BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780181|ref|YP_003064594.1| phosphopantetheine
adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62]
         (182 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780181|ref|YP_003064594.1| phosphopantetheine adenylyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 182

 Score =  369 bits (947), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/182 (100%), Positives = 182/182 (100%)

Query: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60
           MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI
Sbjct: 1   MMRKAVYTGSFDPITNGHMDIIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQSI 60

Query: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120
           FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA
Sbjct: 61  FHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEMRMTSVNRCLCPEIA 120

Query: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTI 180
           TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTI
Sbjct: 121 TIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLKNIVISLVKYDSIKLFPNTI 180

Query: 181 FS 182
           FS
Sbjct: 181 FS 182


>gi|254780649|ref|YP_003065062.1| nicotinic acid mononucleotide adenylyltransferase [Candidatus
          Liberibacter asiaticus str. psy62]
          Length = 216

 Score = 30.0 bits (66), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 8/80 (10%)

Query: 2  MRKAVYTGSFDPITNGHMD---IIIQALSFVEDLVIAIGCNSVKTKGFLSIQERSELIKQ 58
          M+  ++ G+F+P  +GH++   I I+ L+  +   I    NSVK     S  E+   + Q
Sbjct: 20 MKIGLFGGNFNPPHHGHIEIAQIAIKKLNLDQLWWIITPFNSVKNYNLSSSLEKRISLSQ 79

Query: 59 SIFHFIPDSSNRVSVISFEG 78
          S+       + R+ + +FE 
Sbjct: 80 SLI-----KNPRIRITAFEA 94


>gi|254780758|ref|YP_003065171.1| hypothetical protein CLIBASIA_03225 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 216

 Score = 23.9 bits (50), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 49/131 (37%), Gaps = 29/131 (22%)

Query: 14  ITNGHMDIIIQALSFVEDL-----------------------VIAIGCNSVKTKGFLSIQ 50
           IT+GH+D +  A    EDL                       +++I  N+        +Q
Sbjct: 57  ITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQ 116

Query: 51  ERSELIKQS----IFHFIPDSSNRVSVISFEGLAVNLAKDISAQVIVRGLRDMTDFDYEM 106
           +   L+  +    +FH    S   V  ++FE    +L   +    I  G  D+   DY+ 
Sbjct: 117 DGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSI--GRTDILHGDYQQ 174

Query: 107 RMTSVNRCLCP 117
            + S+N  + P
Sbjct: 175 LINSINNKILP 185


>gi|254780432|ref|YP_003064845.1| acetylornithine transaminase protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 392

 Score = 22.7 bits (47), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 5/18 (27%), Positives = 13/18 (72%)

Query: 61  FHFIPDSSNRVSVISFEG 78
           +H++   +N+  +++FEG
Sbjct: 112 YHYMAGKTNKFRIVTFEG 129


>gi|254780751|ref|YP_003065164.1| ribonuclease E [Candidatus Liberibacter asiaticus str. psy62]
          Length = 723

 Score = 22.7 bits (47), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/81 (20%), Positives = 36/81 (44%), Gaps = 1/81 (1%)

Query: 103 DYEMRM-TSVNRCLCPEIATIALFAKESSRYVTSTLIRHLISIDADITSFVPDPVCVFLK 161
           +YE R   S+N  +  E+A    + ++ S         H +  D+   S+  +  CV+  
Sbjct: 541 EYEARFGVSINVVIGIELADKLFYIEKGSPVQALVNTGHKVGSDSQAPSYDKNIECVWQD 600

Query: 162 NIVISLVKYDSIKLFPNTIFS 182
             ++ + K +S++   + I S
Sbjct: 601 EALLPIPKSESLEDIQDNIVS 621


>gi|254780523|ref|YP_003064936.1| flagellar hook-associated protein FlgL [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 357

 Score = 22.3 bits (46), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 8/14 (57%), Positives = 12/14 (85%)

Query: 86  DISAQVIVRGLRDM 99
           D+SA V +RG+RD+
Sbjct: 233 DVSANVNMRGIRDI 246


>gi|254780177|ref|YP_003064590.1| lipoyltransferase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 257

 Score = 22.3 bits (46), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 8/15 (53%), Positives = 13/15 (86%)

Query: 74  ISFEGLAVNLAKDIS 88
           ISF GL++N++ D+S
Sbjct: 178 ISFHGLSLNISPDLS 192


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.326    0.139    0.392 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 103,543
Number of Sequences: 1233
Number of extensions: 3675
Number of successful extensions: 23
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 14
Number of HSP's gapped (non-prelim): 9
length of query: 182
length of database: 328,796
effective HSP length: 69
effective length of query: 113
effective length of database: 243,719
effective search space: 27540247
effective search space used: 27540247
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 35 (18.1 bits)