PSIBLAST alignment of GI: 254780181 and protein with PDB id: 1kqn

gi|28373465|pdb|1KQN|A Chain A, Crystal Structure Of NmnNAMN ADENYLYLTRANSFERASE COMPLEXED With Nad Length = 279
>gi|28373466|pdb|1KQN|B Chain B, Crystal Structure Of NmnNAMN ADENYLYLTRANSFERASE COMPLEXED With Nad Length = 279
 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 22/60 (36%), Gaps = 9/60 (15%)

Query: 112 NRCLCPEIATIALFAKESSRY---------VTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           N        +  L+   S+ +         ++ST IR  +     I   VPD V  +++ 
Sbjct: 191 NDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEK 250