PSIBLAST alignment of GI: 254780181 and protein with PDB id: 1hyb

>gi|13787123|pdb|1HYB|A Chain A, Crystal Structure Of An Active Site Mutant Of Methanobacterium Thermoautotrophicum Nicotinamide Mononucleotide Adenylyltransferase Length = 181
 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 62/184 (33%), Gaps = 16/184 (8%)

Query: 1   MMR-KAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIG--CNSVKTKGFLSIQERSELIK 57
           MM  + +  G   P   G + +I   L  V++L+I IG    S   +   +  ER  ++ 
Sbjct: 1   MMTMRGLLVGRMQPFHRGALQVIKSILEEVDELIICIGSAQLSHSIRDPFTAGERVMMLT 60

Query: 58  QSIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCP 117
           +++      +       S   +      + +A  +         FD       + + L  
Sbjct: 61  KALSENGIPA-------SRYYIIPVQDIECNALWVGHIKMLTPPFDRVYSGNPLVQRLFS 113

Query: 118 EIATIALFAKESSRY-VTSTLIRHLISIDADITSFVPDPVCVFLK-----NIVISLVKYD 171
           E            R   + T +R  +  D D  S +P+ V   +        +  L K +
Sbjct: 114 EDGYEVTAPPLFYRDRYSGTEVRRRMLDDGDWRSLLPESVVEVIDEINGVERIKHLAKKE 173

Query: 172 SIKL 175
             +L
Sbjct: 174 VSEL 177