RPSBLAST alignment for GI: 254780181 and conserved domain: PRK00168

>gnl|CDD|178911 PRK00168, coaD, phosphopantetheine adenylyltransferase; Provisional. Length = 159
 Score =  190 bits (485), Expect = 2e-49
 Identities = 66/161 (40%), Positives = 103/161 (63%), Gaps = 6/161 (3%)

Query: 2   MRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIF 61
           M+ A+Y GSFDPITNGH+DII +A    +++++A+  N  K K   S++ER ELI+++  
Sbjct: 1   MKIAIYPGSFDPITNGHLDIIERASRLFDEVIVAVAINPSK-KPLFSLEERVELIREATA 59

Query: 62  HFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
           H        V V+SF+GL V+ A+++ A VIVRGLR ++DF+YE +M  +NR L PEI T
Sbjct: 60  HL-----PNVEVVSFDGLLVDFAREVGATVIVRGLRAVSDFEYEFQMAGMNRKLAPEIET 114

Query: 122 IALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           + L       +++S+L++ +  +  D++ FVP  V   LK 
Sbjct: 115 VFLMPSPEYSFISSSLVKEVARLGGDVSGFVPPAVAKALKE 155