PSIBLAST alignment of GI: 254780181 and protein with PDB id: 1coz

gi|6137341|pdb|1COZ|A Chain A, Ctp:glycerol-3-Phosphate Cytidylyltransferase From Bacillus Subtilis Length = 129
>gi|6137342|pdb|1COZ|B Chain B, Ctp:glycerol-3-Phosphate Cytidylyltransferase From Bacillus Subtilis Length = 129
 Score = 58.5 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/142 (14%), Positives = 53/142 (37%), Gaps = 15/142 (10%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+K +  G+FD +  GH+ ++ +A    + LV+AI           + +   +  K++  
Sbjct: 1   MKKVITYGTFDLLHWGHIKLLERAKQLGDYLVVAIS----------TDEFNLQKQKKAYH 50

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
            +        ++   + +      +   Q I+    ++  F            L  +   
Sbjct: 51  SYEHRKLILETIRYVDEVIPEKNWEQKKQDIIDH--NIDVFVMGDDWEGKFDFLKDQCEV 108

Query: 122 IALFAKESSRYVTSTLIRHLIS 143
           + L     +  +++T I+  I+
Sbjct: 109 VYL---PRTEGISTTKIKEEIA 127