PSIBLAST alignment of GI: 254780181 and protein with PDB id: 3l92

>gi|284055782|pdb|3L92|A Chain A, Phosphopantetheine Adenylyltransferase From Yersinia Pestis Complexed With Coenzyme A. Length = 162
>gi|284055783|pdb|3L93|A Chain A, Phosphopantetheine Adenylyltransferase From Yersinia Pestis Length = 162
 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 55/165 (33%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           M+ KA+Y G+FDPITNGH+D++ +A +    +++AI  +S K   F ++ ER  L K+  
Sbjct: 4   MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPMF-TLDERVALAKKVT 62

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
                       V+ F  L    AK  +A ++VRGLR ++DF+YE ++ ++NR L P++ 
Sbjct: 63  APLKNVE-----VLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLE 117

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVI 165
           ++ L   E   +++S+L++ +     DIT F+P PV   L   + 
Sbjct: 118 SVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA 162