RPSBLAST alignment of GI: 254780181 and protein with PDBid: 3elb

>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Length = 341
 Score = 37.2 bits (86), Expect = 0.002
 Identities = 15/105 (14%), Positives = 36/105 (34%), Gaps = 11/105 (10%)

Query: 6   VYT-GSFDPITNGHMDIIIQALSFVEDLVIAIG----CNSVKTKGFLSIQERSELIKQSI 60
           V+  G +D +  GH + + QA +  + L++ +         K     + +ER ++++   
Sbjct: 10  VWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIK 69

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYE 105
           +       + V   +     +      +    V G       D  
Sbjct: 70  W------VDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGR 108