  +A+VIVRGLR ++DF+YE +M  +NR L P++ T+ +
Sbjct: 62  PN----VKVMSFTGLLKDFVRVNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              +  ++++ T++R +  +  D++ FV   V  +L   V ++
Sbjct: 118 TPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVTAM 160


>gi|168334444|ref|ZP_02692619.1| pantetheine-phosphate adenylyltransferase [Epulopiscium sp. 'N.t.
           morphotype B']
          Length = 156

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 91/160 (56%), Gaps = 5/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y GSFDP+T GH+DII +A      L++AIG N  K  G   ++ R  ++K +  
Sbjct: 1   MNTAIYPGSFDPVTIGHIDIIARASQHFTSLIVAIGYNPNKATGLFDLKTRIAMLKLATK 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F     + V+V +++GL ++  +  +  VIV+G+R+  DF+YE  M  +N  L   I T
Sbjct: 61  KF-----DNVTVATYDGLLIDFMQSANVNVIVKGVRNSKDFEYEKDMALINNSLDITIET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
             LFA     +++S+++R L+  + ++ ++VP  +   LK
Sbjct: 116 FLLFANPMYSFISSSMVRELLYFNKEVDNYVPKEIIYILK 155


>gi|170719529|ref|YP_001747217.1| phosphopantetheine adenylyltransferase [Pseudomonas putida W619]
 gi|229500857|sp|B1J2E9|COAD_PSEPW RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|169757532|gb|ACA70848.1| pantetheine-phosphate adenylyltransferase [Pseudomonas putida W619]
          Length = 159

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 90/151 (59%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+   S K      +++R  L ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVIIAVAA-SPKKNPLFPLEQRVALAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V VI F  L  + AK+  A V +RGLR ++DF+YE ++ ++NR L PE+ +
Sbjct: 60  H-LPN----VEVIGFSTLLAHFAKEQGANVFLRGLRAVSDFEYEFQLANMNRQLAPEVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++  DIT FV
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFV 145


>gi|58220679|gb|AAW67944.1| putative phosphopantetheine adenylyltransferase [Desulfovibrio
           gigas]
          Length = 176

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 94/160 (58%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y G+FDP+T GH+ ++ +AL   + +++A    + KT  F S++ER E++++ +FH
Sbjct: 14  RVAIYPGTFDPLTFGHVSLVKRALDVFDHILVAPAAATPKTPMF-SLEERVEIVRE-VFH 71

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
             P    RV V  F+GL V  A+   A  I+RGLR ++DF+YE +M  +NR L   I T+
Sbjct: 72  DNP----RVEVAGFQGLLVEFARRRGACAILRGLRAVSDFEYEFQMALMNRRLEKHIQTV 127

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L       +++ST+++      AD+ S +PDP    L+ 
Sbjct: 128 FLMTDYRWLFISSTIVKEAAKAGADVRSMIPDPAWFRLQE 167


>gi|126696313|ref|YP_001091199.1| phosphopantetheine adenylyltransferase [Prochlorococcus marinus
           str. MIT 9301]
 gi|166216570|sp|A3PCX3|COAD_PROM0 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|126543356|gb|ABO17598.1| putative pantetheine-phosphate adenylyltransferase [Prochlorococcus
           marinus str. MIT 9301]
          Length = 157

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 97/159 (61%), Gaps = 6/159 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K +Y G+FDP+TNGH+D+I +A      LV+A+  N+ KT  F +++ R   IK S+ H 
Sbjct: 2   KILYPGTFDPLTNGHLDLIERAEKIFGKLVVAVLENTSKTPTF-NLERRIIQIKNSLSH- 59

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           +P+    + VIS+ GL V+ A D+ A +I+RGLR M+DF+YE+++   N+ L  +I TI 
Sbjct: 60  LPN----IEVISYSGLTVDCANDLKANLILRGLRAMSDFEYELQIAHTNKSLNNDIETIF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           L    +  +++S+L++ +     +I   VP  V   LK+
Sbjct: 116 LSTNTNYSFLSSSLVKEVAKFGGEINHMVPPSVEKDLKD 154


>gi|226942511|ref|YP_002797584.1| phosphopantetheine adenylyltransferase [Azotobacter vinelandii DJ]
 gi|259491300|sp|C1DIB2|COAD_AZOVD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|226717438|gb|ACO76609.1| phosphopantetheine adenylyltransferase [Azotobacter vinelandii DJ]
          Length = 159

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 92/160 (57%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+   S K     S+ +R EL ++   
Sbjct: 1   MNRVIYPGTFDPITKGHGDLVERAAKLFDHVIIAVAA-SPKKNPLFSLDKRVELAREVTR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V+ F  L    A++  A  ++RGLR ++DF+YE ++ ++NR L PE+ +
Sbjct: 60  H-LPN----VEVLGFSSLLAQFAREQKANALLRGLRAVSDFEYEFQLANMNRQLAPEVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           + L   E   Y++STL+R + ++  +I  FV   V   L+
Sbjct: 115 LFLTPSEKYSYISSTLVREIAALGGNIEQFVHPAVADALR 154


>gi|134096060|ref|YP_001101135.1| phosphopantetheine adenylyltransferase [Herminiimonas
           arsenicoxydans]
 gi|166216552|sp|A4G927|COAD_HERAR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|133739963|emb|CAL63014.1| Phosphopantetheine adenylyltransferase (Pantetheine-phosphate
           adenylyltransferase) (PPAT) (Dephospho-CoA
           pyrophosphorylase) [Herminiimonas arsenicoxydans]
          Length = 163

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 98/165 (59%), Gaps = 6/165 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y G+FDP+T GH D++ +A    + L++ +  +S   K F S++ER  +  + + 
Sbjct: 1   MVTAIYPGTFDPLTRGHEDLVRRASGLFDKLIVGV-ADSKNKKPFFSLEERLTISNEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+ P+    V V SF GL  +  +   A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HY-PN----VHVESFSGLLKDFVRRHDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           + L   +  ++++ T++R + ++  D++ FV   V  +LK  + +
Sbjct: 115 LFLTPSDQYQFISGTIVREIAALGGDVSKFVFPSVDKWLKEKIAA 159


>gi|313113536|ref|ZP_07799125.1| pantetheine-phosphate adenylyltransferase [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310624263|gb|EFQ07629.1| pantetheine-phosphate adenylyltransferase [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 185

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 87/151 (57%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDP+T GH+DII +A    + L++A+  NS K   F +++ER EL+K+   
Sbjct: 18  MATAVYPGSFDPVTKGHLDIIKRAAKINDHLIVAVLNNSAKNPLF-TVEERVELLKECC- 75

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                    VSV SF+GL V  AK   A V+VRGLR +TDF+ E+++   N  L P I T
Sbjct: 76  ----KGIQNVSVESFDGLTVEFAKKRHASVMVRGLRAVTDFENEIQLAQTNHALMPGIET 131

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L       Y++ST+++      +DI  FV
Sbjct: 132 MFLATSIKWSYLSSTIVKEAAYYGSDIGKFV 162


>gi|261408046|ref|YP_003244287.1| pantetheine-phosphate adenylyltransferase [Paenibacillus sp.
           Y412MC10]
 gi|329929995|ref|ZP_08283634.1| pantetheine-phosphate adenylyltransferase [Paenibacillus sp. HGF5]
 gi|261284509|gb|ACX66480.1| pantetheine-phosphate adenylyltransferase [Paenibacillus sp.
           Y412MC10]
 gi|328935517|gb|EGG31987.1| pantetheine-phosphate adenylyltransferase [Paenibacillus sp. HGF5]
          Length = 171

 Score =  107 bits (266), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 93/159 (58%), Gaps = 6/159 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R AVY GSFDP+T GHMDII +A    + L++A+  N++      ++ ER +L++Q+  H
Sbjct: 10  RVAVYPGSFDPVTMGHMDIITRASKQFDLLIVAV-LNNLSKNPLFTVDERKDLLRQATAH 68

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
            +P+    V + SF  L  N  +  +AQVIVRG+R +TDF+YE+++ S N  L P+  TI
Sbjct: 69  -LPN----VEIDSFRDLLANYIRQKNAQVIVRGIRTVTDFEYELQLASTNHKLNPDAETI 123

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            +       +++S+L++ +   + D T  V   V   L+
Sbjct: 124 FMMTHPKYSFLSSSLVKEIAHFNGDTTDLVSPEVDAALR 162


>gi|187927352|ref|YP_001897839.1| phosphopantetheine adenylyltransferase [Ralstonia pickettii 12J]
 gi|241661891|ref|YP_002980251.1| phosphopantetheine adenylyltransferase [Ralstonia pickettii 12D]
 gi|309779947|ref|ZP_07674701.1| pantetheine-phosphate adenylyltransferase [Ralstonia sp. 5_7_47FAA]
 gi|229500858|sp|B2UER1|COAD_RALPJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|187724242|gb|ACD25407.1| pantetheine-phosphate adenylyltransferase [Ralstonia pickettii 12J]
 gi|240863918|gb|ACS61579.1| pantetheine-phosphate adenylyltransferase [Ralstonia pickettii 12D]
 gi|308921306|gb|EFP66949.1| pantetheine-phosphate adenylyltransferase [Ralstonia sp. 5_7_47FAA]
          Length = 167

 Score =  107 bits (266), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 94/158 (59%), Gaps = 6/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP T GH D++ +A +  ++L++ +   S   + F +++ER E+ ++ + H+ 
Sbjct: 4   AVYPGTFDPFTRGHEDLVRRASNIFDELIVGV-AQSPNKRPFFALEERIEIAREVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V  F GL  +  +   A+VIVRGLR ++DF+YE +M  +NR L P++ T+ L
Sbjct: 62  PN----VRVEGFSGLLKDFVRKNGARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFL 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
              +  ++++ T +R +  +  D++ FV   V  +LK 
Sbjct: 118 TPSDQYQFISGTFVREIAVLGGDVSKFVFPSVEKWLKE 155


>gi|150390528|ref|YP_001320577.1| pantetheine-phosphate adenylyltransferase [Alkaliphilus
           metalliredigens QYMF]
 gi|167009038|sp|A6TRV0|COAD_ALKMQ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|149950390|gb|ABR48918.1| pantetheine-phosphate adenylyltransferase [Alkaliphilus
           metalliredigens QYMF]
          Length = 157

 Score =  107 bits (266), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 96/153 (62%), Gaps = 6/153 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+  +Y GSFDPITNGH+DII +A    + +++++  N  K   F ++ ER  LI+Q I 
Sbjct: 1   MKVGIYPGSFDPITNGHIDIIKRASEIYDRVIVSVMQNPNKNPMF-TLGERVALIEQIIQ 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +     + + V  F GL ++ A++  A+VI++GLR ++DF+YE++M  +NR LCPE+ T
Sbjct: 60  PY-----SNIEVDCFSGLLIDYAREKGAKVIIKGLRAVSDFEYELQMALMNRKLCPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           + L       Y++S+L++ +     D++ FVP+
Sbjct: 115 VFLMTNSQYSYLSSSLVKEVAKFKGDVSEFVPE 147


>gi|315651229|ref|ZP_07904259.1| pantetheine-phosphate adenylyltransferase [Eubacterium saburreum
           DSM 3986]
 gi|315486525|gb|EFU76877.1| pantetheine-phosphate adenylyltransferase [Eubacterium saburreum
           DSM 3986]
          Length = 167

 Score =  107 bits (266), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 93/151 (61%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA+Y GSFDPITNGH+DII ++    + +++ +  NS K   F +  ER ++IK  I 
Sbjct: 1   MAKAIYPGSFDPITNGHIDIIERSAKMFDKVIVGVLINSAKDPLF-APAERVDMIKGVIG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V+ F+GL V+ A +    ++VRGLR +TDF+YE+++   N+ + P++ T
Sbjct: 60  H-LPN----VEVLEFDGLLVDFAHEQKCNILVRGLRVITDFEYELQLAQTNKIIAPDLET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L       Y++S++++ +     DI+ FV
Sbjct: 115 VFLSTNLKYSYLSSSIVKEIAVYGGDISHFV 145


>gi|270292103|ref|ZP_06198318.1| pantetheine-phosphate adenylyltransferase [Streptococcus sp. M143]
 gi|270279631|gb|EFA25473.1| pantetheine-phosphate adenylyltransferase [Streptococcus sp. M143]
          Length = 162

 Score =  107 bits (266), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 55/159 (34%), Positives = 93/159 (58%), Gaps = 7/159 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+TNGH+DII +A    + L + +  N  K +GFL ++ R   +++++ H  
Sbjct: 6   GLFTGSFDPMTNGHLDIIERASKLFDKLYVGVFYNPHK-QGFLPVENRKRAVEKAVAHL- 63

Query: 65  PDSSNRVSVI-SFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
               + V VI S + L V++A+ + A+ +VRGLR+ TD  YE      N  L PEI T+ 
Sbjct: 64  ----DNVEVIASHDQLVVDVARRLGAKTLVRGLRNATDLQYEASFDYYNYQLAPEIGTVY 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           L ++    Y++S+ +R L+    +I  +VP+ V   L++
Sbjct: 120 LHSRPEHLYISSSAVRELLKFCQEIQQYVPNSVVEELEH 158


>gi|87124467|ref|ZP_01080316.1| putative pantetheine-phosphate adenylyltransferase [Synechococcus
           sp. RS9917]
 gi|86168039|gb|EAQ69297.1| putative pantetheine-phosphate adenylyltransferase [Synechococcus
           sp. RS9917]
          Length = 204

 Score =  107 bits (266), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 91/151 (60%), Gaps = 6/151 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           +A+Y GSFDP+T GH+D+I +      ++V+A+  N  KT  F S+++R   I+ S  H 
Sbjct: 41  RALYPGSFDPLTLGHLDLIERGCRLFGEVVVAVLQNPGKTPAF-SLEQRLAQIEASTAHL 99

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V V SF+GL V  A++I A +I+RGLR M+DF+YE+++   NR L PEI T+ 
Sbjct: 100 -----SGVRVTSFDGLTVRCAEEIGADLILRGLRAMSDFEYELQIAHTNRSLQPEIETVF 154

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           L       +++S++++ +      ++  VP+
Sbjct: 155 LATSAHHSFLSSSVVKEVARFGGRVSHMVPE 185


>gi|327543413|gb|EGF29837.1| phosphopantetheine adenylyltransferase [Rhodopirellula baltica
           WH47]
          Length = 179

 Score =  107 bits (266), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 97/160 (60%), Gaps = 9/160 (5%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVYTGSFDP+T GH+ II +A    + LV+ IG N+ K K   + +ER EL+ Q+I + +
Sbjct: 18  AVYTGSFDPVTLGHLHIIERASKLFDTLVVGIGINADK-KSLFNPEERIELV-QTISNHL 75

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V +F+GLAV+  + + A V+VRG+R +TD   E  M   NR L  +I T+ L
Sbjct: 76  PN----VRVQTFDGLAVDFVRSLGAGVMVRGIRPLTDIAGEFTMMMANRQLDADIETVFL 131

Query: 125 FAKESSRYVTSTLIRHLISI---DADITSFVPDPVCVFLK 161
            A E   +V+S+L++ + ++   D  +  FVP P+   L+
Sbjct: 132 MADERFAHVSSSLLKQIAALSENDDHLAKFVPRPIIPSLR 171


>gi|91214526|ref|ZP_01251499.1| phosphopantetheine adenylyltransferase [Psychroflexus torquis ATCC
           700755]
 gi|91186953|gb|EAS73323.1| phosphopantetheine adenylyltransferase [Psychroflexus torquis ATCC
           700755]
          Length = 152

 Score =  107 bits (266), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 58/157 (36%), Positives = 97/157 (61%), Gaps = 7/157 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++AV+ GSFDPIT GH DII + L+  +++++A+G N+ K K   +++ER   I+++  
Sbjct: 1   MKRAVFPGSFDPITIGHYDIITRGLTLFDEIILAVGVNAEK-KYMFTLEERRTFIEETF- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                   R+ V +++GL VN  K+I+A  I+RGLR+  DF++E  +   NR L  +I T
Sbjct: 59  ----KDEPRIKVDTYKGLTVNYCKEINADFILRGLRNPADFEFEKAIAHTNRKL-EKIET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCV 158
           I L       +++S+++R +I  + D + FVPD V V
Sbjct: 114 IFLLTSSGKSFISSSIVRDIIRNNGDYSGFVPDSVIV 150


>gi|314933321|ref|ZP_07840686.1| pantetheine-phosphate adenylyltransferase [Staphylococcus caprae
           C87]
 gi|313653471|gb|EFS17228.1| pantetheine-phosphate adenylyltransferase [Staphylococcus caprae
           C87]
          Length = 161

 Score =  107 bits (266), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 98/159 (61%), Gaps = 6/159 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           +AV  GSFDPIT GH+DII ++    +++ + +  NS K  G   ++ER +LI+ S+ H 
Sbjct: 5   RAVIPGSFDPITYGHLDIIERSADRFDEIHVCVLKNSSKG-GTFDLEERMDLIRDSVQHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V V  F GL V+    + A+ I+RGLR ++DF+YE+R+TS+N+ L   I T+ 
Sbjct: 64  -----SNVEVHHFNGLLVDFCDQVGARTIIRGLRAVSDFEYELRLTSMNKKLNNNIETMY 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           +    +  +++S++++ + +  ADI++FVP  V   LK+
Sbjct: 119 MMTSTNYSFISSSIVKEVAAYKADISAFVPPNVEKALKD 157


>gi|189500058|ref|YP_001959528.1| phosphopantetheine adenylyltransferase [Chlorobium phaeobacteroides
           BS1]
 gi|229488130|sp|B3EQL4|COAD_CHLPB RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|189495499|gb|ACE04047.1| pantetheine-phosphate adenylyltransferase [Chlorobium
           phaeobacteroides BS1]
          Length = 165

 Score =  107 bits (266), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 60/163 (36%), Positives = 94/163 (57%), Gaps = 7/163 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y G+FDP TNGH+D++ +AL+  + + I +  NS K+  F ++ ER  +I++  
Sbjct: 1   MERLAIYPGTFDPFTNGHLDVLERALTIFDKVYIVLAENSKKSSLF-TVDERCSMIRE-- 57

Query: 61  FHFIPDSSNRVSV-ISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
              I  S++ VSV +   GL    A  + A  IVRGLR + DF+YE +++ +NR L PE+
Sbjct: 58  ---ITASTSGVSVEVLHGGLLAEYAHSVGATAIVRGLRQVKDFEYEFQLSLLNRHLNPEV 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            T+ L       YV S++IR +  +  D++ FV   V   LK 
Sbjct: 115 TTVFLMPNVKYTYVASSIIREVALLGGDVSKFVHPCVLAMLKK 157


>gi|293374735|ref|ZP_06621043.1| pantetheine-phosphate adenylyltransferase [Turicibacter sanguinis
           PC909]
 gi|292646649|gb|EFF64651.1| pantetheine-phosphate adenylyltransferase [Turicibacter sanguinis
           PC909]
          Length = 161

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 95/162 (58%), Gaps = 7/162 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  +Y G+FDP+TNGH+DII +     + L IA+  N +  K   +++ER +++K++ 
Sbjct: 1   MKKIGIYPGTFDPVTNGHLDIIGRGYELFDYLYIAVAEN-INKKTLFTVEERVDMLKKAT 59

Query: 61  FHFIPDSSNRVSVI-SFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
            H       RV V+   + L V+ A  + A+ I+RGLR +TDF+YE ++ + N+ L P I
Sbjct: 60  KHL-----ERVEVVVCADALVVDFANQLGAKTILRGLRAVTDFEYEFQIATTNKRLQPNI 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            T+ L  +  + +++S+  + +     D++SFVP+ V   LK
Sbjct: 115 ETVFLMTRAENMFLSSSTTKEVARFGGDVSSFVPEFVQEALK 156


>gi|255012020|ref|ZP_05284146.1| phosphopantetheine adenylyltransferase [Bacteroides fragilis
           3_1_12]
 gi|313149857|ref|ZP_07812050.1| phosphopantetheine adenylyltransferase [Bacteroides fragilis
           3_1_12]
 gi|313138624|gb|EFR55984.1| phosphopantetheine adenylyltransferase [Bacteroides fragilis
           3_1_12]
          Length = 150

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 95/152 (62%), Gaps = 7/152 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+A++ G+FDP T GH  ++ + L+F++++VI IG N  K   +  I++R E+I++   
Sbjct: 1   MRRAIFPGTFDPFTIGHYSVVQRTLTFMDEVVIGIGINENKNT-YFPIEKRVEMIRK--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            F  D   R+ V S++ L ++ A+ + A+ IVRG+R + DF+YE  +  +NR L   I T
Sbjct: 57  -FYKDEP-RIRVESYDCLTIDFARQVDARFIVRGIRTVKDFEYEETIADINRKLAG-IET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           I LF +     V+ST++R L+  + DI+ F+P
Sbjct: 114 ILLFTEPELTCVSSTIVRELLGYNKDISMFIP 145


>gi|26991799|ref|NP_747224.1| phosphopantetheine adenylyltransferase [Pseudomonas putida KT2440]
 gi|31563014|sp|Q88CQ7|COAD_PSEPK RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|24986911|gb|AAN70688.1|AE016712_6 pantetheine-phosphate adenylyltransferase [Pseudomonas putida
           KT2440]
 gi|313501099|gb|ADR62465.1| CoaD [Pseudomonas putida BIRD-1]
          Length = 161

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 91/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+   S K      +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVIIAVAA-SPKKNPLFPLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V VI F  L  + AK+  A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  H-LPN----VEVIGFSSLLAHFAKEQGANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++  DI+ FV
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDISKFV 145


>gi|325837596|ref|ZP_08166443.1| pantetheine-phosphate adenylyltransferase [Turicibacter sp. HGF1]
 gi|325490898|gb|EGC93197.1| pantetheine-phosphate adenylyltransferase [Turicibacter sp. HGF1]
          Length = 161

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 95/162 (58%), Gaps = 7/162 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +  +Y G+FDP+TNGH+DII +     + L IA+  N +  K   +++ER +++K++ 
Sbjct: 1   MKKIGIYPGTFDPVTNGHLDIIGRGYELFDYLYIAVAEN-INKKTLFTVEERVDMLKKAT 59

Query: 61  FHFIPDSSNRVSVI-SFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEI 119
            H       RV V+   + L V+ A  + A+ I+RGLR +TDF+YE ++ + N+ L P I
Sbjct: 60  KHL-----ERVEVVVCADALVVDFANQLGAKTILRGLRAVTDFEYEFQIATTNKRLQPSI 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            T+ L  +  + +++S+  + +     D++SFVP+ V   LK
Sbjct: 115 ETVFLMTRAENMFLSSSTTKEVARFGGDVSSFVPEFVQEALK 156


>gi|104779571|ref|YP_606069.1| phosphopantetheine adenylyltransferase [Pseudomonas entomophila
           L48]
 gi|166216575|sp|Q1IGF0|COAD_PSEE4 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|95108558|emb|CAK13252.1| phosphopantetheine adenylyltransferase [Pseudomonas entomophila
           L48]
          Length = 159

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 91/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+   S K      +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVIIAVAA-SPKKNPLFPLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V VI F  L  + AK+  A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  H-LPN----VEVIGFSSLLAHFAKEQGANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++  DI+ FV
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDISKFV 145


>gi|145633858|ref|ZP_01789580.1| phosphopantetheine adenylyltransferase [Haemophilus influenzae
           3655]
 gi|145639405|ref|ZP_01795010.1| phosphopantetheine adenylyltransferase [Haemophilus influenzae
           PittII]
 gi|144985300|gb|EDJ92139.1| phosphopantetheine adenylyltransferase [Haemophilus influenzae
           3655]
 gi|145271452|gb|EDK11364.1| phosphopantetheine adenylyltransferase [Haemophilus influenzae
           PittII]
          Length = 156

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 90/160 (56%), Gaps = 6/160 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M   +Y G+FDPITNGH+DII ++      +++A+  NS   K   S++ER EL++QS+ 
Sbjct: 1   MTSVIYPGTFDPITNGHLDIIERSAVIFPRVLVAV-ANSPSKKPLFSLEERVELVRQSVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + V V  F  L  N+ K  +   I+RG+R  TDF+YE+++ ++NR L   + +
Sbjct: 60  HL-----SNVEVFGFSDLLANVIKQHNISAIIRGVRTTTDFEYELQLAALNRLLTKGVDS 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +     E   +V+ST++R +     D+   VP PV   LK
Sbjct: 115 LFFPPVEKWAFVSSTIVREIYLHGGDVAELVPVPVFNALK 154


>gi|148550199|ref|YP_001270301.1| phosphopantetheine adenylyltransferase [Pseudomonas putida F1]
 gi|166216577|sp|A5WAF7|COAD_PSEP1 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|148514257|gb|ABQ81117.1| Phosphopantetheine adenylyltransferase [Pseudomonas putida F1]
          Length = 159

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 91/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+   S K      +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVIIAVAA-SPKKNPLFPLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V VI F  L  + AK+  A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  H-LPN----VEVIGFSSLLAHFAKEQGANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++  DI+ FV
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDISKFV 145


>gi|152980565|ref|YP_001354825.1| phosphopantetheine adenylyltransferase [Janthinobacterium sp.
           Marseille]
 gi|166216553|sp|A6T2S8|COAD_JANMA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|151280642|gb|ABR89052.1| pantetheine-phosphate adenylyltransferase [Janthinobacterium sp.
           Marseille]
          Length = 161

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/161 (33%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+Y G+FDP+T GH D++ +A    + L++ +  +S   K F S++ER  +  + + 
Sbjct: 1   MVTAIYPGTFDPLTRGHEDLVRRASGLFDKLIVGV-ADSRNKKPFFSLEERLTISNEVLG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H+ P+    V V SF GL  +  +   A+VIVRGLR ++DF+YE +M  +NR L P++ T
Sbjct: 60  HY-PN----VHVESFSGLLKDFVRRHDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L   +  ++++ T++R + ++  D++ FV   V  +LK 
Sbjct: 115 LFLTPSDQYQFISGTIVREIATLGGDVSKFVFPSVDKWLKE 155


>gi|223042137|ref|ZP_03612308.1| phosphopantetheine adenylyltransferase [Actinobacillus minor 202]
 gi|223017076|gb|EEF15517.1| phosphopantetheine adenylyltransferase [Actinobacillus minor 202]
          Length = 163

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 89/160 (55%), Gaps = 9/160 (5%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M RK +Y G+FDPIT GH+DII +A S  + +++A+  N  K   F S++ER+ L+ +S 
Sbjct: 1   MNRKVIYAGTFDPITKGHLDIIQRAASLFDQVIVAVAKNPSKQPLF-SLEERTSLVSESC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPE-I 119
            H      + V    F GL  + A +  AQ ++RG+R   D +YE+++  +N  L  E +
Sbjct: 60  LHL-----SNVQAAGFSGLLADFALEHQAQALIRGIRGSDDLEYEIQLAQLNHKLAHEHL 114

Query: 120 ATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVF 159
            TI        RY++ST++R +     DI+ FVP   CV 
Sbjct: 115 ETIFFPPAVELRYISSTMVREIYKHHGDISHFVPP--CVL 152


>gi|315283096|ref|ZP_07871362.1| pantetheine-phosphate adenylyltransferase [Listeria marthii FSL
           S4-120]
 gi|313613255|gb|EFR87133.1| pantetheine-phosphate adenylyltransferase [Listeria marthii FSL
           S4-120]
          Length = 160

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 90/152 (59%), Gaps = 6/152 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AV  G+FDPITNGH+DII +A    + L +++  NS K K   +++ER E+IKQ   H +
Sbjct: 6   AVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSK-KPLFTVEERMEMIKQVTAH-L 63

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V S  GL V+ A    A  IVRGLR ++DF+YEM++ S+NR L  EI T  +
Sbjct: 64  PN----VQVESASGLTVDYAAKRGATAIVRGLRAVSDFEYEMQIASMNRTLNAEIETFFV 119

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
                  +++S++++ +     DI   VP+ V
Sbjct: 120 MTNTKYSFLSSSMVKEVAQYQGDIRELVPEVV 151


>gi|189460240|ref|ZP_03009025.1| hypothetical protein BACCOP_00877 [Bacteroides coprocola DSM 17136]
 gi|189433101|gb|EDV02086.1| hypothetical protein BACCOP_00877 [Bacteroides coprocola DSM 17136]
          Length = 152

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 100/159 (62%), Gaps = 7/159 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M++A++ G+FDP T GH  ++ +AL+F+++++I IG N  K K +   ++R E+IK+   
Sbjct: 1   MKRAIFPGTFDPFTIGHFSVVKRALTFMDEIIIGIGVNDNK-KTWFPTEKRVEMIKR--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +  + +R+ V +++ L V+ A+  +A+ I+RG+R + DF+YE  +  +NR L   I T
Sbjct: 57  --LYANESRIRVEAYDNLTVDFAQQRNAKFIIRGIRTVRDFEYEETIADINRKLAG-IET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           I LF +     ++ST++R L+    D+T F+P+ + + L
Sbjct: 114 ILLFTEPELTAISSTIVRELLQYGKDVTPFLPEGLDINL 152


>gi|238918040|ref|YP_002931554.1| pantetheine-phosphate adenylyltransferase, putative [Edwardsiella
           ictaluri 93-146]
 gi|259491310|sp|C5B9D9|COAD_EDWI9 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|238867607|gb|ACR67318.1| pantetheine-phosphate adenylyltransferase, putative [Edwardsiella
           ictaluri 93-146]
          Length = 161

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 93/157 (59%), Gaps = 6/157 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y G+FDP+TNGH+DI+ +A    + +++AI  +  K   F +++ER  + ++  
Sbjct: 1   MSRTAIYPGTFDPLTNGHLDIVTRAAHMFDSVILAIAASPGKQPLF-TLEERVAMAREVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V  F  L  + A+   A ++VRGLR ++DF+YE+++ ++NR L P + 
Sbjct: 60  AHL-----TNVEVHGFSELMAHFAQRQGANILVRGLRAVSDFEYELQLANMNRHLMPTLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           ++ L   E+  +++S+L++ +     D+ +F+P+ V 
Sbjct: 115 SVFLMPAEAWSFISSSLVKEVARHGGDVDAFLPEQVA 151


>gi|32476543|ref|NP_869537.1| phosphopantetheine adenylyltransferase [Rhodopirellula baltica SH
           1]
 gi|61212714|sp|Q7UKG6|COAD_RHOBA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|32447089|emb|CAD76898.1| phosphopantetheine adenylyltransferase [Rhodopirellula baltica SH
           1]
          Length = 179

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 97/160 (60%), Gaps = 9/160 (5%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVYTGSFDP+T GH+ II +A    + LV+ IG N+ K K   + +ER EL+ Q+I + +
Sbjct: 18  AVYTGSFDPVTLGHLHIIERASKLFDTLVVGIGINADK-KSLFNPEERIELV-QTISNHL 75

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V +F+GLAV+  + + A V+VRG+R +TD   E  M   NR L  +I T+ L
Sbjct: 76  PN----VRVQTFDGLAVDFVRSLGAGVMVRGIRPLTDIAGEFTMMMANRQLDADIETVFL 131

Query: 125 FAKESSRYVTSTLIRHLISI---DADITSFVPDPVCVFLK 161
            A E   +V+S+L++ + ++   D  +  FVP P+   L+
Sbjct: 132 MADERFAHVSSSLLKQIAALSENDDHLAKFVPRPIIPSLR 171


>gi|289812039|ref|ZP_06542668.1| phosphopantetheine adenylyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
          Length = 140

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 85/139 (61%), Gaps = 6/139 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M ++A+Y G+FDPITNGH+DI+ +A    + +++AI  +  K K   ++ ER  L +++ 
Sbjct: 1   MQKRAIYPGTFDPITNGHLDIVTRATQMFDHVILAIAASPGK-KPMFTLNERVALAQKAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V+ F  L  N A+D  A +++RGLR + DF+YEM++  +NR L P++ 
Sbjct: 60  AHL-----GNVEVVGFSDLMANFARDRQANILIRGLRAVADFEYEMQLAHMNRHLMPQLE 114

Query: 121 TIALFAKESSRYVTSTLIR 139
           ++ L   +   +++S+L++
Sbjct: 115 SVFLMPSKEWSFISSSLVK 133


>gi|182417243|ref|ZP_02948596.1| pantetheine-phosphate adenylyltransferase [Clostridium butyricum
           5521]
 gi|237667482|ref|ZP_04527466.1| pantetheine-phosphate adenylyltransferase [Clostridium butyricum E4
           str. BoNT E BL5262]
 gi|182378889|gb|EDT76402.1| pantetheine-phosphate adenylyltransferase [Clostridium butyricum
           5521]
 gi|237655830|gb|EEP53386.1| pantetheine-phosphate adenylyltransferase [Clostridium butyricum E4
           str. BoNT E BL5262]
          Length = 159

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 92/155 (59%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDPITNGH+DII +     + ++I +  N V  K    I ER +LIK+   
Sbjct: 1   MSIAVYPGSFDPITNGHVDIIRRGAKVFDKVIIGVLVN-VDKKHLFEIDERVKLIKK--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             + +    V V+SF GL V+L K+ +A V+++GLR+  DF+YE++M+ +NR L   I T
Sbjct: 57  --VTNDIENVEVVSFNGLLVDLLKEYNANVVLKGLRNSIDFEYELQMSYMNRELDSNIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           I + +  ++ +++S+ ++ +     +I   VP  +
Sbjct: 115 ICMMSSPNNLHISSSCVKQVAKFGGNIEGLVPKEI 149


>gi|307709742|ref|ZP_07646193.1| pantetheine-phosphate adenylyltransferase [Streptococcus mitis
           SK564]
 gi|307619444|gb|EFN98569.1| pantetheine-phosphate adenylyltransferase [Streptococcus mitis
           SK564]
          Length = 162

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 91/158 (57%), Gaps = 5/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDP+TNGH+D+I +A    + L + I  N  K +GFLSI+ R   +++++ H  
Sbjct: 6   GLFTGSFDPMTNGHLDMIERASKLFDKLYVGIFFNPHK-QGFLSIESRKRGLEKALEHL- 63

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
               N   V S + L V++AK + A  +VRGLR+  D  YE      N  L P+I TI L
Sbjct: 64  ---ENVEVVSSHDELVVDVAKRLGATCLVRGLRNAADLQYEASFDYYNHQLSPDIETIYL 120

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            ++    Y++S+ +R L+    DIT +VP+ +   ++N
Sbjct: 121 HSRPEHLYLSSSGVRELLKFGQDITCYVPESILEEIRN 158


>gi|89900457|ref|YP_522928.1| coenzyme A biosynthesis protein [Rhodoferax ferrireducens T118]
 gi|89345194|gb|ABD69397.1| Coenzyme A biosynthesis protein [Rhodoferax ferrireducens T118]
          Length = 166

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDPIT GH D++ +A    + +++A+     K K   S++ER  + ++++ H+ 
Sbjct: 7   AVYPGTFDPITLGHEDVVRRATQLFDRVIVAVAAGHHK-KALFSLEERMAMTREAVKHY- 64

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                +V V SF GL  +      A+ +VRGLR +TDFDYE ++  +NR L P++ T+ L
Sbjct: 65  ----PKVQVESFSGLLRDFVVSQGAKAMVRGLRAVTDFDYEFQLAGMNRSLMPDVETVFL 120

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVK 169
              +  ++++ST +R + S+  ++  FV   V   L   V SL +
Sbjct: 121 TPSDKYQFISSTFVREIASLGGEVDKFVSPSVNECLIEKVRSLAQ 165


>gi|53728768|ref|ZP_00135218.2| COG0669: Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208603|ref|YP_001053828.1| phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae L20]
 gi|303253292|ref|ZP_07339441.1| phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307248156|ref|ZP_07530184.1| Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|166216051|sp|A3N1D7|COAD_ACTP2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|126097395|gb|ABN74223.1| phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|302647974|gb|EFL78181.1| phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|306855333|gb|EFM87508.1| Phosphopantetheine adenylyltransferase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
          Length = 158

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 87/157 (55%), Gaps = 6/157 (3%)

Query: 6   VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIP 65
           +Y G+FDP+TNGH+DII +A      +++A+  N  K   F S +ER+ L++QS  H   
Sbjct: 6   IYAGTFDPMTNGHLDIIERASELFGQVIVAVAKNPSKQPLF-SFEERTALVRQSCAHLA- 63

Query: 66  DSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALF 125
                V  + F GL  + AK   A+ +VRG+R   D +YE+++  +N  L   + T+ L 
Sbjct: 64  ----NVQAVGFSGLLADFAKQHQAKALVRGIRGSDDIEYEIQLAQLNDKLSGRLDTVFLP 119

Query: 126 AKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
              + RY++ST++R +     D+  FVP+ V   LK 
Sbjct: 120 PSVTWRYLSSTMVREIYRHQGDVAQFVPNAVLCALKE 156


>gi|269792717|ref|YP_003317621.1| pantetheine-phosphate adenylyltransferase [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100352|gb|ACZ19339.1| pantetheine-phosphate adenylyltransferase [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 166

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 96/161 (59%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M +AVY GSFDPITNGH+ I  +A +  ++L++A+  N  K   F S++ER  + ++++ 
Sbjct: 1   MIRAVYPGSFDPITNGHVYIAERAAALFDELIVAVLHNPEKRATF-SVEERQMMAREALS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P     V V +F+GL V+  + + +++I+RGLR ++DF+YE ++  +NR L PEI T
Sbjct: 60  H-LPT----VKVDAFQGLLVDFMRHVRSRIIIRGLRALSDFEYEFQLAQMNRQLAPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + +       Y++S  ++ + S    I   VP  V   L+ 
Sbjct: 115 MFIVTDAKYSYLSSRGVKEVYSFGGPIQDMVPPGVFRRLRE 155


>gi|237802344|ref|ZP_04590805.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331025201|gb|EGI05257.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 159

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 91/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+   S K      +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDQVVIAVAA-SPKKNPLFPLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V+ F  L  + AK+ +  V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  H-LPN----VEVVGFSTLLAHFAKEQNTNVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++  DIT FV
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFV 145


>gi|153004927|ref|YP_001379252.1| pantetheine-phosphate adenylyltransferase [Anaeromyxobacter sp.
           Fw109-5]
 gi|166216054|sp|A7HC22|COAD_ANADF RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|152028500|gb|ABS26268.1| pantetheine-phosphate adenylyltransferase [Anaeromyxobacter sp.
           Fw109-5]
          Length = 165

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 90/159 (56%), Gaps = 6/159 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           R A+Y GSFDP+TNGH+ II + L   + L++A+  N  K+  F + +ER  LI +++  
Sbjct: 4   RTAIYPGSFDPLTNGHLAIIQRGLKVFDRLIVAVANNPQKSPLF-TAEERKALISEAV-- 60

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
               +  RV V SF  L V+  +      ++RGLR ++DF+YE ++ ++NR L PE   +
Sbjct: 61  ---GNDPRVEVDSFNALLVDYVRTKGVYTVIRGLRAVSDFEYEFQLANMNRKLLPEFEAV 117

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            +   E   +V++ L+R + +   D+T  VP  V   L+
Sbjct: 118 FVMTGEDYFFVSAQLVREVATFGGDVTGLVPPNVAQELR 156


>gi|78779300|ref|YP_397412.1| phosphopantetheine adenylyltransferase [Prochlorococcus marinus
           str. MIT 9312]
 gi|123554228|sp|Q31AW9|COAD_PROM9 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|78712799|gb|ABB49976.1| Phosphopantetheine adenylyltransferase [Prochlorococcus marinus
           str. MIT 9312]
          Length = 157

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/158 (36%), Positives = 97/158 (61%), Gaps = 6/158 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           K +Y G+FDP+TNGH+D+I +A     +LV+A+  N+ KT  F +++ R   IK S+ H 
Sbjct: 2   KILYPGTFDPLTNGHLDLIERAEKIFGNLVVAVLENTSKTPTF-NLERRIIQIKYSLSH- 59

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
           +P+    + +IS+ GL V+ A D+ A +I+RGLR M+DF+YE+++   N+ L  +I TI 
Sbjct: 60  LPN----IEIISYSGLTVDCANDLKANLILRGLRAMSDFEYELQIAHTNKSLNNDIETIF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           L    +  +++S+L++ +     +I   VP  V   LK
Sbjct: 116 LSTNTNYSFLSSSLVKEVAKFGGEINHMVPPSVEKDLK 153


>gi|73748122|ref|YP_307361.1| phosphopantetheine adenylyltransferase [Dehalococcoides sp. CBDB1]
 gi|123619472|sp|Q3ZWQ5|COAD_DEHSC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|73659838|emb|CAI82445.1| pantetheine-phosphate adenylyltransferase [Dehalococcoides sp.
           CBDB1]
          Length = 159

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 95/163 (58%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y G FDP+T GH+ +  +A  F + L+IA+  N  K  G  +  ER + IKQSI  F 
Sbjct: 3   AIYPGRFDPVTLGHLSVARRASGFCDRLIIAVFDNPAKP-GLFTAAERVDFIKQSIKDF- 60

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V SF GL VN A+ + A +I+RGLR   DF+ EM M  +NR L   I    L
Sbjct: 61  PN----VEVRSFSGLMVNFARKMGASLIIRGLRVGADFEREMEMYVMNRRLDEGIELCCL 116

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
           F++   +Y++++LI+ ++ +  D +  + + V V LKN + S+
Sbjct: 117 FSEPQYQYLSASLIKEIVILGGDSSGLISEHVAVALKNKLASV 159


>gi|87120922|ref|ZP_01076814.1| phosphopantetheine adenylyltransferase [Marinomonas sp. MED121]
 gi|86163760|gb|EAQ65033.1| phosphopantetheine adenylyltransferase [Marinomonas sp. MED121]
          Length = 171

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/163 (34%), Positives = 93/163 (57%), Gaps = 6/163 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDPITNGH D++ +A      +V+A+   S K +  L    R  L +  + H +
Sbjct: 8   AVYPGTFDPITNGHADLVERAARLFSKVVVAVAA-SPKKRPVLDHDVRIALARNVLGH-L 65

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V+ F+ L     + ++ QV+VRGLR ++DF+YE ++ ++NR + P++ ++ L
Sbjct: 66  PN----VEVVGFDNLLTEFTRSVNGQVVVRGLRAVSDFEYEFQLANMNRVIAPDVESLFL 121

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISL 167
              E   Y++STL+R + S+  D   FV   V   LK   +SL
Sbjct: 122 TPSEKHSYISSTLVREIASLGGDFGLFVHPEVESVLKARYLSL 164


>gi|88797605|ref|ZP_01113194.1| phosphopantetheine adenylyltransferase [Reinekea sp. MED297]
 gi|88779777|gb|EAR10963.1| phosphopantetheine adenylyltransferase [Reinekea sp. MED297]
          Length = 161

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 94/162 (58%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M    +Y G+FDPIT GHMD+I + L     +++A+  +S K K   S+ ER  L ++  
Sbjct: 1   MSSTVIYPGTFDPITLGHMDLIERGLRHFGKVIVAV-ADSPKKKPLFSLDERVALARE-- 57

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              + +S   V V  F  L V+ A++ +AQVI+RGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 58  ---VTESLGNVEVAGFSNLLVDFAREHNAQVILRGLRVVSDFEYEFQLANMNRVLAPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           ++ L   E   +++ST +R +  ++ D++  V   V   LK 
Sbjct: 115 SLFLTPSEQYSFISSTFVREIAYLNGDVSKMVHPAVEAALKK 156


>gi|330872368|gb|EGH06517.1| phosphopantetheine adenylyltransferase [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 159

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 92/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + +VIA+   S K      +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVVIAVAA-SPKKNPLFPLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V+ F  L  + A++ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  H-LPN----VEVVGFSTLLAHFAEEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++  DIT FV
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDITKFV 145


>gi|108804211|ref|YP_644148.1| phosphopantetheine adenylyltransferase [Rubrobacter xylanophilus
           DSM 9941]
 gi|123069120|sp|Q1AW92|COAD_RUBXD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|108765454|gb|ABG04336.1| Phosphopantetheine adenylyltransferase [Rubrobacter xylanophilus
           DSM 9941]
          Length = 164

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 96/162 (59%), Gaps = 6/162 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  A+  GSFDPIT GH+DII +A    + +V+A+G N ++ +  LS  ER+ LI++   
Sbjct: 1   MNIAICPGSFDPITTGHLDIIRRASKLFDHVVVAVGSN-LRKQPRLSAAERARLIEK--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D  N VSV   EGL V+ A++  A+V+V+GLR ++DF+ E     +NR L PE+ T
Sbjct: 57  -VTADLEN-VSVEVMEGLLVDFAREQGARVVVKGLRAVSDFESEFEQAQLNRTLYPELET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNI 163
           + + +     +++S+ +R + ++  D+   VPD +   ++ I
Sbjct: 115 VFIMSASQHSFLSSSAVREIAALGGDVRGLVPDGILETVRQI 156


>gi|308273140|emb|CBX29743.1| Phosphopantetheine adenylyltransferase [uncultured Desulfobacterium
           sp.]
          Length = 170

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 92/161 (57%), Gaps = 6/161 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M R A+Y GSFDP+TNGH+DII + L   + +++ I  N  K K   +I+ER E++++S+
Sbjct: 1   MRRIAIYPGSFDPVTNGHIDIIERGLKIFDKIIVTILRNPNK-KFLFTIEERIEMLEKSL 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                   N V + +F GL V+ A    +  I+RG+R ++DFDYE +M  +NR L  EI 
Sbjct: 60  -----KKINNVEIDTFNGLLVDYALKKKSHAILRGMRALSDFDYEFQMALMNRRLNREIQ 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           T+ L       + +S++I+     D +IT  VP  V   LK
Sbjct: 115 TVFLMTGLRWIFTSSSIIKQAAEFDGNITGMVPPIVNQKLK 155


>gi|307297856|ref|ZP_07577662.1| pantetheine-phosphate adenylyltransferase [Thermotogales bacterium
           mesG1.Ag.4.2]
 gi|306917116|gb|EFN47498.1| pantetheine-phosphate adenylyltransferase [Thermotogales bacterium
           mesG1.Ag.4.2]
          Length = 158

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 93/150 (62%), Gaps = 6/150 (4%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           KAVY GSFDPIT GH+D++ +  S + D V+ +   +V  K F S +ER E+++  + H 
Sbjct: 2   KAVYPGSFDPITYGHIDLV-ERCSKIFDEVLVLVMENVNKKHFFSHEERIEMVRCGVSHL 60

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                  V++I++ GL V+ AK    ++I+RGLR ++DF+ E++M   N+ +  E+ T+ 
Sbjct: 61  -----ENVTIITYSGLLVDFAKANDVKIIIRGLRAVSDFELELQMAHANKAMLQELETLF 115

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVP 153
           L    S+ +++S+++R + +   DI+ +VP
Sbjct: 116 LMTDTSNSFISSSMVREIAAFGGDISKWVP 145


>gi|322385920|ref|ZP_08059561.1| pantetheine-phosphate adenylyltransferase [Streptococcus cristatus
           ATCC 51100]
 gi|321270035|gb|EFX52954.1| pantetheine-phosphate adenylyltransferase [Streptococcus cristatus
           ATCC 51100]
          Length = 161

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 90/152 (59%), Gaps = 5/152 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
            ++TGSFDPITNGH+D+I +A    + L + I  N  K  GF SI  +  ++  ++ H  
Sbjct: 6   GLFTGSFDPITNGHVDLIERASRLFDRLYVGIFYNPHKA-GFFSIHAKKRMVLAALAHL- 63

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
               N   + S + LAV++AK +    +VRGLR+  D DYE  +   N+ L P++ T+ L
Sbjct: 64  ---ENVEVITSHDELAVDVAKRLGVTTLVRGLRNGQDLDYEAGLHFFNKELAPDLETVFL 120

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
            ++ + RY++S+ +R LI+   D++++VP  V
Sbjct: 121 LSQPAYRYISSSAMRELIAFQQDLSAYVPASV 152


>gi|46908287|ref|YP_014676.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           str. 4b F2365]
 gi|226224658|ref|YP_002758765.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes
           Clip81459]
 gi|254826193|ref|ZP_05231194.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes FSL
           J1-194]
 gi|255522358|ref|ZP_05389595.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes FSL
           J1-175]
 gi|61212630|sp|Q71XW2|COAD_LISMF RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|259491318|sp|C1KX05|COAD_LISMC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|46881558|gb|AAT04853.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|225877120|emb|CAS05832.1| Putative phosphopantetheine adenylyltransferase [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|293595432|gb|EFG03193.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes FSL
           J1-194]
          Length = 160

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 90/150 (60%), Gaps = 6/150 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AV  G+FDPITNGH+DII +A    + L +++  NS K K   +I+ER E+I+Q   H +
Sbjct: 6   AVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSK-KPLFTIEERMEMIRQVTAH-L 63

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V S  GL V+ A    A  IVRGLR ++DF+YEM++ S+NR L  EI T  +
Sbjct: 64  PN----VQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASMNRTLNAEIETFFI 119

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPD 154
                  +++S++++ +     DI+  VP+
Sbjct: 120 MTNTKYSFLSSSMVKEVAQYQGDISELVPE 149


>gi|218295485|ref|ZP_03496298.1| pantetheine-phosphate adenylyltransferase [Thermus aquaticus
           Y51MC23]
 gi|218244117|gb|EED10643.1| pantetheine-phosphate adenylyltransferase [Thermus aquaticus
           Y51MC23]
          Length = 161

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/157 (33%), Positives = 92/157 (58%), Gaps = 6/157 (3%)

Query: 6   VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFL-SIQERSELIKQSIFHFI 64
           VY GSFDP+TNGH+D+I +A      + +AI  N  K   +L + +ER  +++++  H +
Sbjct: 4   VYPGSFDPLTNGHLDVIQRASRLFAKVTVAILENPNKRGQYLFTAEERLTIVREATAH-L 62

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V   +F GL V+  K + AQ IV+GLR ++D++YE++M  +NR L P + T+ +
Sbjct: 63  PN----VEAATFSGLLVDFVKRVGAQAIVKGLRAVSDYEYELQMAHLNRQLLPGLETLFI 118

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
            +     +V+ST+++ +     D++  VP      LK
Sbjct: 119 LSATRYSFVSSTMVKEIARYGGDVSKLVPPATLRALK 155


>gi|225180919|ref|ZP_03734367.1| pantetheine-phosphate adenylyltransferase [Dethiobacter
           alkaliphilus AHT 1]
 gi|225168400|gb|EEG77203.1| pantetheine-phosphate adenylyltransferase [Dethiobacter
           alkaliphilus AHT 1]
          Length = 163

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 92/152 (60%), Gaps = 6/152 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y GSFDP+TNGH DII +A    + +V+++  N  K   F +I+ER E++K      I
Sbjct: 4   AIYPGSFDPVTNGHRDIIERASRVFDKVVVSVLENPRKQPMF-TIEERVEMLK-----MI 57

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
            +S   V V SF+GL ++ AK  ++ ++V+GLR M+DF++E +M  +NR L   + T+ +
Sbjct: 58  TNSYENVEVDSFQGLLIDYAKQKNSNIVVKGLRAMSDFEFEFQMALINRKLDSRLETMFM 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
                  YV+S++++ + S   DI   VP+ V
Sbjct: 118 MTNNRYSYVSSSIVKEIGSYGGDICELVPNEV 149


>gi|309389037|gb|ADO76917.1| Phosphopantetheine adenylyltransferase [Halanaerobium praevalens
           DSM 2228]
          Length = 162

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 93/166 (56%), Gaps = 6/166 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M +K VY GSFDP+TNGH+DI+ +A +  +++++++  N  KT  F +++ER E++K S 
Sbjct: 1   MSKKIVYPGSFDPVTNGHLDIVKRAANIFDEVIVSVFNNPNKTPVF-TMEERVEMLKNST 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                     V V SF GL     K I    I+RGLR ++DF+ E +M S+N+ L   I 
Sbjct: 60  REL-----ENVKVDSFSGLTTKYIKSIGGDAILRGLRAVSDFEGEFQMASMNKHLDENIE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           TI L       +++S++I+     D DI   VP+ V   L+N  I 
Sbjct: 115 TIFLMTDTKYAFLSSSVIKEAAYFDGDIKELVPNFVYHKLRNKFIE 160


>gi|158320476|ref|YP_001512983.1| pantetheine-phosphate adenylyltransferase [Alkaliphilus oremlandii
           OhILAs]
 gi|167009039|sp|A8MHA0|COAD_ALKOO RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|158140675|gb|ABW18987.1| pantetheine-phosphate adenylyltransferase [Alkaliphilus oremlandii
           OhILAs]
          Length = 157

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 90/155 (58%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDPITNGH+DII +A    + L++++  N  K   F S++ER  LI++ I 
Sbjct: 1   MKVAIYPGSFDPITNGHLDIIERASKMCDHLIVSVIHNPNKNPLF-SLEERKLLIEECIG 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +       V+V  F GL +  AK   A  I++GLR ++DF+YE++M  +N+ LCP I T
Sbjct: 60  KYA-----NVTVDCFSGLLMEYAKGKEATAIIKGLRAISDFEYELQMALMNQRLCPSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L       +++S+LI+ +      I   VP  V
Sbjct: 115 VFLMTSTEYSFLSSSLIKEVAKFGGSIHGMVPANV 149


>gi|302382445|ref|YP_003818268.1| pantetheine-phosphate adenylyltransferase [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193073|gb|ADL00645.1| pantetheine-phosphate adenylyltransferase [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 160

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 90/151 (59%), Gaps = 5/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  +Y G+FDP+TNGH+DII +A+  V+ LVI +  N  K   F +  ER E+++  + 
Sbjct: 1   MRIGLYPGTFDPVTNGHLDIIGRAVKLVDRLVIGVAQNDDKGPLF-TTAERVEMVRAEVA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D    + V  F  L ++ A+ + A VIVRGLR + DF+YE +MT++N+ L  +I T
Sbjct: 60  GLGSD----IDVQPFSTLLMHFAEHLDANVIVRGLRAVADFEYEFQMTAMNQRLNDDIET 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L A    + + S L++ +  +D +I SFV
Sbjct: 116 VFLMADPRHQAIASRLVKEIARLDGNIDSFV 146


>gi|259500695|ref|ZP_05743597.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners DSM
           13335]
 gi|302191385|ref|ZP_07267639.1| phosphopantetheine adenylyltransferase [Lactobacillus iners AB-1]
 gi|315653470|ref|ZP_07906391.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners ATCC
           55195]
 gi|259168079|gb|EEW52574.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners DSM
           13335]
 gi|315489161|gb|EFU78802.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners ATCC
           55195]
          Length = 165

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 98/161 (60%), Gaps = 7/161 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKA++ GSFDP+TNGH++ +  A +  + +   I  N+ K K   + +ER E+ K ++F
Sbjct: 6   MRKAIFPGSFDPLTNGHVETVNIATTIFDKVFFVIMTNTNK-KYLFTEEERLEIAK-TVF 63

Query: 62  HFIPDSSNRVSVISF-EGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
               D+S +V VI+  + LAV++A  + A  IVRGLR+  DF+YE  + ++N+ L P++ 
Sbjct: 64  K---DNS-KVEVIARPQELAVDVAMKLGANTIVRGLRNDADFNYEREIAAINKTLAPQLN 119

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           TI L     + +++ST+I+   +   DIT  VPD V   LK
Sbjct: 120 TILLLTGPENSFISSTMIKETATFGGDITKLVPDIVSEALK 160


>gi|47093604|ref|ZP_00231362.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           str. 4b H7858]
 gi|254854012|ref|ZP_05243360.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           FSL R2-503]
 gi|254933480|ref|ZP_05266839.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           HPB2262]
 gi|300765487|ref|ZP_07075468.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           FSL N1-017]
 gi|47018028|gb|EAL08803.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           str. 4b H7858]
 gi|258607401|gb|EEW20009.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           FSL R2-503]
 gi|293585044|gb|EFF97076.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           HPB2262]
 gi|300513798|gb|EFK40864.1| pantetheine-phosphate adenylyltransferase [Listeria monocytogenes
           FSL N1-017]
 gi|328466032|gb|EGF37208.1| phosphopantetheine adenylyltransferase [Listeria monocytogenes
           1816]
          Length = 160

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 90/150 (60%), Gaps = 6/150 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AV  G+FDPITNGH+DII +A    + L +++  NS K K   +I+ER E+I+Q   H +
Sbjct: 6   AVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSK-KPLFTIEERMEMIRQVTAH-L 63

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V S  GL V+ A    A  IVRGLR ++DF+YEM++ S+NR L  EI T  +
Sbjct: 64  PN----VQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASMNRTLNAEIETFFV 119

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPD 154
                  +++S++++ +     DI+  VP+
Sbjct: 120 MTNTKYSFLSSSMVKEVAQYQGDISELVPE 149


>gi|254880969|ref|ZP_05253679.1| phosphopantetheine adenylyltransferase [Bacteroides sp. 4_3_47FAA]
 gi|294777377|ref|ZP_06742828.1| pantetheine-phosphate adenylyltransferase [Bacteroides vulgatus
           PC510]
 gi|319639977|ref|ZP_07994704.1| phosphopantetheine adenylyltransferase [Bacteroides sp. 3_1_40A]
 gi|254833762|gb|EET14071.1| phosphopantetheine adenylyltransferase [Bacteroides sp. 4_3_47FAA]
 gi|294448445|gb|EFG16994.1| pantetheine-phosphate adenylyltransferase [Bacteroides vulgatus
           PC510]
 gi|317388255|gb|EFV69107.1| phosphopantetheine adenylyltransferase [Bacteroides sp. 3_1_40A]
          Length = 158

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 95/153 (62%), Gaps = 7/153 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+A++ G+FDP T GH  ++ +AL+F++++VI IG N  K K +   ++R E+I + +F
Sbjct: 8   MRRAIFPGTFDPFTIGHYSVVKRALTFMDEVVIGIGINENK-KTWFPTEKRVEMI-EKLF 65

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
              P    RV V +++ L ++ A+   AQ IVRG+R + DF+YE  +  +NR L   I T
Sbjct: 66  ADDP----RVKVDAYDCLTIDFARAKEAQFIVRGIRTVHDFEYEETIADINRKLAG-IET 120

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           I LF +     ++ST++R L+    D+T F+P+
Sbjct: 121 ILLFTEPELTSISSTIVRELLQFGKDVTPFLPE 153


>gi|148264545|ref|YP_001231251.1| phosphopantetheine adenylyltransferase [Geobacter uraniireducens
           Rf4]
 gi|189082572|sp|A5G4G0|COAD_GEOUR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|146398045|gb|ABQ26678.1| pantetheine-phosphate adenylyltransferase [Geobacter uraniireducens
           Rf4]
          Length = 162

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/152 (34%), Positives = 94/152 (61%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           ++KAVY GSFDPIT GH+DII + L   + +++A+  NS K   F +++ER  LI++ + 
Sbjct: 3   LKKAVYPGSFDPITYGHIDIIERGLKVFDTVIVAVARNSEKNSLF-NVEERIALIREVL- 60

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
                 ++R  V +F+GL V+  +   A VI+RGLR ++DF+YE ++  +NR +  E+ T
Sbjct: 61  ----GDNSRAKVDTFDGLLVDYVRKQGATVIIRGLRAVSDFEYEFQLAQMNRSITQEVET 116

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + +       Y++S++++ + S++  I   VP
Sbjct: 117 LFMMTSVPYSYLSSSIVKEVSSLNGPIDGLVP 148


>gi|118594545|ref|ZP_01551892.1| phosphopantetheine adenylyltransferase [Methylophilales bacterium
           HTCC2181]
 gi|118440323|gb|EAV46950.1| phosphopantetheine adenylyltransferase [Methylophilales bacterium
           HTCC2181]
          Length = 156

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 93/148 (62%), Gaps = 6/148 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y GSFDP T GH DII +A    + LV+ I  ++ K   FL+ ++R  L  Q +F   
Sbjct: 3   ALYPGSFDPFTIGHEDIISRAAKTFDGLVVGISEDNAK-DNFLNYEQRLNL-AQVLFS-- 58

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
             S + + +  F GL V+ AK++ A++IVRG+R++TD++ E +M  +N+ L P + TI L
Sbjct: 59  --SFSNIQISCFRGLTVDFAKELGAEIIVRGIRNVTDYESESQMAQLNKQLAPSVETIFL 116

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFV 152
            + +  R ++STL+R +  +D DI+SFV
Sbjct: 117 NSPDKYRSISSTLVRQIHLLDGDISSFV 144


>gi|158312986|ref|YP_001505494.1| phosphopantetheine adenylyltransferase [Frankia sp. EAN1pec]
 gi|229500847|sp|A8L588|COAD_FRASN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|158108391|gb|ABW10588.1| pantetheine-phosphate adenylyltransferase [Frankia sp. EAN1pec]
          Length = 162

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 97/161 (60%), Gaps = 3/161 (1%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+AV  GSFDPITNGH+DII++A    +++V+A+  N  K   F +I+ER +LI+ ++ 
Sbjct: 1   MRRAVCPGSFDPITNGHLDIIVRASKLFDEVVVAVLINKSKAHLF-TIEERIDLIRDAVR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
              PD+   V V S  GL V+  +    Q IV+GLR ++DFDYE++M  +N  L   + T
Sbjct: 60  SH-PDAPTNVVVDSSHGLLVDFCRVRGIQSIVKGLRAVSDFDYELQMAQMNHSLA-GVET 117

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + +       +++S+L++ +     D++  VPD V   L++
Sbjct: 118 LFMSTNPQYAFLSSSLVKEVARYGGDVSGLVPDVVLKGLRD 158


>gi|88811314|ref|ZP_01126569.1| phosphopantetheine adenylyltransferase [Nitrococcus mobilis Nb-231]
 gi|88791203|gb|EAR22315.1| phosphopantetheine adenylyltransferase [Nitrococcus mobilis Nb-231]
          Length = 163

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 86/149 (57%), Gaps = 6/149 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAI-GCNSVKTKGFLSIQERSELIKQSIFHF 63
           AVY G+FDPITNGH D+I +A S    +++AI G      +   S++ER  + K+++   
Sbjct: 5   AVYPGTFDPITNGHSDLIERAASLFNRVIVAISGAPGAAKQPAFSLEERVAMAKEAL--- 61

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                  V V +FE L  N   +  A VI+RGLR ++DF+YE ++  +NR L P + T+ 
Sbjct: 62  --ACHANVEVTAFESLLANYVIERKANVILRGLRAVSDFEYEFQLAGMNRQLAPRVETLF 119

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFV 152
           L   E   Y++STL+R +  +  D++ FV
Sbjct: 120 LTPAEQYAYLSSTLVREVAMLGGDVSRFV 148


>gi|86607292|ref|YP_476055.1| phosphopantetheine adenylyltransferase [Synechococcus sp. JA-3-3Ab]
 gi|123504920|sp|Q2JRG2|COAD_SYNJA RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|86555834|gb|ABD00792.1| pantetheine-phosphate adenylyltransferase [Synechococcus sp.
           JA-3-3Ab]
          Length = 159

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/158 (36%), Positives = 89/158 (56%), Gaps = 6/158 (3%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           A+Y GSFDPIT GH+DII +A      +++A+  N  KT  F   Q +++++  S+ H  
Sbjct: 3   ALYPGSFDPITFGHLDIIERASRLFSKVIVAVLKNPNKTPLFTPEQRQAQIL-LSVAHL- 60

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
                 V V +F GL V  A+   A+VIVRGLR ++DFD E++M   N+ L PE+ T+ L
Sbjct: 61  ----KNVEVDTFSGLTVAYARQRGARVIVRGLRVLSDFDVELQMAHTNKLLAPELETLFL 116

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
                  +V+S+L++ +  +   I   VP PV   L+ 
Sbjct: 117 ATASEHSFVSSSLVKEVAKLGGPIDHLVPPPVAQDLRE 154


>gi|223043875|ref|ZP_03613917.1| pantetheine-phosphate adenylyltransferase [Staphylococcus capitis
           SK14]
 gi|222442779|gb|EEE48882.1| pantetheine-phosphate adenylyltransferase [Staphylococcus capitis
           SK14]
          Length = 161

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 98/159 (61%), Gaps = 6/159 (3%)

Query: 4   KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHF 63
           +AV  GSFDPIT GH+DII ++    +++ + +  NS K  G   ++ER +LI+ S+ H 
Sbjct: 5   RAVIPGSFDPITYGHLDIIERSADRFDEIHVCVLKNSSKG-GTFDLEERIDLIRDSVQHL 63

Query: 64  IPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIA 123
                + V V  F GL V+    + A+ I+RGLR ++DF+YE+R+TS+N+ L   I T+ 
Sbjct: 64  -----SNVEVHHFNGLLVDFCDQVGARTIIRGLRAVSDFEYELRLTSMNKKLNNNIETMY 118

Query: 124 LFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           +    +  +++S++++ + +  ADI++FVP  V   LK+
Sbjct: 119 MMTSTNYSFISSSIVKEVAAYKADISAFVPPNVEKALKD 157


>gi|88802383|ref|ZP_01117910.1| phosphopantetheine adenylyltransferase [Polaribacter irgensii 23-P]
 gi|88781241|gb|EAR12419.1| phosphopantetheine adenylyltransferase [Polaribacter irgensii 23-P]
          Length = 152

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 94/155 (60%), Gaps = 7/155 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+KA++ GSFDPIT GH DII + ++  ++L+IAIG N+ K K   S++ER + I +  F
Sbjct: 1   MKKAIFPGSFDPITLGHYDIIERGVTLFDELIIAIGINADK-KNMFSLEERKKFI-EGCF 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
              P    ++ V+++EGL V+  ++     I+RGLR+  DF++E  +   NR L  +I T
Sbjct: 59  GNHP----KIKVVAYEGLTVHFCEENKVDFILRGLRNPADFEFEKAIAHTNRDLS-KIET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + L    S+ Y++S+++R +I    D T  VP  V
Sbjct: 114 VFLLTAASTSYISSSIVRDVIRNHGDYTKLVPKSV 148


>gi|167630222|ref|YP_001680721.1| pantetheine-phosphate adenylyltransferase [Heliobacterium
           modesticaldum Ice1]
 gi|229500831|sp|B0TGU9|COAD_HELMI RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|167592962|gb|ABZ84710.1| pantetheine-phosphate adenylyltransferase [Heliobacterium
           modesticaldum Ice1]
          Length = 168

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 92/156 (58%), Gaps = 6/156 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M  AVY GSFDPIT GHMDI+ +A     ++++A+  N  K K   ++ ER E+I+ ++ 
Sbjct: 1   MTVAVYPGSFDPITKGHMDIVERAAQIFHEVIVAVVINPNK-KPLFTMDERVEMIRMAVS 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H      + V V SF GL V+  +   A+ IVRGLR ++DF+ E +M  +N+ L PE+ T
Sbjct: 60  HI-----SNVRVESFSGLLVDFTRKQGARAIVRGLRAVSDFEVEFQMALMNKRLYPEVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           + +       +++S++++ + S   D++ ++P  V 
Sbjct: 115 VFMATHTDYAFLSSSMVKEVASFGGDVSDYLPPAVL 150


>gi|254797290|ref|YP_003082132.1| pantetheine-phosphate adenylyltransferase [Neorickettsia risticii
           str. Illinois]
 gi|254590530|gb|ACT69892.1| pantetheine-phosphate adenylyltransferase [Neorickettsia risticii
           str. Illinois]
          Length = 161

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 95/155 (61%), Gaps = 5/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR  VY G+FDP+T GH+DII +AL  V+ L+IA+   + KT  F S ++R   I+ S+ 
Sbjct: 1   MRIGVYAGTFDPVTLGHLDIIKKALLVVDKLIIAVAECTSKTPTF-SSEKRKSFIQNSV- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               +   ++ + +F GL V+  +   + +IVRGLR ++DF+YE +M+ VN  L   I T
Sbjct: 59  ---EEIQGKLEIKTFRGLLVDFVRQEKSNIIVRGLRAVSDFEYEFQMSWVNHKLDDGIIT 115

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           I L A   +++++ST ++ +  +  D++ F+P+ +
Sbjct: 116 IFLPASHETQFLSSTFVKQVAILGGDLSQFLPNQI 150


>gi|212712568|ref|ZP_03320696.1| hypothetical protein PROVALCAL_03663 [Providencia alcalifaciens DSM
           30120]
 gi|212684784|gb|EEB44312.1| hypothetical protein PROVALCAL_03663 [Providencia alcalifaciens DSM
           30120]
          Length = 161

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 97/157 (61%), Gaps = 7/157 (4%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M  KA+Y G+FDPIT+GH+DI+ +A +  + +++AI  NS +     +++ER EL KQ  
Sbjct: 1   MNHKAIYPGTFDPITSGHVDIVTRAAAMFDHVLLAI-ANSQRKSPMFNLEERVELAKQVT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V V+ F  L  + A+   A +++RG+R + DF+YE ++ ++NR   P++ 
Sbjct: 60  AHL-----DNVEVVGFSELMASFAQKHGANILIRGVRSVADFEYEWQLANMNRHFVPDLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVC 157
           T+ L   +S  +V+S+LI+ +   D DI+SF+P PV 
Sbjct: 115 TVFLLPSQSLSFVSSSLIKDVALHDGDISSFLP-PVV 150


>gi|238855244|ref|ZP_04645563.1| pantetheine-phosphate adenylyltransferase [Lactobacillus jensenii
           269-3]
 gi|260664604|ref|ZP_05865456.1| pantetheine-phosphate adenylyltransferase [Lactobacillus jensenii
           SJ-7A-US]
 gi|282932463|ref|ZP_06337888.1| pantetheine-phosphate adenylyltransferase [Lactobacillus jensenii
           208-1]
 gi|313471936|ref|ZP_07812428.1| pantetheine-phosphate adenylyltransferase [Lactobacillus jensenii
           1153]
 gi|238832136|gb|EEQ24454.1| pantetheine-phosphate adenylyltransferase [Lactobacillus jensenii
           269-3]
 gi|239529138|gb|EEQ68139.1| pantetheine-phosphate adenylyltransferase [Lactobacillus jensenii
           1153]
 gi|260561669|gb|EEX27641.1| pantetheine-phosphate adenylyltransferase [Lactobacillus jensenii
           SJ-7A-US]
 gi|281303412|gb|EFA95589.1| pantetheine-phosphate adenylyltransferase [Lactobacillus jensenii
           208-1]
          Length = 165

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 99/166 (59%), Gaps = 5/166 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KA++ GSFDP+TNGH++ I QA    + + + I  N+ K K   S +ER+EL++ ++ 
Sbjct: 1   MVKAIFPGSFDPVTNGHLETIKQASKAFDKVFVVIMTNTSK-KYLFSARERAELVEDALA 59

Query: 62  HFIPDSSNRVSVISFEG-LAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                    VSV++    L V++AK++   +IVRGLR+  DF YE +++++N+ L P I 
Sbjct: 60  DL---KLANVSVLTRPATLTVDVAKELQTNIIVRGLRNSEDFLYEQQISAMNKKLNPAIE 116

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVIS 166
           TI       + +V S++I+ +   + D++ F+P+   + LK ++ S
Sbjct: 117 TIYFMTSSENSFVASSMIKEIAKFNGDVSQFLPEKAALALKRVLGS 162


>gi|187931914|ref|YP_001891899.1| phosphopantetheine adenylyltransferase [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|229500849|sp|B2SHB2|COAD_FRATM RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|187712823|gb|ACD31120.1| phosphopantetheine adenylyltransferase [Francisella tularensis
           subsp. mediasiatica FSC147]
          Length = 162

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/160 (40%), Positives = 99/160 (61%), Gaps = 9/160 (5%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y G+FDPITNGH+D++ +AL+  +++V+A+     K   F  I+ R ++IK+  
Sbjct: 1   MNKIAIYPGTFDPITNGHVDLVERALNIFDEIVVAVSTAYGKNTLF-DIRIREQMIKE-- 57

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
              +   + RV V+SF+GL V+ A   +A  IVRGLR ++DFDYE +M+SVN  L  +I 
Sbjct: 58  ---VFKDNQRVKVVSFQGLLVDTAVKHNACAIVRGLRAVSDFDYEFQMSSVNNKLNSDIQ 114

Query: 121 TIALFAKESSRYVTSTLIRHL-ISIDADITSFVPDPVCVF 159
           TI L   E    ++STL+R + I     +  FVP+  CVF
Sbjct: 115 TIFLTPSEKFSCISSTLVRAVAIHNYKRVDEFVPE--CVF 152


>gi|118442920|ref|YP_878303.1| pantetheine-phosphate adenylyltransferase [Clostridium novyi NT]
 gi|166216540|sp|A0Q101|COAD_CLONN RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|118133376|gb|ABK60420.1| pantetheine-phosphate adenylyltransferase [Clostridium novyi NT]
          Length = 161

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 93/152 (61%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDPIT GH+DII +A    +++++++  N  K KG  SI+ER +LI++   
Sbjct: 1   MRVAIYPGSFDPITEGHLDIIKRASKVFDEVIVSVLVNPDK-KGLFSIEERVKLIEK--- 56

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             + +  + V   SFEGL V+  K+  A+VI++GLR ++DF+YE++M  +N+ L   I T
Sbjct: 57  --VTEDIDNVKAESFEGLLVDYMKEKDAKVIIKGLRVVSDFEYELQMAHMNKKLDSSIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           + +       Y++S+ I+ ++     I   VP
Sbjct: 115 VFMMTNAKYSYLSSSSIKQVVMFGGCIEGLVP 146


>gi|322514989|ref|ZP_08068001.1| pantetheine-phosphate adenylyltransferase [Actinobacillus ureae
           ATCC 25976]
 gi|322119042|gb|EFX91206.1| pantetheine-phosphate adenylyltransferase [Actinobacillus ureae
           ATCC 25976]
          Length = 158

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 89/162 (54%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M    +Y G+FDPITNGH+DII +A     ++++A+  N  K   F S++ER+ L+KQS 
Sbjct: 1   MSYTVIYAGTFDPITNGHLDIIERAAKLFGNVIVAVAKNPSKQPLF-SLEERTLLVKQSC 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H      + V  + F GL  + A    A+ ++RG+R   D +YE+++  +N  L   + 
Sbjct: 60  VHL-----SNVQAVGFSGLLADFAVQHQAKALIRGIRGSDDIEYEIQLAQLNEQLEEGLE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           TI L      RY++ST++R +     D+T FVP  V   LK 
Sbjct: 115 TIFLPPAVQWRYLSSTMVREIYRHQGDVTQFVPPFVLNALKE 156


>gi|160913553|ref|ZP_02076244.1| hypothetical protein EUBDOL_00029 [Eubacterium dolichum DSM 3991]
 gi|158434105|gb|EDP12394.1| hypothetical protein EUBDOL_00029 [Eubacterium dolichum DSM 3991]
          Length = 157

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 93/155 (60%), Gaps = 6/155 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+KA++ GSFDP+T GHMDII +A    ++L++ I  NS KT  F +++ER   ++ +  
Sbjct: 1   MKKAIFPGSFDPLTRGHMDIIKRACKLFDELIVVILNNSKKTSMF-TVEERISFLQAAT- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D  N V V  +EGL V  A+ + A  +VRG+R + D++YEM + ++N+ +  EI T
Sbjct: 59  ---QDLDN-VRVADYEGLTVEFARAVGACCMVRGVRSIKDYEYEMEIAAINQHIASEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           + LFA     +V+S+ I+ +++    +   V + V
Sbjct: 115 LILFANPQDSFVSSSAIKEMVAYGQSVEGLVSEEV 149


>gi|150003804|ref|YP_001298548.1| phosphopantetheine adenylyltransferase [Bacteroides vulgatus ATCC
           8482]
 gi|237724418|ref|ZP_04554899.1| phosphopantetheine adenylyltransferase [Bacteroides sp. D4]
 gi|166216059|sp|A6KZR2|COAD_BACV8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|149932228|gb|ABR38926.1| phosphopantetheine adenylyltransferase [Bacteroides vulgatus ATCC
           8482]
 gi|229437287|gb|EEO47364.1| phosphopantetheine adenylyltransferase [Bacteroides dorei
           5_1_36/D4]
          Length = 151

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 95/153 (62%), Gaps = 7/153 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR+A++ G+FDP T GH  ++ +AL+F++++VI IG N  K K +   ++R E+I + +F
Sbjct: 1   MRRAIFPGTFDPFTIGHYSVVKRALTFMDEVVIGIGINENK-KTWFPTEKRVEMI-EKLF 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
              P    RV V +++ L ++ A+   AQ IVRG+R + DF+YE  +  +NR L   I T
Sbjct: 59  ADDP----RVKVDAYDCLTIDFARAKEAQFIVRGIRTVHDFEYEETIADINRKLAG-IET 113

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPD 154
           I LF +     ++ST++R L+    D+T F+P+
Sbjct: 114 ILLFTEPELTSISSTIVRELLQFGKDVTPFLPE 146


>gi|126664645|ref|ZP_01735629.1| phosphopantetheine adenylyltransferase [Marinobacter sp. ELB17]
 gi|126630971|gb|EBA01585.1| phosphopantetheine adenylyltransferase [Marinobacter sp. ELB17]
          Length = 158

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 100/161 (62%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M K +Y G+FDPIT+GH D+I +A    +++V+A+  NS K K  L ++ER EL++++  
Sbjct: 1   MPKVIYPGTFDPITHGHTDLIERASRLFDEVVVAVAYNS-KKKPLLELEERCELVRRATA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V+V+ F  L     +  +A VI+RGLR ++DF+YE ++  +NR L PE+ +
Sbjct: 60  H-VPN----VTVMGFSNLLAEFVRSQNATVILRGLRAVSDFEYEFQLADMNRRLAPELES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L       Y++STLIR + S+  D++ FV   V   LKN
Sbjct: 115 VFLTPTNHLSYISSTLIREIASLGGDVSEFVDPAVQDALKN 155


>gi|114332301|ref|YP_748523.1| pantetheine-phosphate adenylyltransferase [Nitrosomonas eutropha
           C91]
 gi|122313041|sp|Q0ADM4|COAD_NITEC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|114309315|gb|ABI60558.1| Phosphopantetheine adenylyltransferase [Nitrosomonas eutropha C91]
          Length = 164

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 90/151 (59%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M K +Y G+FDPIT+GH D++ +A      +++A+  +S K   F S++ER ++ +  + 
Sbjct: 1   MDKVIYPGTFDPITHGHEDLVYRASRLFGKVIVAVAVSSGKAP-FFSLEERVKMARNVLT 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +     + V V  F GL +  A+   A +I+RGLR ++DF+YE ++  +NR L P++ T
Sbjct: 60  GY-----SNVEVTGFSGLLMEFARQQDAHIIIRGLRAVSDFEYEFQLAGMNRGLYPDVET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           I L   E   ++++T++R +  +  D++ FV
Sbjct: 115 IFLTPSEQYMFISATIVREIARLGGDVSKFV 145


>gi|309803965|ref|ZP_07698048.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners
           LactinV 11V1-d]
 gi|309805325|ref|ZP_07699375.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners
           LactinV 09V1-c]
 gi|309807238|ref|ZP_07701210.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners
           LactinV 03V1-b]
 gi|309809300|ref|ZP_07703169.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners SPIN
           2503V10-D]
 gi|312871432|ref|ZP_07731527.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners LEAF
           3008A-a]
 gi|312872293|ref|ZP_07732363.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners LEAF
           2062A-h1]
 gi|312873989|ref|ZP_07734025.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners LEAF
           2052A-d]
 gi|325911486|ref|ZP_08173897.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners UPII
           143-D]
 gi|308163967|gb|EFO66231.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners
           LactinV 11V1-d]
 gi|308165325|gb|EFO67558.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners
           LactinV 09V1-c]
 gi|308166376|gb|EFO68583.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners
           LactinV 03V1-b]
 gi|308170413|gb|EFO72437.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners SPIN
           2503V10-D]
 gi|311090538|gb|EFQ48946.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners LEAF
           2052A-d]
 gi|311092116|gb|EFQ50490.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners LEAF
           2062A-h1]
 gi|311093085|gb|EFQ51434.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners LEAF
           3008A-a]
 gi|325476686|gb|EGC79841.1| pantetheine-phosphate adenylyltransferase [Lactobacillus iners UPII
           143-D]
          Length = 160

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 98/161 (60%), Gaps = 7/161 (4%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MRKA++ GSFDP+TNGH++ +  A +  + +   I  N+ K K   + +ER E+ K ++F
Sbjct: 1   MRKAIFPGSFDPLTNGHVETVNIATTIFDKVFFVIMTNTNK-KYLFTEEERLEIAK-TVF 58

Query: 62  HFIPDSSNRVSVISF-EGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
               D+S +V VI+  + LAV++A  + A  IVRGLR+  DF+YE  + ++N+ L P++ 
Sbjct: 59  K---DNS-KVEVIARPQELAVDVAMKLGANTIVRGLRNDADFNYEREIAAINKTLAPQLN 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           TI L     + +++ST+I+   +   DIT  VPD V   LK
Sbjct: 115 TILLLTGPENSFISSTMIKETATFGGDITKLVPDIVSEALK 155


>gi|260886981|ref|ZP_05898244.1| pantetheine-phosphate adenylyltransferase [Selenomonas sputigena
           ATCC 35185]
 gi|330839233|ref|YP_004413813.1| pantetheine-phosphate adenylyltransferase [Selenomonas sputigena
           ATCC 35185]
 gi|260863043|gb|EEX77543.1| pantetheine-phosphate adenylyltransferase [Selenomonas sputigena
           ATCC 35185]
 gi|329746997|gb|AEC00354.1| pantetheine-phosphate adenylyltransferase [Selenomonas sputigena
           ATCC 35185]
          Length = 162

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 96/159 (60%), Gaps = 8/159 (5%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M KAV +GSFDP+TNGH+DI  +A    ++L++ +  N  KT  F +++ER EL+ ++  
Sbjct: 1   MIKAVCSGSFDPVTNGHVDIFERASRMFDELIVGVFHNIRKTP-FFTVEERLELLAEATR 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H IP+    + V +FEGL     +++ A VIVRGLR +TD++YE +   + + + P+I T
Sbjct: 60  H-IPN----LRVGAFEGLLPEYMREVGATVIVRGLRSVTDYEYEQKQEQMLKYIAPDIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFL 160
           + L       +V+S+ +R + +    +T  VP+  CV L
Sbjct: 115 VFLLTDPRYSFVSSSGVREIANFHGRVTGLVPE--CVEL 151


>gi|77461569|ref|YP_351076.1| phosphopantetheine adenylyltransferase [Pseudomonas fluorescens
           Pf0-1]
 gi|123602920|sp|Q3K569|COAD_PSEPF RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|77385572|gb|ABA77085.1| phosphopantetheine adenylyltransferase [Pseudomonas fluorescens
           Pf0-1]
          Length = 159

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 92/151 (60%), Gaps = 6/151 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M + +Y G+FDPIT GH D++ +A    + ++IA+   S K      +++R EL ++   
Sbjct: 1   MNRVLYPGTFDPITKGHGDLVERASRLFDHVIIAVAA-SPKKNPLFPLEQRVELAREVTK 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H +P+    V V+ F  L  + AK+ +A V +RGLR ++DF+YE ++ ++NR L P++ +
Sbjct: 60  H-LPN----VEVVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVES 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFV 152
           + L   E   +++STL+R + ++  DI+ FV
Sbjct: 115 LFLTPSERYSFISSTLVREIAALGGDISKFV 145


>gi|237752727|ref|ZP_04583207.1| phosphopantetheine adenylyltransferase [Helicobacter winghamensis
           ATCC BAA-430]
 gi|229376216|gb|EEO26307.1| phosphopantetheine adenylyltransferase [Helicobacter winghamensis
           ATCC BAA-430]
          Length = 171

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 95/156 (60%), Gaps = 2/156 (1%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y G+FDPITNGH+D+I +A    + L+IA+  +S K   F S+ ER +++  +I
Sbjct: 1   MSKIAIYPGTFDPITNGHLDVIERACKLFDGLIIAVAKSSGKNPLF-SLDERVKMVNLAI 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                + ++++ V SFE L    A++  A+++VRGLR ++DF+YE++M   N  L  E+ 
Sbjct: 60  MES-QNIASKICVHSFENLIAEFAREQGAKILVRGLRAVSDFEYELQMGYANASLNKELE 118

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPV 156
           TI L     + +++ST++R + +   +I   VP  V
Sbjct: 119 TIYLMPSLQNAFISSTVVRSIFAHKGEIAHLVPKSV 154


>gi|154148715|ref|YP_001406484.1| phosphopantetheine adenylyltransferase [Campylobacter hominis ATCC
           BAA-381]
 gi|254763939|sp|A7I1U3|COAD_CAMHC RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|153804724|gb|ABS51731.1| pantetheine-phosphate adenylyltransferase [Campylobacter hominis
           ATCC BAA-381]
          Length = 159

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 93/162 (57%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M    +Y G+FDPITNGH+D+I +AL   +++++A+   S   K F  + +R E++K++ 
Sbjct: 1   MRTNCIYPGTFDPITNGHLDVIKRALRIFDNVIVAVA-KSDNKKPFFELDKRVEMVKEAT 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                 S   + VI+FE L V+ AK      ++RGLR ++DF+YE+++   NR L  +  
Sbjct: 60  -----KSLENIEVIAFENLLVDFAKSQDTCFVIRGLRAVSDFEYELQLGYANRSLWDKFE 114

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           TI L       +++S+++R +     DI+  VP  +  FL++
Sbjct: 115 TIYLMPTIKYSFISSSIVRSIFEHGGDISHLVPKEILPFLED 156


>gi|113866397|ref|YP_724886.1| phosphopantetheine adenylyltransferase [Ralstonia eutropha H16]
 gi|123134468|sp|Q0KEQ3|COAD_RALEH RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|113525173|emb|CAJ91518.1| phosphopantetheine adenylyltransferase [Ralstonia eutropha H16]
          Length = 161

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 93/148 (62%), Gaps = 6/148 (4%)

Query: 5   AVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFI 64
           AVY G+FDP+T GH D++ +A +  ++LV+ +  +S   + F S++ER  + ++ + H+ 
Sbjct: 4   AVYPGTFDPMTRGHEDLVRRASNIFDELVVGV-AHSPNKRPFFSLEERIGIAREVLGHY- 61

Query: 65  PDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIAL 124
           P+    V V  F GL  +  ++ +A+VIVRGLR ++DF+YE +M  +NR L P++ T+ L
Sbjct: 62  PN----VRVEGFSGLLKDFVRNNNARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFL 117

Query: 125 FAKESSRYVTSTLIRHLISIDADITSFV 152
              +  ++++ T +R +  +  D++ FV
Sbjct: 118 TPSDQYQFISGTFVREIAVLGGDVSKFV 145


>gi|194334179|ref|YP_002016039.1| phosphopantetheine adenylyltransferase [Prosthecochloris aestuarii
           DSM 271]
 gi|229500854|sp|B4S8K5|COAD_PROA2 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|194311997|gb|ACF46392.1| pantetheine-phosphate adenylyltransferase [Prosthecochloris
           aestuarii DSM 271]
          Length = 168

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 94/152 (61%), Gaps = 5/152 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M + A+Y G+FDP TNGH+D+  +A +  + +V+ I  NS K   F S+ ER E+I++ I
Sbjct: 1   MTQIAIYPGTFDPFTNGHLDVFERASNIFDSVVVVIAENSRKNTLF-SVDERREMIEKII 59

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
             + P +  RV V+  +GL  + A+ + A+ IVRG+R + DF+YE +M+ +NR L P++ 
Sbjct: 60  GRY-PGA--RVEVLH-DGLLADYARQVGAKAIVRGVRQVKDFEYEFQMSLLNRQLNPDVT 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           T+ L       YV S++IR +  +  D+ +FV
Sbjct: 116 TVFLMPNVKYTYVASSIIREVAMLGGDVHNFV 147


>gi|57237612|ref|YP_178860.1| phosphopantetheine adenylyltransferase [Campylobacter jejuni
           RM1221]
 gi|86150266|ref|ZP_01068493.1| posphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|86152082|ref|ZP_01070294.1| posphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|88597563|ref|ZP_01100797.1| posphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|121612588|ref|YP_001000456.1| phosphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|148926935|ref|ZP_01810612.1| 3-deoxy-D-manno-octulosonic-acid transferase [Campylobacter jejuni
           subsp. jejuni CG8486]
 gi|153951621|ref|YP_001398305.1| phosphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|157415038|ref|YP_001482294.1| phosphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|167005398|ref|ZP_02271156.1| pantetheine-phosphate adenylyltransferase [Campylobacter jejuni
           subsp. jejuni 81-176]
 gi|205356735|ref|ZP_03223495.1| 3-Deoxy-D-Manno-Octulosonic acid transferase [Campylobacter jejuni
           subsp. jejuni CG8421]
 gi|218562395|ref|YP_002344174.1| phosphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|283957251|ref|ZP_06374712.1| posphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|315124290|ref|YP_004066294.1| phosphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|14194533|sp|Q9PPF2|COAD_CAMJE RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|73620150|sp|Q5HV25|COAD_CAMJR RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216532|sp|A7H475|COAD_CAMJD RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|166216533|sp|A1VZB5|COAD_CAMJJ RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|172047111|sp|A8FLI0|COAD_CAMJ8 RecName: Full=Phosphopantetheine adenylyltransferase; AltName:
           Full=Dephospho-CoA pyrophosphorylase; AltName:
           Full=Pantetheine-phosphate adenylyltransferase;
           Short=PPAT
 gi|57166416|gb|AAW35195.1| posphopantetheine adenylyltransferase [Campylobacter jejuni RM1221]
 gi|85839382|gb|EAQ56644.1| posphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|85840867|gb|EAQ58117.1| posphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|87249404|gb|EAQ72364.1| posphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|88190155|gb|EAQ94130.1| posphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112360101|emb|CAL34895.1| phosphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|145845019|gb|EDK22116.1| 3-deoxy-D-manno-octulosonic-acid transferase [Campylobacter jejuni
           subsp. jejuni CG8486]
 gi|152939067|gb|ABS43808.1| posphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|157386002|gb|ABV52317.1| pantetheine-phosphate adenylyltransferase [Campylobacter jejuni
           subsp. jejuni 81116]
 gi|205345374|gb|EDZ32017.1| 3-Deoxy-D-Manno-Octulosonic acid transferase [Campylobacter jejuni
           subsp. jejuni CG8421]
 gi|283791263|gb|EFC30071.1| posphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|284926013|gb|ADC28365.1| phosphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|307747677|gb|ADN90947.1| Phosphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni M1]
 gi|315018012|gb|ADT66105.1| phosphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|315058221|gb|ADT72550.1| Phosphopantetheine adenylyltransferase [Campylobacter jejuni subsp.
           jejuni S3]
 gi|315928306|gb|EFV07622.1| pantetheine-phosphate adenylyltransferase [Campylobacter jejuni
           subsp. jejuni DFVF1099]
 gi|315929196|gb|EFV08418.1| pantetheine-phosphate adenylyltransferase [Campylobacter jejuni
           subsp. jejuni 305]
 gi|315931182|gb|EFV10154.1| pantetheine-phosphate adenylyltransferase [Campylobacter jejuni
           subsp. jejuni 327]
          Length = 158

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 95/157 (60%), Gaps = 6/157 (3%)

Query: 6   VYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIP 65
           +Y G+FDPITNGH+D+I +AL   +++++AI   S   K    +++R EL   +  +   
Sbjct: 4   LYPGTFDPITNGHLDVIKRALKIFDEVIVAIA-KSEHKKPCYDLEKRKELALLATQNL-- 60

Query: 66  DSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATIALF 125
                V +I+F+ L V+LAK++    I+RGLR ++DF+YE+++   N  L  ++ TI L 
Sbjct: 61  ---KNVKIIAFDNLLVDLAKELKVNTIIRGLRAVSDFEYELQIGYANHALWEDMETIYLM 117

Query: 126 AKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
                 +++S+++R +++   D++S VP  +  FLK+
Sbjct: 118 PSLKHAFISSSIVRSIVAHGGDVSSLVPKEILPFLKD 154


>gi|294054724|ref|YP_003548382.1| pantetheine-phosphate adenylyltransferase [Coraliomargarita
           akajimensis DSM 45221]
 gi|293614057|gb|ADE54212.1| pantetheine-phosphate adenylyltransferase [Coraliomargarita
           akajimensis DSM 45221]
          Length = 163

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 93/152 (61%), Gaps = 6/152 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           MR A+Y GSFDPIT GH+D++ +     + +VIA+  N+ K   F S +ER +LI++++ 
Sbjct: 1   MRTAIYPGSFDPITYGHLDVLKRGCRIFDRVVIAVAHNAGKNATF-SNEERVQLIEENV- 58

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
               D  N V VI+F GL V+LAK ++A  ++RG+R ++DF++E +M  +NR L  EI T
Sbjct: 59  ---KDLPN-VEVIAFYGLIVDLAKKLNAVALIRGMRAVSDFEHEFQMAQMNRHLDGEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVP 153
           I L   E   + +STL++ +       T  +P
Sbjct: 115 IFLMPNEDYFFTSSTLVKQVHRFTDRETHLIP 146


>gi|297205841|ref|ZP_06923236.1| pantetheine-phosphate adenylyltransferase [Lactobacillus jenseni