PSIBLAST alignment of GI: 254780181 and protein with PDB id: 1yul

>gi|83753740|pdb|1YUL|A Chain A, Crystal Structure Of Nicotinic Acid Mononucleotide Adenylyltransferase From Pseudomonas Aeruginosa Length = 242
 Score = 68.1 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/205 (10%), Positives = 57/205 (27%), Gaps = 47/205 (22%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFV--EDL-VIAIGCNSVKTKGFLSIQERSELIKQ 58
            R  ++ G+FDP+  GH    ++       ++L ++       +    +S  +R   +++
Sbjct: 23  KRIGLFGGTFDPVHIGHXRSAVEXAEQFALDELRLLPNARPPHRETPQVSAAQRLAXVER 82

Query: 59  SIFHFIPDSSNRVSVISFEGLAVNLAKD--------ISAQVIVRGLRDMTDFDYEMRMTS 110
           ++      + +   +   +        +              + G           R  +
Sbjct: 83  AVAGVERLTVDPRELQRDKPSYTIDTLESVRAELAADDQLFXLIGWDAFCGLPTWHRWEA 142

Query: 111 VNRCLC----------------------------------PEIATIALFAKESSRYVTST 136
           +                                       P      ++       V++T
Sbjct: 143 LLDHCHIVVLQRPDADSEPPESLRDLLAARSVADPQALKGPGGQITFVWQTP--LAVSAT 200

Query: 137 LIRHLISIDADITSFVPDPVCVFLK 161
            IR L+     +   VPD V  +++
Sbjct: 201 QIRALLGAGRSVRFLVPDAVLNYIE 225