RPSBLAST alignment of GI: 254780181 and protein with PDBid: 3f3m

>3f3m_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A biosynthetic pathway, coenzyme A biosynthesis, cytoplasm, nucleotidyltransferase; HET: PPS; 2.40A {Staphylococcus aureus} Length = 168
 Score = 92.0 bits (227), Expect = 8e-20
 Identities = 59/162 (36%), Positives = 96/162 (59%), Gaps = 6/162 (3%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
               AV  GSFDPIT GH+DII ++     D +      + K +G  S++ER +LI+QS+
Sbjct: 2   EHTIAVIPGSFDPITYGHLDIIERSTDRF-DEIHVCVLKNSKKEGTFSLEERMDLIEQSV 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
            H        V V  F GL V+  + + A+ I+RGLR ++DF+YE+R+TS+N+ L  EI 
Sbjct: 61  KHL-----PNVKVHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIE 115

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKN 162
           T+ + +  +  +++S++++ + +  ADI+ FVP  V   LK 
Sbjct: 116 TLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKK 157