PSIBLAST alignment of GI: 254780182 and protein with PDB id: 3kua

>gi|312207859|pdb|3KUA|A Chain A, Ccdbvfi:gyra14vfi Length = 153
>gi|312207860|pdb|3KUA|B Chain B, Ccdbvfi:gyra14vfi Length = 153
 Score = 87.9 bits (216), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 52/133 (39%), Positives = 81/133 (60%), Gaps = 8/133 (6%)

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           + RRT + L KARDRAH+L GLA+A+AN+DE++ +I+ +P P  A+  L+ R W+  ++ 
Sbjct: 21  MTRRTIFELRKARDRAHILEGLALALANIDEIIELIKNAPTPAEAKEGLISRGWDLGNVA 80

Query: 429 DLIDLIDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            +++     +             +G  +L+E Q +AILELRL RLTGL  + I +E  +L
Sbjct: 81  SMLERAGTDAARPDWLEPEFGIREGKYFLTEQQAQAILELRLHRLTGLEHEKILDEYKAL 140

Query: 481 GIEIKECLDILSS 493
             EI E + IL+S
Sbjct: 141 LDEIAELMHILAS 153