RPSBLAST alignment for GI: 254780181 and conserved domain: COG1057

>gnl|CDD|31257 COG1057, NadD, Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism]. Length = 197
 Score = 44.9 bits (106), Expect = 1e-05
 Identities = 38/184 (20%), Positives = 66/184 (35%), Gaps = 28/184 (15%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVE-DLVIAIGCNS---VKTKGFLSIQERSELI 56
           M + A++ GSFDP   GH+ I  +AL  +  D VI +        K K   S + R  ++
Sbjct: 2   MKKIALFGGSFDPPHYGHLLIAEEALDQLGLDKVIFLPSPVPPHKKKKELASAEHRLAML 61

Query: 57  KQSI---------FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRG--LRDMTDF-DY 104
           + +I            I       ++ + E L      D+    I+    L  +  + D+
Sbjct: 62  ELAIEDNPRFEVSDREIKRGGPSYTIDTLEHLRQEYGPDVELYFIIGADNLASLPKWYDW 121

Query: 105 EMRMTSVNRCLCPEI------------ATIALFAKESSRYVTSTLIRHLISIDADITSFV 152
           +  +  V   + P                  +        ++ST IR  I   A +   +
Sbjct: 122 DELLKLVTFVVAPRPGYGELELSLLSSGGAIILLDLPRLDISSTEIRERIRRGASVDYLL 181

Query: 153 PDPV 156
           PD V
Sbjct: 182 PDSV 185