RPSBLAST alignment for GI: 254780181 and conserved domain: COG1659

>gnl|CDD|31845 COG1659, COG1659, Uncharacterized protein, linocin/CFP29 homolog [Function unknown]. Length = 267
 Score = 36.9 bits (85), Expect = 0.003
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 2/100 (2%)

Query: 23  IQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFHFIPDSSNR-VSVISFEGLAV 81
            + L+FVED  I  G ++   +G LS      L        IPD   + +S +   G+  
Sbjct: 109 AKKLAFVEDRTIFEGYSAAGIEGILSASSNPALTLPEDPREIPDVIVQALSELRLAGVDG 168

Query: 82  NLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIAT 121
             +  ++A    + + + +D  Y +R   +NR +  +I  
Sbjct: 169 PYSLLLNADRYTKLVSETSDHGYPIR-EHLNRLVDGDIIW 207