PSIBLAST alignment of GI: 254780181 and protein with PDB id: 1m8j

>gi|34811405|pdb|1M8J|A Chain A, Crystal Structure Of Methanobacterium Thermoautotrophicum Nicotinamide Mononucleotide Adenylyltransferase Mutant R136a Complexed With Nad Length = 181
 Score = 63.9 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/183 (16%), Positives = 61/183 (33%), Gaps = 15/183 (8%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIG--CNSVKTKGFLSIQERSELIKQ 58
           M  + +  G   P   GH+ +I   L  V++L+I IG    S   +   +  ER  ++ +
Sbjct: 2   MTMRGLLVGRMQPFHRGHLQVIKSILEEVDELIICIGSAQLSHSIRDPFTAGERVMMLTK 61

Query: 59  SIFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPE 118
           ++      +       S   +      + +A  +         FD       + + L  E
Sbjct: 62  ALSENGIPA-------SRYYIIPVQDIECNALWVGHIKMLTPPFDRVYSGNPLVQRLFSE 114

Query: 119 IATIALFAKESSRY-VTSTLIRHLISIDADITSFVPDPVCVFLK-----NIVISLVKYDS 172
                       R   + T +   +  D D  S +P+ V   +        +  L K + 
Sbjct: 115 DGYEVTAPPLFYRDRYSGTEVARRMLDDGDWRSLLPESVVEVIDEINGVERIKHLAKKEV 174

Query: 173 IKL 175
            +L
Sbjct: 175 SEL 177