RPSBLAST alignment of GI: 254780181 and protein with PDBid: 1qjc

>1qjc_A Phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.64A {Escherichia coli} SCOP: c.26.1.3 PDB: 1h1t_A* 1gn8_A* 1b6t_A* Length = 158
 Score =  111 bits (278), Expect = 1e-25
 Identities = 55/160 (34%), Positives = 91/160 (56%), Gaps = 6/160 (3%)

Query: 3   RKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSIFH 62
           ++A+Y G+FDPITNGH+DI+ +A     D VI     S   K   +++ER  L +Q+  H
Sbjct: 2   KRAIYPGTFDPITNGHIDIVTRATQMF-DHVILAIAASPSKKPMFTLEERVALAQQATAH 60

Query: 63  FIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIATI 122
                   V V+ F  L  N A++  A V++RGLR + DF+YEM++  +NR L PE+ ++
Sbjct: 61  L-----GNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELESV 115

Query: 123 ALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
            L   +   +++S+L++ +     D+T F+P+ V   L  
Sbjct: 116 FLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMA 155