BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780182|ref|YP_003064595.1| DNA gyrase subunit A
[Candidatus Liberibacter asiaticus str. psy62]
         (910 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|328543836|ref|YP_004303945.1| DNA gyrase, A subunit [Polymorphum gilvum SL003B-26A1]
 gi|326413580|gb|ADZ70643.1| DNA gyrase, A subunit [Polymorphum gilvum SL003B-26A1]
          Length = 912

 Score = 1021 bits (2640), Expect = 0.0,   Method: Composition-based stats.
 Identities = 570/911 (62%), Positives = 712/911 (78%), Gaps = 5/911 (0%)

Query: 1   MTE-HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFG 59
           M +     S       I  VSITDEM+ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+ 
Sbjct: 1   MADQDSSVSGGGLPSDIRPVSITDEMKRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYS 60

Query: 60  MMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS 119
           M + G EWNK Y K AR+ G+VMGKYHPHG++AIYDAL RMAQ++SLRL LI+GQGNFGS
Sbjct: 61  MHENGYEWNKPYRKSARVVGDVMGKYHPHGDSAIYDALVRMAQNFSLRLPLIDGQGNFGS 120

Query: 120 VDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGG 179
           VDGDP AA RYTECRLQK AH LLDD+ KDTVDF+ NYD S  EPVVL A++PN+LVNG 
Sbjct: 121 VDGDPAAAMRYTECRLQKVAHKLLDDIDKDTVDFQDNYDNSESEPVVLPAKFPNLLVNGA 180

Query: 180 GGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKN 239
           GGIAVGMATNIP HNLGEV+D  +A+++NP + L+ L+EII GPDFPTG +ILGR+GI++
Sbjct: 181 GGIAVGMATNIPPHNLGEVIDAAIAMMENPAMTLNELLEIIPGPDFPTGGIILGRSGIRS 240

Query: 240 AYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           AY TGRGS+V+RG   +E+    RE ++V+EIPYQVNKA M+EKIAELVREKRI  I+D+
Sbjct: 241 AYETGRGSVVMRGKVEVEEIRAGREALIVSEIPYQVNKATMIEKIAELVREKRIEGISDI 300

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDESDR G RVVIELK+ A ADVILNQLYR+++LQ+ F  NMVALNG +PE+  L  +LK
Sbjct: 301 RDESDRLGMRVVIELKKDAVADVILNQLYRFSALQTSFGCNMVALNGGRPEQMLLSDMLK 360

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
           AF+AFREEV+ RRT++LL KARDRAHVLVGLAIAVAN+DEV+ +IR +P+P TAR +LMQ
Sbjct: 361 AFIAFREEVIGRRTRFLLAKARDRAHVLVGLAIAVANIDEVIHLIRTAPDPATARAQLMQ 420

Query: 420 RSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           R+W A D+  LI LIDD  +T+  DGT  LSE Q RAIL+LRL RLT LGRD+I +ELN 
Sbjct: 421 RNWPAMDVAPLILLIDDPRHTVNEDGTYRLSEEQARAILDLRLQRLTALGRDEIGDELNK 480

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           LG EI + L+IL SR R+  II++ELL +++E  TPR+T IVEG  D+EDED I REDMV
Sbjct: 481 LGEEIADYLEILRSRPRIQQIIREELLEIRNEFATPRKTEIVEGGADLEDEDLIQREDMV 540

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           VTVSH GY+KRVPL+ YRAQRRGGKGRSG+  +DEDFVT LF+ +THT VLFFSS G VY
Sbjct: 541 VTVSHTGYIKRVPLATYRAQRRGGKGRSGMATKDEDFVTRLFVANTHTPVLFFSSRGIVY 600

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           K KVWRLP+G P +RGKAL+N+L L  GE+I++IMP PE+E SW +L V+FAT  G VRR
Sbjct: 601 KMKVWRLPLGGPTSRGKALVNLLPLEAGEQISSIMPLPENEDSWADLDVMFATTRGTVRR 660

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           NKLSDF Q+NR+GKIAMKLD  D I+ V TCT+ +D+LLTT  GQC+RFP++ +RVFAGR
Sbjct: 661 NKLSDFTQVNRNGKIAMKLDEGDGIIGVYTCTENDDVLLTTAAGQCIRFPVTDVRVFAGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NSVGVRGI+LA+ D +ISM+I+ H +AD +ER+ Y+K     R     +   +     ++
Sbjct: 721 NSVGVRGINLAEDDHLISMSILRHFEADAEERVTYLKRRRLMRG--ETEDAGVEDEAEEA 778

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
             EG++S ER  E+   EQ ILTVSE G+GKRTSS+++R++ R GKGI A  V++ N  G
Sbjct: 779 GAEGHLSLERYAEMSAAEQIILTVSENGYGKRTSSFEYRVTGRGGKGITAMAVTRRN--G 836

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FPV D+DQI+LV+D G LIR PV+ IR+A RAT+GV++F+TA+DE+VV+VER+ E
Sbjct: 837 PLVAAFPVEDSDQIMLVTDGGQLIRCPVDGIRVAGRATQGVIVFNTAEDEKVVAVERVSE 896

Query: 900 SEIVDEAESTE 910
            E  D    +E
Sbjct: 897 DEDGDTGAESE 907


>gi|307947099|ref|ZP_07662434.1| DNA gyrase, A subunit [Roseibium sp. TrichSKD4]
 gi|307770763|gb|EFO29989.1| DNA gyrase, A subunit [Roseibium sp. TrichSKD4]
          Length = 925

 Score = 1018 bits (2631), Expect = 0.0,   Method: Composition-based stats.
 Identities = 551/911 (60%), Positives = 701/911 (76%), Gaps = 7/911 (0%)

Query: 1   MTE-HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFG 59
           MT+    +        I  +SI DEM++SYL YA++VI+ RA+PD+RDGLKPVHRRIL+ 
Sbjct: 1   MTDQENSTPPGGVPSDIKPISIVDEMKSSYLDYAMSVIVSRALPDVRDGLKPVHRRILYS 60

Query: 60  MMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS 119
           M + G EWNK Y K AR+ G+VMGKYHPHG++AIYDAL RMAQ++SLRL LI+GQGNFGS
Sbjct: 61  MNENGYEWNKPYRKSARVVGDVMGKYHPHGDSAIYDALVRMAQNFSLRLPLIDGQGNFGS 120

Query: 120 VDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGG 179
           +DGD  AA RYTECRL+K AH LLDD+ KDTVDF+ NYD S  EPVVL A++PN+LVNG 
Sbjct: 121 IDGDRAAAMRYTECRLEKVAHKLLDDIDKDTVDFQENYDNSESEPVVLPAKFPNLLVNGA 180

Query: 180 GGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKN 239
           GGIAVGMATNIP HNLGEV+D  +AV+ NP + +  LM+I+ GPDFPTG +ILGR+GI++
Sbjct: 181 GGIAVGMATNIPPHNLGEVIDAAIAVMVNPAMTVAELMDIVPGPDFPTGGIILGRSGIRS 240

Query: 240 AYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           AY +GRGS+V+R    +E+   DR  ++V+EIPYQVNK++M+EKIAE VR+KRI  I+D+
Sbjct: 241 AYESGRGSVVMRSKVDVEEIRKDRNALIVSEIPYQVNKSSMIEKIAEAVRDKRIEGISDI 300

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDESDR G RVVIELKR A  DV+LNQLYRY+ LQ+ F  NMVALNG KPE+  L  ILK
Sbjct: 301 RDESDRSGMRVVIELKRDAVPDVVLNQLYRYSQLQTSFGCNMVALNGGKPEQLNLPDILK 360

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
           AF++FREEVV RRTK+LL KARDRAH+LVGL IAVAN+DEV+ +IR +P+P TAR +LM+
Sbjct: 361 AFISFREEVVQRRTKFLLKKARDRAHILVGLGIAVANIDEVIHLIRTAPDPATARAQLME 420

Query: 420 RSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           R W A D++ LI LIDD  + +  DGT  LSE Q RAIL+LRL RLT LGRD+I +EL+ 
Sbjct: 421 RDWPARDVEPLIRLIDDPRHMVQEDGTYKLSEEQARAILDLRLQRLTALGRDEIADELSK 480

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           +G EI + LDIL SR+R+  I++ E+L +K+E  TPR+T IV+G  D +DED I REDMV
Sbjct: 481 IGAEISDFLDILRSRARIQDIVRGEMLEIKEEFATPRKTEIVDGGADFDDEDLIQREDMV 540

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           VTVSH GY+KRVPL+ YRAQRRGGKGRSG+  +DEDFVT LF+ +THT VLFFSS G  Y
Sbjct: 541 VTVSHNGYIKRVPLATYRAQRRGGKGRSGMATKDEDFVTRLFVANTHTPVLFFSSRGICY 600

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           K KVWRLP+G P +RGKALIN+L L QGE+I++IMP PEDE SW NL V+F+T  G VRR
Sbjct: 601 KMKVWRLPLGGPISRGKALINMLPLEQGEQISSIMPLPEDEESWANLDVMFSTVRGTVRR 660

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           NKLSDF QINR+GKIAMKL+  D I++V TC++ +D++LTT  GQC+RFP+  +RVFAGR
Sbjct: 661 NKLSDFTQINRNGKIAMKLEDGDGIVNVATCSEHDDVMLTTAAGQCIRFPVGDVRVFAGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NSVGVRGI LA GD+VISM I+ H DA+ +ER  ++K   A R    G+ +E        
Sbjct: 721 NSVGVRGIRLADGDKVISMQILHHMDAEAEERTAFLKMSRALR----GEADENAGSDETG 776

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           +V+  +S+ER  E+   EQ ILT+SE G+GKRTSS+++R++ R GKGI A  V++ N  G
Sbjct: 777 AVDAGLSQERYAEMSAAEQIILTLSENGYGKRTSSFEYRVTGRGGKGITAMAVTERN--G 834

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LV+ FPV ++DQI+LV++ G LIR PV+ IRIA RAT+GV++F TA  E VV+VE I E
Sbjct: 835 GLVSSFPVEESDQIMLVTNGGQLIRCPVDGIRIAGRATQGVIVFKTADGENVVAVEGISE 894

Query: 900 SEIVDEAESTE 910
            +  ++ ++ E
Sbjct: 895 VDDEEDVDAVE 905



 Score = 56.0 bits (133), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 46/298 (15%), Positives = 94/298 (31%), Gaps = 56/298 (18%)

Query: 528 EDEDCIVREDMVVTV-----SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFI 582
                   E+    +     +  G V+R  LS +    R GK    + + D D + ++  
Sbjct: 633 SIMPLPEDEESWANLDVMFSTVRGTVRRNKLSDFTQINRNGKI--AMKLEDGDGIVNVAT 690

Query: 583 VSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESS 642
            S H  V+  ++ G   +  V  +       R    +  + L  G+++ ++      ++ 
Sbjct: 691 CSEHDDVMLTTAAGQCIRFPVGDVR--VFAGRNSVGVRGIRLADGDKVISMQILHHMDAE 748

Query: 643 WNNLY-------------------------------------------VVFATKHGNVRR 659
                                                           ++  +++G  +R
Sbjct: 749 AEERTAFLKMSRALRGEADENAGSDETGAVDAGLSQERYAEMSAAEQIILTLSENGYGKR 808

Query: 660 NKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQCVRFPISAIRVF 716
               ++    R   G  AM +      ++S     + + I+L T  GQ +R P+  IR  
Sbjct: 809 TSSFEYRVTGRGGKGITAMAVTERNGGLVSSFPVEESDQIMLVTNGGQLIRCPVDGIR-I 867

Query: 717 AGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITS 774
           AGR + GV     A G+ V+++  +   D + D                     +  S
Sbjct: 868 AGRATQGVIVFKTADGENVVAVEGISEVDDEEDVDAVEDGGEGGDSAAPDAAPSDGES 925


>gi|118589189|ref|ZP_01546596.1| DNA gyrase subunit A [Stappia aggregata IAM 12614]
 gi|118438518|gb|EAV45152.1| DNA gyrase subunit A [Stappia aggregata IAM 12614]
          Length = 938

 Score = 1013 bits (2619), Expect = 0.0,   Method: Composition-based stats.
 Identities = 549/905 (60%), Positives = 692/905 (76%), Gaps = 5/905 (0%)

Query: 4   HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQM 63
              +  +     I  VSI DEM+ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+ M + 
Sbjct: 8   DNSTPTDGLPSDIKPVSIVDEMKRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYSMHEN 67

Query: 64  GVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGD 123
           G EWNK Y K AR+ G+VMGKYHPHG++AIYDAL RMAQ++SLRL LI+GQGNFGSVDGD
Sbjct: 68  GYEWNKPYRKSARVVGDVMGKYHPHGDSAIYDALVRMAQNFSLRLPLIDGQGNFGSVDGD 127

Query: 124 PPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIA 183
           P AA RYTECRL+K AH LLDD+ K+TVDF+ NYD S  EPVVL A++PN+LVNG GGIA
Sbjct: 128 PAAAMRYTECRLEKVAHKLLDDIDKETVDFQENYDNSESEPVVLPAKFPNLLVNGAGGIA 187

Query: 184 VGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYAT 243
           VGMATNIP HNLGEV+D  +AV++NP + L+ LM+I+ GPDFPTG +ILGR+GI++AY T
Sbjct: 188 VGMATNIPPHNLGEVIDAAIAVMENPAMSLEELMQIVPGPDFPTGGMILGRSGIRSAYET 247

Query: 244 GRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDES 303
            RGSIV+R    +E+   DR  ++VTEIPYQVNK+ M+EKIAELVR+KRI  I+D+RDES
Sbjct: 248 ARGSIVMRAKVDVEEVRKDRTALIVTEIPYQVNKSTMIEKIAELVRDKRIEGISDIRDES 307

Query: 304 DRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVA 363
           DR G RVVIELKR A  DVILNQLYR++ LQ+ F  N+VALNG KPE+  L  +L+AFV+
Sbjct: 308 DRSGMRVVIELKRDAVPDVILNQLYRFSQLQTSFGANIVALNGGKPEQMNLSDMLRAFVS 367

Query: 364 FREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWN 423
           FREEV+ RRT+YLL KARDRAH+LVGL IAVAN+DEV+++IR +P+P TAR +LM+R+W 
Sbjct: 368 FREEVIQRRTRYLLKKARDRAHILVGLGIAVANIDEVIKLIRGAPDPATARAQLMERNWP 427

Query: 424 ASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIE 483
           A D++ LI LIDD  + +  DGT  LSE Q RAIL+LRL RLT +GRD+I  ELN +G E
Sbjct: 428 AKDVESLILLIDDPRHMVQDDGTYKLSEEQARAILDLRLQRLTAMGRDEIEEELNKIGAE 487

Query: 484 IKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVS 543
           I + L+IL SR+R+  I++ E+L +K E  TPRRT I+EG  D ++ED I REDMVVTVS
Sbjct: 488 ISDYLEILRSRARIQEIVRNEMLEIKQEFATPRRTEIIEGGPDFDEEDLIQREDMVVTVS 547

Query: 544 HLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKV 603
           H GY+KRVPL+ YRAQRRGGKGRSG+  +DEDFVT LF+ +THT VLFFSS G  YK KV
Sbjct: 548 HGGYIKRVPLATYRAQRRGGKGRSGMATKDEDFVTRLFVANTHTPVLFFSSRGICYKMKV 607

Query: 604 WRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLS 663
           WRLP+G P +RGKALIN+L L QGE+IT+I+P PEDE SW NL V+FAT  G +RRNKLS
Sbjct: 608 WRLPLGGPTSRGKALINLLPLEQGEQITSILPLPEDEDSWANLDVMFATIRGTIRRNKLS 667

Query: 664 DFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVG 723
           DF+ INR+GKIAMKL+  D I+ V+TC++ +D++LTT  GQC+RFP++ +RVFAGRNSVG
Sbjct: 668 DFVNINRNGKIAMKLEDGDGIVGVDTCSEHDDVMLTTNFGQCIRFPVTDVRVFAGRNSVG 727

Query: 724 VRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEG 783
           VRGI LA  D+VISM I+ H D   +ER  Y+K   A R       E       +  V G
Sbjct: 728 VRGIRLADEDRVISMQILHHIDVSAEERAAYLKLSRAMRGEA---DENGNGADEEGVVAG 784

Query: 784 NISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVA 843
           ++ +ER  ++   EQ ILT+SE G+GKRTSS+++R++ R GKGI A  V+  N  G L++
Sbjct: 785 DLPQERYAQMSAAEQIILTISENGYGKRTSSFEYRVTGRGGKGITAMAVNSRN--GGLIS 842

Query: 844 VFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIV 903
            FPV D+ QI+LV+D G LIR PV+ IRIA RAT+GV++F TA DE+VV+VE I E +  
Sbjct: 843 SFPVEDSHQIMLVTDGGQLIRCPVDGIRIAGRATQGVIVFKTAADEKVVAVEGISEVDED 902

Query: 904 DEAES 908
           D  E 
Sbjct: 903 DVLED 907



 Score = 56.3 bits (134), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 44/256 (17%), Positives = 84/256 (32%), Gaps = 12/256 (4%)

Query: 531 DCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVL 590
           D     D V+  ++ G   R P++  R    G        +R  D    + +   H   +
Sbjct: 692 DTCSEHDDVMLTTNFGQCIRFPVTDVR-VFAGRNSVGVRGIRLADEDRVISMQILHHIDV 750

Query: 591 FFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVF 650
                    K              G     +++ +  +     M   E         ++ 
Sbjct: 751 SAEERAAYLKLSRAMRGEADENGNGADEEGVVAGDLPQERYAQMSAAEQI-------ILT 803

Query: 651 ATKHGNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQCVR 707
            +++G  +R    ++    R   G  AM ++S    ++S       + I+L T  GQ +R
Sbjct: 804 ISENGYGKRTSSFEYRVTGRGGKGITAMAVNSRNGGLISSFPVEDSHQIMLVTDGGQLIR 863

Query: 708 FPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISG 767
            P+  IR  AGR + GV     A  ++V+++  +   D D                    
Sbjct: 864 CPVDGIR-IAGRATQGVIVFKTAADEKVVAVEGISEVDEDDVLEDGLEGEAEGSAEPGVS 922

Query: 768 DTEEITSLKNDSSVEG 783
           D    T   +++  E 
Sbjct: 923 DAGNDTIDGDETPPEA 938


>gi|150396459|ref|YP_001326926.1| DNA gyrase subunit A [Sinorhizobium medicae WSM419]
 gi|150027974|gb|ABR60091.1| DNA gyrase, A subunit [Sinorhizobium medicae WSM419]
          Length = 931

 Score = 1013 bits (2619), Expect = 0.0,   Method: Composition-based stats.
 Identities = 632/909 (69%), Positives = 757/909 (83%), Gaps = 1/909 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MTE       +   GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+GM
Sbjct: 1   MTEQSTPGGGKNPPGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYGM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            ++G++WNKKYVKCAR++G+VMGKYHPHGNAAIYDALARMAQDWSLRL LI+GQGNFGSV
Sbjct: 61  SELGIDWNKKYVKCARVTGDVMGKYHPHGNAAIYDALARMAQDWSLRLPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAAERYTECRLQKAAH LLDDL K+TVDFR NYDG+  EPVV+ A++PN+LVNG G
Sbjct: 121 DGDPPAAERYTECRLQKAAHSLLDDLDKETVDFRDNYDGTLHEPVVVPAKFPNLLVNGAG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEV+D C+A+IDNP I+L  LM+II GPDFPTGA+ILGR+GI+ A
Sbjct: 181 GIAVGMATNIPPHNLGEVIDACIALIDNPAIELPELMQIIPGPDFPTGALILGRSGIRQA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGS+++RG +HIE   GDREQI++TEIPYQVNK+ M+EK+AELVR+KRI  I+DLR
Sbjct: 241 YETGRGSVIMRGRAHIEPMRGDREQIIITEIPYQVNKSTMIEKMAELVRDKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVV+ELKR A+A+VILNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRQGYRVVVELKRDANAEVILNQLYRYTPLQTSFGCNMVALNGGKPEQMTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FREEVV RRTKYLL KAR+RAHVLVGLAIAVAN+DEV+++IR +P+P+TAR +LM+R
Sbjct: 361 FVSFREEVVSRRTKYLLRKARERAHVLVGLAIAVANIDEVIKLIRQAPDPQTAREQLMER 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D+  LI LIDD  + I  D T  LSE Q RAILELRL RLT LGRD+I +ELN +
Sbjct: 421 RWPAHDVDGLIRLIDDPRHRINDDATYNLSEEQARAILELRLQRLTALGRDEIGDELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EIK+ LDILSSR R++ I+K EL SV+DE  TPRRT I EG  DM+DED I +EDMVV
Sbjct: 481 GDEIKDYLDILSSRLRIMQIVKDELTSVRDEFGTPRRTEIAEGGPDMDDEDLIAQEDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSHLGY+KRVPL+ YRAQRRGGKGRSG+  RDEDFVT LF+ +THT VLFFSS G VYK
Sbjct: 541 TVSHLGYIKRVPLTTYRAQRRGGKGRSGMATRDEDFVTRLFVANTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+PQ+RGKALIN+L L  GERITTIMP PEDE++W NL V+F+T  G VRRN
Sbjct: 601 EKVWRLPIGTPQSRGKALINMLPLEPGERITTIMPLPEDETTWQNLDVMFSTTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDF+Q+NR+GKIAMKL +  DEILSV+TCT+ +D++LTT LGQC+RFP++ +RVFAGR
Sbjct: 661 KLSDFVQVNRNGKIAMKLEEEGDEILSVDTCTEFDDVVLTTALGQCIRFPVADVRVFAGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NS+GVRGISL  GD++ISMAIV H +A+  ER  Y+K  +A+RR ++G+ EEI  +  + 
Sbjct: 721 NSIGVRGISLGDGDRIISMAIVAHVEAEPWERAAYLKRSAAERRAVTGEEEEIVLVGEEV 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           +  G ++ ER +ELK +EQFILTVS+KGFGKR+SSYDFR S R GKGIRATD SK  EIG
Sbjct: 781 TNGGELTNERYEELKAREQFILTVSKKGFGKRSSSYDFRTSGRGGKGIRATDTSKTAEIG 840

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FP+  NDQI+LVSD G LIRVPV  IR+ASRATKGV IFSTAKDE+VVSVERI E
Sbjct: 841 ELVAAFPIEHNDQIMLVSDGGQLIRVPVEGIRLASRATKGVTIFSTAKDEKVVSVERISE 900

Query: 900 SEIVDEAES 908
            +  +E E+
Sbjct: 901 PDGDEEIEA 909



 Score = 55.6 bits (132), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 31/135 (22%), Positives = 54/135 (40%), Gaps = 6/135 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFIQINR-----SGKIAMKLDSRDEILSVETCTQENDILLT 699
             +++  +K G  +R+   DF    R           K     E+++       + I+L 
Sbjct: 798 EQFILTVSKKGFGKRSSSYDFRTSGRGGKGIRATDTSKTAEIGELVAAFPIEHNDQIMLV 857

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  GQ +R P+  IR  A R + GV   S AK ++V+S+  +   D D +      + + 
Sbjct: 858 SDGGQLIRVPVEGIR-LASRATKGVTIFSTAKDEKVVSVERISEPDGDEEIEAVGAEGVM 916

Query: 760 AQRRLISGDTEEITS 774
           AQ  L    T     
Sbjct: 917 AQPELPPEPTSTPEE 931


>gi|254503583|ref|ZP_05115734.1| DNA gyrase, A subunit [Labrenzia alexandrii DFL-11]
 gi|222439654|gb|EEE46333.1| DNA gyrase, A subunit [Labrenzia alexandrii DFL-11]
          Length = 940

 Score = 1013 bits (2618), Expect = 0.0,   Method: Composition-based stats.
 Identities = 552/895 (61%), Positives = 690/895 (77%), Gaps = 5/895 (0%)

Query: 4   HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQM 63
              +        I  VSI DEM+ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+ M + 
Sbjct: 9   DNSTPSGGLPSDIKPVSIVDEMKRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYSMHEN 68

Query: 64  GVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGD 123
           G EWNK Y K AR+ G+VMGKYHPHG++AIYDAL RMAQ++SLRL LI+GQGNFGSVDGD
Sbjct: 69  GYEWNKPYRKSARVVGDVMGKYHPHGDSAIYDALVRMAQNFSLRLPLIDGQGNFGSVDGD 128

Query: 124 PPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIA 183
           P AA RYTECRL+K AH LLDD+ KDTVDF+ NYD S  EPVVL A++PN+LVNG GGIA
Sbjct: 129 PAAAMRYTECRLEKVAHRLLDDIDKDTVDFQENYDNSESEPVVLPAKFPNLLVNGAGGIA 188

Query: 184 VGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYAT 243
           VGMATNIP HNLGEV+D  +A+++NP + L+ LM+I+ GPDFPTG +ILGR+GI++AY T
Sbjct: 189 VGMATNIPPHNLGEVIDASIAIMENPAMTLEELMQIVPGPDFPTGGMILGRSGIRSAYET 248

Query: 244 GRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDES 303
           GRGS+ +R     E+   DR  ++VTEIPYQVNK+ M+EKIAE+VR+KR+  I+D+RDES
Sbjct: 249 GRGSVPMRAKVDTEEIRKDRWALIVTEIPYQVNKSTMIEKIAEMVRDKRVEGISDIRDES 308

Query: 304 DRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVA 363
           DR G RVVIELKR A  DV+LNQLYR++ LQ+ F  NMVALNG KPE+  L  +LKAFVA
Sbjct: 309 DRSGMRVVIELKRDAVPDVVLNQLYRFSQLQTSFGANMVALNGGKPEQMNLSDMLKAFVA 368

Query: 364 FREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWN 423
           FREEV+ RRT+YLL K RDRAH+LVGL IAVAN+DEV+++IR +P+P TAR +LM+R+W 
Sbjct: 369 FREEVIQRRTRYLLKKCRDRAHILVGLGIAVANIDEVIKLIRAAPDPATARAQLMERNWP 428

Query: 424 ASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIE 483
           A D++DLI LIDD  + +  DGT  LSE Q RAIL+LRL RLT +GRD+I  ELN +G E
Sbjct: 429 ARDVEDLIRLIDDPRHMVQEDGTYKLSEEQARAILDLRLQRLTAMGRDEIEEELNKIGAE 488

Query: 484 IKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVS 543
           I + LDIL SR+R+  I++ E+L +++E  TPRRT I+EG  D ++ED I REDMVVTVS
Sbjct: 489 ISDYLDILRSRARIQEIVRNEMLEIREEFATPRRTEIIEGGADFDEEDLIQREDMVVTVS 548

Query: 544 HLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKV 603
           H GY+KRVPL+ YRAQRRGGKGRSG+  +DEDFVT LF+ +THT VLFFSS G  YK KV
Sbjct: 549 HGGYIKRVPLATYRAQRRGGKGRSGMATKDEDFVTRLFVANTHTPVLFFSSRGICYKMKV 608

Query: 604 WRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLS 663
           WRLP+G P +RGKAL+N+L L QGE+IT+I+P PEDE +W NL V+FAT  G VRRNKLS
Sbjct: 609 WRLPLGGPTSRGKALVNMLPLEQGEQITSILPLPEDEDTWANLDVMFATVRGTVRRNKLS 668

Query: 664 DFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVG 723
           DF+ INR+GKIAMKL+  D I+ V+TC++ +DI+LTT  GQC+RFP + +RVFAGRNSVG
Sbjct: 669 DFVNINRNGKIAMKLEEGDGIVGVDTCSEHSDIMLTTNSGQCIRFPATDVRVFAGRNSVG 728

Query: 724 VRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEG 783
           VRGI LA GD++ISM I+ H D D +ER  Y+K   A R       E   +   D  V G
Sbjct: 729 VRGIRLADGDRIISMQILHHIDVDAEERAAYLKLSRAMRGEA---DENGAAADEDGVVAG 785

Query: 784 NISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVA 843
            +S+ER  E+   EQ ILT+SE G+GKRTSS+++R++ R GKGI A  V+  N  G L+A
Sbjct: 786 ELSQERYAEMSAAEQIILTISENGYGKRTSSFEYRVTGRGGKGITAMAVNHRN--GGLIA 843

Query: 844 VFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
            FPV D+DQI+LV+D G LIR PV  IRIA RAT+GV+IF TA+DE+VV+VE I 
Sbjct: 844 SFPVEDSDQIMLVTDGGQLIRCPVEGIRIAGRATQGVIIFKTAEDEKVVAVEGIS 898



 Score = 50.9 bits (120), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/140 (20%), Positives = 56/140 (40%), Gaps = 4/140 (2%)

Query: 648 VVFATKHGNVRRNKLSDFIQINR--SGKIAMKLDSRDEILSVETCTQE-NDILLTTKLGQ 704
           ++  +++G  +R    ++    R   G  AM ++ R+  L      ++ + I+L T  GQ
Sbjct: 802 ILTISENGYGKRTSSFEYRVTGRGGKGITAMAVNHRNGGLIASFPVEDSDQIMLVTDGGQ 861

Query: 705 CVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRL 764
            +R P+  IR  AGR + GV     A+ ++V+++  +   D D +     +         
Sbjct: 862 LIRCPVEGIR-IAGRATQGVIIFKTAEDEKVVAVEGISEVDEDEELVEGELPEGGGADGD 920

Query: 765 ISGDTEEITSLKNDSSVEGN 784
                       + SS    
Sbjct: 921 AGSGEGGDGEAPDSSSGSDE 940


>gi|227822110|ref|YP_002826081.1| DNA gyrase subunit A [Sinorhizobium fredii NGR234]
 gi|227341110|gb|ACP25328.1| DNA gyrase subunit A [Sinorhizobium fredii NGR234]
          Length = 927

 Score = 1013 bits (2618), Expect = 0.0,   Method: Composition-based stats.
 Identities = 630/909 (69%), Positives = 756/909 (83%), Gaps = 1/909 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MTE       +   GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+GM
Sbjct: 1   MTEQSTPGGGKTPPGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYGM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            ++G++WNKKYVKCAR++G+VMGKYHPHGN AIYDALARMAQDWSLRL LI+GQGNFGSV
Sbjct: 61  SELGIDWNKKYVKCARVTGDVMGKYHPHGNMAIYDALARMAQDWSLRLPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAAERYTECRLQKAAH LLDDL K+TVDFR NYDG+ QEPVV+ A++PN+LVNG G
Sbjct: 121 DGDPPAAERYTECRLQKAAHSLLDDLDKETVDFRDNYDGTLQEPVVVPAKFPNLLVNGAG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNL EV++GC+A+ID+P I+L  LM+I+ GPDFPTGA+ILGR GI+ A
Sbjct: 181 GIAVGMATNIPPHNLSEVINGCIALIDDPAIELPELMQIVPGPDFPTGALILGRAGIRQA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGS+++RG +HIE   GDREQI++TEIPYQVNKA M+EK+AELVR+KRI  I+DLR
Sbjct: 241 YETGRGSVIMRGRAHIEPMRGDREQIIITEIPYQVNKATMIEKMAELVRDKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVVIELKR A+A+VILNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRQGYRVVIELKRDANAEVILNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FVAFREEVV RRTKYLL KAR+RAHVLVGLAIAVAN+DEV+++IR +P+P+TAR +LM+R
Sbjct: 361 FVAFREEVVSRRTKYLLRKARERAHVLVGLAIAVANIDEVIKLIRHAPDPQTAREQLMER 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D+  LI LIDD  + I  DGT  LSE Q RAIL+LRL RLT LGRD+I +ELN +
Sbjct: 421 RWPAHDVDALIRLIDDPRHRINDDGTYNLSEEQARAILDLRLQRLTALGRDEIGDELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EI++ L+ILSSR R++ I+K EL +V+DE  TPRRT I EG  DM+DED I +EDMVV
Sbjct: 481 GEEIRDYLEILSSRLRIMQIVKDELAAVRDEFGTPRRTEIAEGGPDMDDEDLIAQEDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSHLGY+KRVPL+ YRAQRRGGKGRSG+  RDEDFVT LF+ +THT VLFFSS G VYK
Sbjct: 541 TVSHLGYIKRVPLTTYRAQRRGGKGRSGMSTRDEDFVTRLFVANTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+PQ+RGKALIN+L L  GERITTIMP PEDE++W NL V+F+T  G VRRN
Sbjct: 601 EKVWRLPIGTPQSRGKALINMLPLEHGERITTIMPLPEDEATWENLDVMFSTTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDF+Q+NR+GKIAMKL +  DEILSVETCT+ +D++LTT +GQC+RFP+S +RVFAGR
Sbjct: 661 KLSDFVQVNRNGKIAMKLEEEGDEILSVETCTEFDDVVLTTAVGQCIRFPVSDVRVFAGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NS+GVRGISL  GD++ISMAI+ H +A+  ER  Y+K  +A+RR  +G+ EEI  +  + 
Sbjct: 721 NSIGVRGISLGDGDRIISMAILAHIEAEPWERAAYLKRSAAERRATTGEDEEIVLVGEEV 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           +  G +S ER +ELK +EQF+LT+SE+GFGKR+SSYDFR S R GKGIRATD SK  EIG
Sbjct: 781 ANGGELSNERYEELKAREQFVLTLSERGFGKRSSSYDFRTSGRGGKGIRATDTSKTAEIG 840

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FPV  NDQI+LVSD G LIRVPV+ IR+ASRATKGV IFSTAKDE+VVSVERI E
Sbjct: 841 ELVAAFPVEHNDQIMLVSDGGQLIRVPVDGIRLASRATKGVTIFSTAKDEKVVSVERISE 900

Query: 900 SEIVDEAES 908
            +  DE E 
Sbjct: 901 PDGEDEIEE 909



 Score = 53.3 bits (126), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 51/131 (38%), Gaps = 6/131 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFIQINR-----SGKIAMKLDSRDEILSVETCTQENDILLT 699
             +V+  ++ G  +R+   DF    R           K     E+++       + I+L 
Sbjct: 798 EQFVLTLSERGFGKRSSSYDFRTSGRGGKGIRATDTSKTAEIGELVAAFPVEHNDQIMLV 857

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  GQ +R P+  IR  A R + GV   S AK ++V+S+  +   D + +         +
Sbjct: 858 SDGGQLIRVPVDGIR-LASRATKGVTIFSTAKDEKVVSVERISEPDGEDEIEEIVTAGEA 916

Query: 760 AQRRLISGDTE 770
                 +   E
Sbjct: 917 IAAEPPADAEE 927


>gi|15965313|ref|NP_385666.1| DNA gyrase subunit A [Sinorhizobium meliloti 1021]
 gi|15074493|emb|CAC46139.1| Probable DNA gyrase subunit A [Sinorhizobium meliloti 1021]
          Length = 931

 Score = 1012 bits (2615), Expect = 0.0,   Method: Composition-based stats.
 Identities = 633/909 (69%), Positives = 756/909 (83%), Gaps = 1/909 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MTE       +   GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+GM
Sbjct: 1   MTEQSTPGGGKNPPGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYGM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            ++G++WNKKYVKCAR++G+VMGKYHPHGNAAIYDALARMAQDWSLRL LI+GQGNFGSV
Sbjct: 61  SELGIDWNKKYVKCARVTGDVMGKYHPHGNAAIYDALARMAQDWSLRLPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAAERYTECRLQKAAH LLDDL KDTVDFR NYDG+  EPVV+ A++PN+LVNG G
Sbjct: 121 DGDPPAAERYTECRLQKAAHSLLDDLDKDTVDFRDNYDGTLHEPVVVPAKFPNLLVNGAG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNL EV+DGC+A+IDNP I+L  LM+II GPDFPTGA+ILGR+GI+ A
Sbjct: 181 GIAVGMATNIPPHNLVEVIDGCIALIDNPAIELPELMQIIPGPDFPTGALILGRSGIRQA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGS+++RG +HIE   GDREQI++TEIPYQVNKA M+EK+AELVREKRI  I+DLR
Sbjct: 241 YETGRGSVIMRGRAHIEPMRGDREQIIITEIPYQVNKATMIEKMAELVREKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVVIELKR A+A+VILNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRQGYRVVIELKRDANAEVILNQLYRYTPLQTSFGCNMVALNGGKPEQMTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FRE+VV RRTKYLL KAR+RAHVLVGLAIAVAN+DEV+++IR +P+P+TAR +LM+R
Sbjct: 361 FVSFREDVVSRRTKYLLRKARERAHVLVGLAIAVANIDEVIKLIRQAPDPQTAREQLMER 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D+  LI LIDD  + I  D T  LSE Q RAIL+LRL RLT LGRD+I +ELN +
Sbjct: 421 RWPAHDVDALIRLIDDPRHRINDDATYNLSEEQARAILDLRLQRLTALGRDEIGDELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EIK+ LDILSSR R++ I+K EL +V+DE  TPRRT I EG  DM+DED I +EDMVV
Sbjct: 481 GEEIKDYLDILSSRLRIMQIVKNELTAVRDEFGTPRRTEIAEGGPDMDDEDLIAQEDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSHLGY+KRVPL+ YRAQRRGGKGRSG+  RDEDFVT LF+ +THT VLFFSS G VYK
Sbjct: 541 TVSHLGYIKRVPLTTYRAQRRGGKGRSGMATRDEDFVTRLFVANTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+PQ+RGKALIN+L L  GERITTIMP PEDE++W NL V+F+T  G VRRN
Sbjct: 601 EKVWRLPIGTPQSRGKALINMLPLEPGERITTIMPLPEDETTWENLDVMFSTTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDF+Q+NR+GKIAMKL +  DEILSV+TCT+ +D++LTT LGQC+RFP++ +RVFAGR
Sbjct: 661 KLSDFVQVNRNGKIAMKLEEEGDEILSVDTCTEFDDVVLTTALGQCIRFPVADVRVFAGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NS+GVRGISL  GD++ISMAIV H +A+  ER  Y+K  +A+RR ++G+ EEI  +  + 
Sbjct: 721 NSIGVRGISLGDGDRIISMAIVAHVEAEPWERAAYLKRSAAERRALTGEEEEIVLVGEEV 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           +  G ++ ER +ELK +EQFILTVS KGFGKR+SSYDFR S R GKGIRATD SK  EIG
Sbjct: 781 TNGGELTNERYEELKAREQFILTVSMKGFGKRSSSYDFRTSGRGGKGIRATDTSKTAEIG 840

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FP+  NDQI+LVSD G LIRVPV  IR+ASRATKGV IFSTAKDE+VVSVERI E
Sbjct: 841 ELVAAFPIEHNDQIMLVSDGGQLIRVPVEGIRLASRATKGVTIFSTAKDEKVVSVERITE 900

Query: 900 SEIVDEAES 908
            +  +E E+
Sbjct: 901 PDGDEEIEA 909



 Score = 54.4 bits (129), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 28/135 (20%), Positives = 52/135 (38%), Gaps = 6/135 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFIQINR-----SGKIAMKLDSRDEILSVETCTQENDILLT 699
             +++  +  G  +R+   DF    R           K     E+++       + I+L 
Sbjct: 798 EQFILTVSMKGFGKRSSSYDFRTSGRGGKGIRATDTSKTAEIGELVAAFPIEHNDQIMLV 857

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  GQ +R P+  IR  A R + GV   S AK ++V+S+  +   D D +      + + 
Sbjct: 858 SDGGQLIRVPVEGIR-LASRATKGVTIFSTAKDEKVVSVERITEPDGDEEIEAVGAEGVM 916

Query: 760 AQRRLISGDTEEITS 774
           A+       T     
Sbjct: 917 AEPESPPDTTSTPDE 931


>gi|307307939|ref|ZP_07587664.1| DNA gyrase, A subunit [Sinorhizobium meliloti BL225C]
 gi|306901555|gb|EFN32158.1| DNA gyrase, A subunit [Sinorhizobium meliloti BL225C]
          Length = 931

 Score = 1011 bits (2614), Expect = 0.0,   Method: Composition-based stats.
 Identities = 632/909 (69%), Positives = 755/909 (83%), Gaps = 1/909 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MTE       +   GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+GM
Sbjct: 1   MTEQSTPGGGKNPPGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYGM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            ++G++WNKKYVKCAR++G+VMGKYHPHGN AIYDALARMAQDWSLRL LI+GQGNFGSV
Sbjct: 61  SELGIDWNKKYVKCARVTGDVMGKYHPHGNTAIYDALARMAQDWSLRLPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAAERYTECRLQKAAH LLDDL KDTVDFR NYDG+  EPVV+ A++PN+LVNG G
Sbjct: 121 DGDPPAAERYTECRLQKAAHSLLDDLDKDTVDFRDNYDGTLHEPVVVPAKFPNLLVNGAG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNL EV+DGC+A+IDNP I+L  LM+II GPDFPTGA+ILGR+GI+ A
Sbjct: 181 GIAVGMATNIPPHNLVEVIDGCIALIDNPAIELPELMQIIPGPDFPTGALILGRSGIRQA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGS+++RG +HIE   GDREQI++TEIPYQVNKA M+EK+AELVREKRI  I+DLR
Sbjct: 241 YETGRGSVIMRGRAHIEPMRGDREQIIITEIPYQVNKATMIEKMAELVREKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVVIELKR A+A+VILNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRQGYRVVIELKRDANAEVILNQLYRYTPLQTSFGCNMVALNGGKPEQMTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FRE+VV RRTKYLL KAR+RAHVLVGLAIAVAN+DEV+++IR +P+P+TAR +LM+R
Sbjct: 361 FVSFREDVVSRRTKYLLRKARERAHVLVGLAIAVANIDEVIKLIRQAPDPQTAREQLMER 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D+  LI LIDD  + I  D T  LSE Q RAIL+LRL RLT LGRD+I +ELN +
Sbjct: 421 RWPAHDVDALIRLIDDPRHRINDDATYNLSEEQARAILDLRLQRLTALGRDEIGDELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EIK+ LDILSSR R++ I+K EL +V+DE  TPRRT I EG  DM+DED I +EDMVV
Sbjct: 481 GEEIKDYLDILSSRLRIMQIVKNELTAVRDEFGTPRRTEIAEGGPDMDDEDLIAQEDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSHLGY+KRVPL+ YRAQRRGGKGRSG+  RDEDFVT LF+ +THT VLFFSS G VYK
Sbjct: 541 TVSHLGYIKRVPLTTYRAQRRGGKGRSGMATRDEDFVTRLFVANTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+PQ+RGKALIN+L L  GERITTIMP PEDE++W NL V+F+T  G VRRN
Sbjct: 601 EKVWRLPIGTPQSRGKALINMLPLEPGERITTIMPLPEDETTWENLDVMFSTTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDF+Q+NR+GKIAMKL +  DEILSV+TCT+ +D++LTT LGQC+RFP++ +RVFAGR
Sbjct: 661 KLSDFVQVNRNGKIAMKLEEEGDEILSVDTCTEFDDVVLTTALGQCIRFPVADVRVFAGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NS+GVRGISL  GD++ISMAIV H +A+  ER  Y+K  +A+RR ++G+ EEI  +  + 
Sbjct: 721 NSIGVRGISLGDGDRIISMAIVAHVEAEPWERAAYLKRSAAERRALTGEEEEIVLVGEEV 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           +  G ++ ER +ELK +EQFILTVS KGFGKR+SSYDFR S R GKGIRATD SK  EIG
Sbjct: 781 TNGGELTNERYEELKAREQFILTVSMKGFGKRSSSYDFRTSGRGGKGIRATDTSKTAEIG 840

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FP+  NDQI+LVSD G LIRVPV  IR+ASRATKGV IFSTAKDE+VVSVERI E
Sbjct: 841 ELVAAFPIEHNDQIMLVSDGGQLIRVPVEGIRLASRATKGVTIFSTAKDEKVVSVERITE 900

Query: 900 SEIVDEAES 908
            +  +E E+
Sbjct: 901 PDGDEEIEA 909



 Score = 54.4 bits (129), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 28/135 (20%), Positives = 52/135 (38%), Gaps = 6/135 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFIQINR-----SGKIAMKLDSRDEILSVETCTQENDILLT 699
             +++  +  G  +R+   DF    R           K     E+++       + I+L 
Sbjct: 798 EQFILTVSMKGFGKRSSSYDFRTSGRGGKGIRATDTSKTAEIGELVAAFPIEHNDQIMLV 857

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  GQ +R P+  IR  A R + GV   S AK ++V+S+  +   D D +      + + 
Sbjct: 858 SDGGQLIRVPVEGIR-LASRATKGVTIFSTAKDEKVVSVERITEPDGDEEIEAVGAEGVM 916

Query: 760 AQRRLISGDTEEITS 774
           A+       T     
Sbjct: 917 AEPESPPDTTSTPDE 931


>gi|240850765|ref|YP_002972165.1| DNA gyrase subunit A [Bartonella grahamii as4aup]
 gi|240267888|gb|ACS51476.1| DNA gyrase subunit A [Bartonella grahamii as4aup]
          Length = 927

 Score = 1011 bits (2613), Expect = 0.0,   Method: Composition-based stats.
 Identities = 591/913 (64%), Positives = 717/913 (78%), Gaps = 3/913 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+     + +   GI  +SI DEMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M
Sbjct: 1   MTDLTPHPERDVLTGIEPISIIDEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            +MG+ +NK Y K A + GEVMGK+HPHG+A+IYDAL RMAQD+SLR  LI+GQGNFGSV
Sbjct: 61  NEMGLSFNKSYRKSAGVVGEVMGKFHPHGDASIYDALVRMAQDFSLRNPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTECRL+K +  LL D+ KDTVDF+ NYDG  +EPVVL AR+PN+LVNG G
Sbjct: 121 DGDPPAAMRYTECRLEKVSEELLADIDKDTVDFQDNYDGREREPVVLPARFPNLLVNGSG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEVVDGC+A+IDNPDI LD ++EII GPDFPTG +ILG +G++ A
Sbjct: 181 GIAVGMATNIPPHNLGEVVDGCIALIDNPDITLDKIIEIIPGPDFPTGGIILGLSGVRAA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGSI++R    IE+    R+ I+V+EIPYQVNKA M+EK+AELVR+KRI  I+DLR
Sbjct: 241 YETGRGSIIMRAKVEIEEIRSGRQAIIVSEIPYQVNKATMIEKMAELVRDKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR GYRVVIELK+   A+V+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRDGYRVVIELKKDVVAEVVLNQLYRYTPLQTSFGCNMVALNGGKPEQMTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FREEVV RRTKYLL KAR+RAHVLVGLA+AVAN+DE++ +IR +P+P+TAR +LM+R
Sbjct: 361 FVSFREEVVSRRTKYLLRKARERAHVLVGLALAVANIDEIIALIRKAPDPQTARAQLMER 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D+  LI LIDD  + I  DGT  LSE Q RAILELRL RLT LGRD+I +ELN +
Sbjct: 421 RWPAMDVAPLIKLIDDPRHIIHEDGTYNLSEEQARAILELRLQRLTALGRDEIADELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G++I + LDIL+SR R++ I+K EL ++++E  TPRRT    G  +ME ED I  EDMVV
Sbjct: 481 GVDIADYLDILASRVRIMCIVKDELSALREEFATPRRTVFGFGSAEMESEDLIAPEDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSH GY+KRVPL+ YRAQRRGGKGRSG+  +DEDFVT LF+ +THT VLFFSS G VYK
Sbjct: 541 TVSHSGYIKRVPLNTYRAQRRGGKGRSGMSTKDEDFVTRLFVANTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLP+G+PQ+RG+ALIN+L L QGERITTIMP PEDE+SW+ L V+FAT  G VRRN
Sbjct: 601 EKVWRLPLGTPQSRGRALINMLPLQQGERITTIMPLPEDEASWSALDVMFATTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
           KLSDF+Q+NR+GKIAMKLD  DEILSVETCT+ +D++LTT  GQC+RFP+  +RVFAGRN
Sbjct: 661 KLSDFVQVNRNGKIAMKLDEEDEILSVETCTEHDDVVLTTANGQCIRFPVVDVRVFAGRN 720

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGD---TEEITSLKN 777
           SVGVRGI+LAKGD+VISM I+ H +A   ER  Y+K +  +RR    D    + +T  + 
Sbjct: 721 SVGVRGINLAKGDKVISMTILEHVEATSIERSAYIKRVMNERRAFGADADVEDIVTLDEE 780

Query: 778 DSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINE 837
           D   E  +++ER  EL  +EQ +LTVSE G+GKR+SSY+FRIS R GKGIRATD SK  E
Sbjct: 781 DGGAETELTDERYAELHAREQMLLTVSEFGYGKRSSSYEFRISGRGGKGIRATDPSKTAE 840

Query: 838 IGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERI 897
           IG LVA FPV   DQI+LVSD G LIRVPV  IR A R+TKGV IF+TAK ERVVSVERI
Sbjct: 841 IGKLVAAFPVKAQDQIMLVSDGGQLIRVPVEGIRTAGRSTKGVTIFNTAKGERVVSVERI 900

Query: 898 RESEIVDEAESTE 910
            E E    +   E
Sbjct: 901 SEPEDDTSSLDDE 913



 Score = 59.4 bits (142), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 46/246 (18%), Positives = 87/246 (35%), Gaps = 9/246 (3%)

Query: 528 EDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHT 587
             E C   +D+V+T +  G   R P+   R     G+   GV   +      +  ++   
Sbjct: 686 SVETCTEHDDVVLT-TANGQCIRFPVVDVRV--FAGRNSVGVRGINLAKGDKVISMTILE 742

Query: 588 SVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLY 647
            V   S     Y ++V               I  L    G   T +      E       
Sbjct: 743 HVEATSIERSAYIKRVMNERRAFGADADVEDIVTLDEEDGGAETELTDERYAELHAREQM 802

Query: 648 VVFATKHGNVRRNKLSDFI-QINRSGKIAM----KLDSRDEILSVETCTQENDILLTTKL 702
           ++  ++ G  +R+   +F         I      K     ++++      ++ I+L +  
Sbjct: 803 LLTVSEFGYGKRSSSYEFRISGRGGKGIRATDPSKTAEIGKLVAAFPVKAQDQIMLVSDG 862

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + AKG++V+S+  +   + D        +  S   
Sbjct: 863 GQLIRVPVEGIRT-AGRSTKGVTIFNTAKGERVVSVERISEPEDDTSSLDDEGEKHSDTV 921

Query: 763 RLISGD 768
            +    
Sbjct: 922 DMSEEK 927


>gi|316934206|ref|YP_004109188.1| DNA gyrase subunit A [Rhodopseudomonas palustris DX-1]
 gi|315601920|gb|ADU44455.1| DNA gyrase, A subunit [Rhodopseudomonas palustris DX-1]
          Length = 913

 Score = 1010 bits (2610), Expect = 0.0,   Method: Composition-based stats.
 Identities = 556/912 (60%), Positives = 694/912 (76%), Gaps = 8/912 (0%)

Query: 1   MTE--HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILF 58
           M++       +      I  VSI DEM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+
Sbjct: 1   MSDKDDEKPGEPLAPSDIRPVSILDEMKRSYLDYAMSVIVARALPDARDGLKPVHRRILY 60

Query: 59  GMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFG 118
           GM + G EWNK Y K AR  G+V+GKYHPHG+ ++YDAL RMAQD+S+R+ LI+GQGNFG
Sbjct: 61  GMYENGFEWNKPYRKSARTVGDVIGKYHPHGDQSVYDALVRMAQDFSMRVPLIDGQGNFG 120

Query: 119 SVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNG 178
           SVDGD PAA RYTE RL K A  LLDD+ KDTVDF+PNYD S +EP VL A++PN+LVNG
Sbjct: 121 SVDGDMPAAMRYTESRLTKIAQTLLDDIDKDTVDFQPNYDNSEREPQVLPAKFPNLLVNG 180

Query: 179 GGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIK 238
            GGIAVGMATNIP HNLGEV+D CVA+ID+P + +D L +I+ GPDFPTG +ILGR+GI+
Sbjct: 181 AGGIAVGMATNIPPHNLGEVIDACVALIDDPALTIDDLNKIVPGPDFPTGGIILGRSGIR 240

Query: 239 NAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIAD 298
           +AY TGRGSIV+RG   IE    DRE I+V+EIPYQVNKA M+E+IAELVREK+I  I+D
Sbjct: 241 SAYQTGRGSIVMRGKVEIETVRKDREAIIVSEIPYQVNKATMVERIAELVREKKIEGISD 300

Query: 299 LRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGIL 358
           LRDESDR G+RVVIEL+R A  +V+LNQLY++T LQ+ F  NMVAL G +P+   L  +L
Sbjct: 301 LRDESDRDGFRVVIELRRDAVPEVVLNQLYKFTPLQTNFGANMVALEGGRPQLMNLKDLL 360

Query: 359 KAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELM 418
             FVAFRE+VV RRTK+LLNKARDRAH+LVGLAIAVAN+DE++R+IR SP+P TAR  LM
Sbjct: 361 TVFVAFREQVVTRRTKFLLNKARDRAHILVGLAIAVANIDEIIRVIRNSPDPNTARETLM 420

Query: 419 QRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELN 478
            R W A+D+  +I LIDD  + +  DGT  LS  Q +AIL+LRL RLT LGR++I +EL+
Sbjct: 421 SRDWPAADVAAMITLIDDPRHKLNEDGTARLSFEQAKAILDLRLQRLTALGREEISDELD 480

Query: 479 SLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDM 538
            L +EI + L+IL SR+R+  I+K EL +VK E  TPR+T IVE   ++EDED I REDM
Sbjct: 481 KLAVEIADYLEILRSRARVQTIVKDELGAVKAEFATPRKTVIVEQEGEVEDEDLIQREDM 540

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           VVTVSH GYVKRVPLS YRAQRRGGKGRSG+  R+EDFV+ LF+ STHT VLFFSS G V
Sbjct: 541 VVTVSHAGYVKRVPLSTYRAQRRGGKGRSGMATREEDFVSRLFVASTHTPVLFFSSRGQV 600

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVR 658
           YKEKVWRLP+  P  RGKALINIL L QGERITTIMP PEDE+SW+ L V+FAT  GNVR
Sbjct: 601 YKEKVWRLPLAPPNGRGKALINILPLEQGERITTIMPLPEDEASWSELDVMFATTGGNVR 660

Query: 659 RNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAG 718
           RNKLSDF+ + RSG IAMKLD  + I+ V+ CT+ +D+LLT   GQC+RFP+  +RVF+G
Sbjct: 661 RNKLSDFVDVRRSGIIAMKLDDGEAIVDVQICTERDDVLLTAAGGQCIRFPVPDVRVFSG 720

Query: 719 RNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKND 778
           R S+GVRGI+L+ GD+VIS++I+ H +A   ER  Y+K   A RR  +G+  E       
Sbjct: 721 RTSMGVRGIALSSGDKVISLSILRHFEATPAERSTYLKQSGAIRRAATGEESEPIETPEV 780

Query: 779 SSVEGN----ISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSK 834
            + EG+    +S+ER  E+   EQF+LT+SE G+GKRTSS+++R + R GKGI A  V+ 
Sbjct: 781 EAEEGDTSAALSQERYAEMSASEQFVLTISENGYGKRTSSFEYRTTGRGGKGIVAMSVNG 840

Query: 835 INEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSV 894
            N  G LVA FPV D+DQI+LV+D G LIR PV  IR+A R+T+GV++F+TA DE+VVSV
Sbjct: 841 RN--GKLVASFPVEDSDQIMLVTDNGQLIRCPVEGIRVAGRSTQGVIVFNTADDEKVVSV 898

Query: 895 ERIRESEIVDEA 906
           ERI E++  D  
Sbjct: 899 ERIPETDDGDNG 910


>gi|307317170|ref|ZP_07596611.1| DNA gyrase, A subunit [Sinorhizobium meliloti AK83]
 gi|306897258|gb|EFN28003.1| DNA gyrase, A subunit [Sinorhizobium meliloti AK83]
          Length = 931

 Score = 1010 bits (2610), Expect = 0.0,   Method: Composition-based stats.
 Identities = 632/909 (69%), Positives = 755/909 (83%), Gaps = 1/909 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MTE       +   GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+GM
Sbjct: 1   MTEQSTPGGGKNPPGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYGM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            ++G++WNKKYVKCAR++G+VMGKYHPHGN AIYDALARMAQDWSLRL LI+GQGNFGSV
Sbjct: 61  SELGIDWNKKYVKCARVTGDVMGKYHPHGNMAIYDALARMAQDWSLRLPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAAERYTECRLQKAAH LLDDL KDTVDFR NYDG+  EPVV+ A++PN+LVNG G
Sbjct: 121 DGDPPAAERYTECRLQKAAHSLLDDLDKDTVDFRDNYDGTLHEPVVVPAKFPNLLVNGAG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNL EV+DGC+A+IDNP I+L  LM+II GPDFPTGA+ILGR+GI+ A
Sbjct: 181 GIAVGMATNIPPHNLVEVIDGCIALIDNPAIELPELMQIIPGPDFPTGALILGRSGIRQA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGS+++RG +HIE   GDREQI++TEIPYQVNKA M+EK+AELVREKRI  I+DLR
Sbjct: 241 YETGRGSVIMRGRAHIEPMRGDREQIIITEIPYQVNKATMIEKMAELVREKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVVIELKR A+A+VILNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRQGYRVVIELKRDANAEVILNQLYRYTPLQTSFGCNMVALNGGKPEQMTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FRE+VV RRTKYLL KAR+RAHVLVGLAIAVAN+DEV+++IR +P+P+TAR +LM+R
Sbjct: 361 FVSFREDVVSRRTKYLLRKARERAHVLVGLAIAVANIDEVIKLIRQAPDPQTAREQLMER 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D+  LI LIDD  + I  D T  LSE Q RAIL+LRL RLT LGRD+I +ELN +
Sbjct: 421 RWPAHDVDALIRLIDDPRHRINDDATYNLSEEQARAILDLRLQRLTALGRDEIGDELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EIK+ LDILSSR R++ I+K EL +V+DE  TPRRT I EG  DM+DED I +EDMVV
Sbjct: 481 GEEIKDYLDILSSRLRIMQIVKNELTAVRDEFGTPRRTEIAEGGPDMDDEDLIAQEDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSHLGY+KRVPL+ YRAQRRGGKGRSG+  RDEDFVT LF+ +THT VLFFSS G VYK
Sbjct: 541 TVSHLGYIKRVPLTTYRAQRRGGKGRSGMATRDEDFVTRLFVANTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+PQ+RGKALIN+L L  GERITTIMP PEDE++W NL V+F+T  G VRRN
Sbjct: 601 EKVWRLPIGTPQSRGKALINMLPLEPGERITTIMPLPEDETTWENLDVMFSTTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDF+Q+NR+GKIAMKL +  DEILSV+TCT+ +D++LTT LGQC+RFP++ +RVFAGR
Sbjct: 661 KLSDFVQVNRNGKIAMKLEEEGDEILSVDTCTEFDDVVLTTALGQCIRFPVADVRVFAGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NS+GVRGISL  GD++ISMAIV H +A+  ER  Y+K  +A+RR ++G+ EEI  +  + 
Sbjct: 721 NSIGVRGISLGDGDRIISMAIVAHVEAEPWERAAYLKRSAAERRALTGEEEEIVLVGEEV 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           +  G ++ ER +ELK +EQFILTVS KGFGKR+SSYDFR S R GKGIRATD SK  EIG
Sbjct: 781 TNGGELTNERYEELKAREQFILTVSVKGFGKRSSSYDFRTSGRGGKGIRATDTSKTAEIG 840

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FP+  NDQI+LVSD G LIRVPV  IR+ASRATKGV IFSTAKDE+VVSVERI E
Sbjct: 841 ELVAAFPIEHNDQIMLVSDGGQLIRVPVEGIRLASRATKGVTIFSTAKDEKVVSVERITE 900

Query: 900 SEIVDEAES 908
            +  +E E+
Sbjct: 901 PDGDEEIEA 909



 Score = 53.6 bits (127), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 29/135 (21%), Positives = 54/135 (40%), Gaps = 6/135 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFIQINR-----SGKIAMKLDSRDEILSVETCTQENDILLT 699
             +++  +  G  +R+   DF    R           K     E+++       + I+L 
Sbjct: 798 EQFILTVSVKGFGKRSSSYDFRTSGRGGKGIRATDTSKTAEIGELVAAFPIEHNDQIMLV 857

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  GQ +R P+  IR  A R + GV   S AK ++V+S+  +   D D +      + + 
Sbjct: 858 SDGGQLIRVPVEGIR-LASRATKGVTIFSTAKDEKVVSVERITEPDGDEEIEAVGAEGVM 916

Query: 760 AQRRLISGDTEEITS 774
           A+  L +  T     
Sbjct: 917 AEPELPTDTTSTPDE 931


>gi|49475756|ref|YP_033797.1| DNA gyrase subunit A [Bartonella henselae str. Houston-1]
 gi|49238563|emb|CAF27803.1| DNA gyrase subunit a [Bartonella henselae str. Houston-1]
          Length = 931

 Score = 1009 bits (2609), Expect = 0.0,   Method: Composition-based stats.
 Identities = 592/911 (64%), Positives = 719/911 (78%), Gaps = 1/911 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+     + +   GI  VSI DEMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M
Sbjct: 1   MTDLNPHPERDVMAGIEPVSIIDEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            +MG+ +NK Y K A + GEVMGK+HPHG+A+IYDAL RMAQD+SLR  LI+GQGNFGSV
Sbjct: 61  NEMGLSFNKPYRKSAGVVGEVMGKFHPHGDASIYDALVRMAQDFSLRNPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTECRL+K +  LL D+ KDTVDF+ NYDG  +EPVVL AR+PN+LVNG G
Sbjct: 121 DGDPPAAMRYTECRLEKVSEELLADIDKDTVDFQDNYDGREREPVVLPARFPNLLVNGSG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEV+D C+A+IDNPDI LD ++EII GPDFPTG +ILG +G+++A
Sbjct: 181 GIAVGMATNIPPHNLGEVLDACIALIDNPDITLDKIIEIIPGPDFPTGGIILGHSGVRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGSI++R    IE+T   R+ I+V+EIPYQVNKA M+EK+AELVR+KRI  I+DLR
Sbjct: 241 YETGRGSIIMRAKVDIEETRNGRQAIIVSEIPYQVNKATMIEKMAELVRDKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR GYRVVIELKR   ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRDGYRVVIELKRDVIADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQMTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FREEVV RRTKYLL KAR+RAHVLVGLA+AVAN+DE++ +IR +P+P+TAR +LM+R
Sbjct: 361 FVSFREEVVSRRTKYLLRKARERAHVLVGLALAVANIDEIIALIRKAPDPQTARIKLMER 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A+D+  LI LIDD  + I +D T  LSE Q RAILELRL RLT LGRD+I +ELN +
Sbjct: 421 RWPAADVAPLIKLIDDPRHIIHADNTYNLSEEQARAILELRLQRLTALGRDEIADELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G++I + L IL+SRSR++ IIK EL  +++   TPRRT    G  +M+ ED I  EDMVV
Sbjct: 481 GVDITDYLHILASRSRIMSIIKDELNVLREAFATPRRTVFGFGSAEMDCEDLIAPEDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSH GY+KRVPLS YRAQRRGGKGRSG+  +DEDFVT LF+V+THT VLFFS+ G VYK
Sbjct: 541 TVSHSGYIKRVPLSTYRAQRRGGKGRSGMSTKDEDFVTRLFVVNTHTPVLFFSTRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLP+G+PQ+RG+ALIN+L L QGERITTIMP PEDE+ W+ L V+FAT  G VRRN
Sbjct: 601 EKVWRLPLGTPQSRGRALINMLPLQQGERITTIMPLPEDEARWSALDVMFATTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
           KLSDF+QINR+GKIAMKLD  DEILSVETCT+ +D++LTT  GQC+RFP+  +RVFAGRN
Sbjct: 661 KLSDFVQINRNGKIAMKLDEEDEILSVETCTERHDVVLTTAKGQCIRFPVVEVRVFAGRN 720

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEE-ITSLKNDS 779
           SVGVRGI+LA  D+VISM I+ H +A   ER  Y+K +  +RR    D E+ +T  + D 
Sbjct: 721 SVGVRGINLANDDKVISMTILEHVEATSVERSAYIKRVINERRAAGSDAEDLVTLDEEDE 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           +V+  ++E R  EL  +EQ +LTVSE G+GKR+SSY+FRIS R GKGIRATD SK  EIG
Sbjct: 781 AVDTELTEGRYLELHAREQMLLTVSEFGYGKRSSSYEFRISGRGGKGIRATDPSKTAEIG 840

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FPV   DQI+LVSD G LIRVPV  IRIA R+TKGV IF+TA+ E+VVSVERI E
Sbjct: 841 KLVAAFPVKAQDQIMLVSDGGQLIRVPVEGIRIAGRSTKGVTIFNTAEGEKVVSVERISE 900

Query: 900 SEIVDEAESTE 910
           SE  D     E
Sbjct: 901 SEDDDNQLDDE 911


>gi|192291247|ref|YP_001991852.1| DNA gyrase subunit A [Rhodopseudomonas palustris TIE-1]
 gi|192284996|gb|ACF01377.1| DNA gyrase, A subunit [Rhodopseudomonas palustris TIE-1]
          Length = 913

 Score = 1008 bits (2606), Expect = 0.0,   Method: Composition-based stats.
 Identities = 554/912 (60%), Positives = 688/912 (75%), Gaps = 8/912 (0%)

Query: 1   MTE--HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILF 58
           M++         +    I  VSI DEM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+
Sbjct: 1   MSDKDDEKPEGPQAPSDIRPVSILDEMKRSYLDYAMSVIVARALPDARDGLKPVHRRILY 60

Query: 59  GMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFG 118
           GM + G EWNK+Y K AR  G+V+GKYHPHG+ ++YDAL RMAQD+S+R+ LI+GQGNFG
Sbjct: 61  GMYENGFEWNKQYRKSARTVGDVIGKYHPHGDQSVYDALVRMAQDFSMRVPLIDGQGNFG 120

Query: 119 SVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNG 178
           SVDGD PAA RYTE RL K A  LLDD+ KDTVDF+PNYD S +EP VL A++PN+LVNG
Sbjct: 121 SVDGDMPAAMRYTESRLTKIAQTLLDDIDKDTVDFQPNYDNSEREPQVLPAKFPNLLVNG 180

Query: 179 GGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIK 238
            GGIAVGMATNIP HNLGEV+D C+A+ID+P + +D L +I+ GPDFPTG +ILGR GI+
Sbjct: 181 AGGIAVGMATNIPPHNLGEVIDACIALIDDPALSIDDLNKIVPGPDFPTGGIILGRAGIR 240

Query: 239 NAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIAD 298
            AY TGRGSIV+RG   IE    DRE I+V+EIPYQVNKA M+E+IAELVREK+I  I D
Sbjct: 241 AAYQTGRGSIVMRGKVEIETVRKDREAIIVSEIPYQVNKATMVERIAELVREKKIEGIGD 300

Query: 299 LRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGIL 358
           LRDESDR G+RVVIEL+R A  +V+LNQLY++T LQ+ F  NMVAL G +P+   L  +L
Sbjct: 301 LRDESDRDGFRVVIELRRDAVPEVVLNQLYKFTPLQTNFGANMVALEGGRPQLMNLKDLL 360

Query: 359 KAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELM 418
             FVAFRE+VV RRTK+LLNKARDRAH+LVGLAIAVAN+DE++R+IR SP+P TAR  LM
Sbjct: 361 TVFVAFREQVVTRRTKFLLNKARDRAHILVGLAIAVANIDEIIRVIRNSPDPNTARETLM 420

Query: 419 QRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELN 478
            R W A+D+  +I LIDD  + +  DGT  LS  Q +AIL+LRL RLT LGR++I  EL+
Sbjct: 421 SRDWPAADVAAMITLIDDPRHKLNPDGTARLSFEQAKAILDLRLQRLTALGREEISEELD 480

Query: 479 SLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDM 538
            L +EI + L+IL SR+R+  I+K EL  VK E  TPRRT I E   ++EDED I REDM
Sbjct: 481 KLAVEIADYLEILRSRARVQAIVKTELGEVKAEFATPRRTVIAEQEGEVEDEDLIQREDM 540

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           VVTVSH GYVKRVPLS YRAQRRGGKGRSG+  R+EDFV+ LF+ STHT VLFFSS G V
Sbjct: 541 VVTVSHAGYVKRVPLSTYRAQRRGGKGRSGMATREEDFVSRLFVASTHTPVLFFSSRGQV 600

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVR 658
           YKEKVWRLP+  P  RGKALINIL L QGERITTIMP PEDE+SW+ L V+FAT  GNVR
Sbjct: 601 YKEKVWRLPLAPPNGRGKALINILPLEQGERITTIMPLPEDEASWSELDVMFATTGGNVR 660

Query: 659 RNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAG 718
           RNKLSDF+ + RSG IAMKLD  + I+ V+ CT+ +D+LLT   GQC+RFP+  +RVF+G
Sbjct: 661 RNKLSDFVDVRRSGIIAMKLDEGEAIVDVQICTERDDVLLTAAGGQCIRFPVPDVRVFSG 720

Query: 719 RNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKND 778
           R S+GVRGI+L+ GD VIS++I+ H +A   ER  Y+K   A RR  +G+  E       
Sbjct: 721 RTSMGVRGIALSSGDTVISLSILRHFEATPAERSTYLKQSGAIRRAATGEENEPVETPEA 780

Query: 779 SSVEGN----ISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSK 834
            + EG+    +S+ER  E+   EQF+LT+SE G+GKRTSS+++R + R GKGI A  V+ 
Sbjct: 781 EAEEGDASAALSQERYAEMSASEQFVLTISENGYGKRTSSFEYRTTGRGGKGIVAMSVNS 840

Query: 835 INEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSV 894
            N  G LVA FPV D+DQI+LV+D G LIR PV  IR+A R+T+GV++F+TA DE+VVSV
Sbjct: 841 RN--GKLVASFPVEDSDQIMLVTDNGQLIRCPVEGIRVAGRSTQGVIVFNTADDEKVVSV 898

Query: 895 ERIRESEIVDEA 906
           ERI E++  +  
Sbjct: 899 ERIPETDDGENG 910


>gi|161610772|ref|NP_947941.2| DNA gyrase subunit A [Rhodopseudomonas palustris CGA009]
          Length = 913

 Score = 1008 bits (2605), Expect = 0.0,   Method: Composition-based stats.
 Identities = 554/912 (60%), Positives = 688/912 (75%), Gaps = 8/912 (0%)

Query: 1   MTE--HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILF 58
           M++         +    I  VSI DEM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+
Sbjct: 1   MSDKDDEKPEGPQAPSDIRPVSILDEMKRSYLDYAMSVIVARALPDARDGLKPVHRRILY 60

Query: 59  GMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFG 118
           GM + G EWNK+Y K AR  G+V+GKYHPHG+ ++YDAL RMAQD+S+R+ LI+GQGNFG
Sbjct: 61  GMYENGFEWNKQYRKSARTVGDVIGKYHPHGDQSVYDALVRMAQDFSMRVPLIDGQGNFG 120

Query: 119 SVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNG 178
           SVDGD PAA RYTE RL K A  LLDD+ KDTVDF+PNYD S +EP VL A++PN+LVNG
Sbjct: 121 SVDGDMPAAMRYTESRLTKIAQTLLDDIDKDTVDFQPNYDNSEREPQVLPAKFPNLLVNG 180

Query: 179 GGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIK 238
            GGIAVGMATNIP HNLGEV+D C+A+ID+P + +D L +I+ GPDFPTG +ILGR GI+
Sbjct: 181 AGGIAVGMATNIPPHNLGEVIDACIALIDDPALSIDDLNKIVPGPDFPTGGIILGRAGIR 240

Query: 239 NAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIAD 298
            AY TGRGSIV+RG   IE    DRE I+V+EIPYQVNKA M+E+IAELVREK+I  I D
Sbjct: 241 AAYQTGRGSIVMRGKVEIETVRKDREAIIVSEIPYQVNKATMVERIAELVREKKIEGIGD 300

Query: 299 LRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGIL 358
           LRDESDR G+RVVIEL+R A  +V+LNQLY++T LQ+ F  NMVAL G +P+   L  +L
Sbjct: 301 LRDESDRDGFRVVIELRRDAVPEVVLNQLYKFTPLQTNFGANMVALEGGRPQLMNLKDLL 360

Query: 359 KAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELM 418
             FVAFRE+VV RRTK+LLNKARDRAH+LVGLAIAVAN+DE++R+IR SP+P TAR  LM
Sbjct: 361 TVFVAFREQVVTRRTKFLLNKARDRAHILVGLAIAVANIDEIIRVIRNSPDPNTARETLM 420

Query: 419 QRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELN 478
            R W A+D+  +I LIDD  + +  DGT  LS  Q +AIL+LRL RLT LGR++I  EL+
Sbjct: 421 SRDWPAADVAAMITLIDDPRHKLNPDGTARLSFEQAKAILDLRLQRLTALGREEISEELD 480

Query: 479 SLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDM 538
            L +EI + L+IL SR+R+  I+K EL  VK E  TPRRT I E   ++EDED I REDM
Sbjct: 481 KLAVEIADYLEILRSRARVQAIVKTELGEVKAEFATPRRTVIAEQEGEVEDEDLIQREDM 540

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           VVTVSH GYVKRVPLS YRAQRRGGKGRSG+  R+EDFV+ LF+ STHT VLFFSS G V
Sbjct: 541 VVTVSHAGYVKRVPLSTYRAQRRGGKGRSGMATREEDFVSRLFVASTHTPVLFFSSRGQV 600

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVR 658
           YKEKVWRLP+  P  RGKALINIL L QGERITTIMP PEDE+SW+ L V+FAT  GNVR
Sbjct: 601 YKEKVWRLPLAPPNGRGKALINILPLEQGERITTIMPLPEDEASWSELDVMFATTGGNVR 660

Query: 659 RNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAG 718
           RNKLSDF+ + RSG IAMKLD  + I+ V+ CT+ +D+LLT   GQC+RFP+  +RVF+G
Sbjct: 661 RNKLSDFVDVRRSGIIAMKLDEGEAIVDVQICTERDDVLLTAAGGQCIRFPVPDVRVFSG 720

Query: 719 RNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKND 778
           R S+GVRGI+L+ GD VIS++I+ H +A   ER  Y+K   A RR  +G+  E       
Sbjct: 721 RTSMGVRGIALSSGDTVISLSILRHFEATPAERSTYLKQSGAIRRAATGEENEPVETPEA 780

Query: 779 SSVEGN----ISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSK 834
            + EG+    +S+ER  E+   EQF+LT+SE G+GKRTSS+++R + R GKGI A  V+ 
Sbjct: 781 EAEEGDTSAALSQERYAEMSASEQFVLTISENGYGKRTSSFEYRTTGRGGKGIVAMSVNS 840

Query: 835 INEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSV 894
            N  G LVA FPV D+DQI+LV+D G LIR PV  IR+A R+T+GV++F+TA DE+VVSV
Sbjct: 841 RN--GKLVASFPVEDSDQIMLVTDNGQLIRCPVEGIRVAGRSTQGVIVFNTADDEKVVSV 898

Query: 895 ERIRESEIVDEA 906
           ERI E++  +  
Sbjct: 899 ERIPETDDGENG 910


>gi|239831888|ref|ZP_04680217.1| DNA gyrase, A subunit [Ochrobactrum intermedium LMG 3301]
 gi|239824155|gb|EEQ95723.1| DNA gyrase, A subunit [Ochrobactrum intermedium LMG 3301]
          Length = 935

 Score = 1008 bits (2605), Expect = 0.0,   Method: Composition-based stats.
 Identities = 597/915 (65%), Positives = 732/915 (80%), Gaps = 10/915 (1%)

Query: 1   MTEHIISSDEEE--------EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPV 52
           M++       ++          GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPV
Sbjct: 1   MSDQTPPPGSDDMNGGPNGGPSGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPV 60

Query: 53  HRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIE 112
           HRRIL  M +M + +N+ Y K A + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  L++
Sbjct: 61  HRRILHAMNEMNLAYNRPYRKSAGVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLVD 120

Query: 113 GQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYP 172
           GQGNFGS+DGDPPAA RYTECRL+K +  +L D+ KDTVDF+ NYDG  QEPVV+ AR+P
Sbjct: 121 GQGNFGSIDGDPPAAMRYTECRLEKLSESILSDIDKDTVDFQDNYDGREQEPVVMPARFP 180

Query: 173 NVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVIL 232
           N+LVNG GGIAVGMATNIP HNLGEV+DGCVA+IDNP I+L  LMEII GPDFPTG +IL
Sbjct: 181 NLLVNGSGGIAVGMATNIPPHNLGEVIDGCVALIDNPAIELSELMEIIPGPDFPTGGIIL 240

Query: 233 GRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKR 292
           GR+GI +AY TGRGS+V+RG + IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KR
Sbjct: 241 GRSGINSAYTTGRGSVVMRGRATIEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKR 300

Query: 293 IVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERF 352
           I  I+DLRDESDR+GYRVV+ELKR A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ 
Sbjct: 301 IEGISDLRDESDREGYRVVVELKRDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQL 360

Query: 353 TLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPET 412
            L+ +L+AFV FREEVV RRTK+LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P T
Sbjct: 361 NLLDMLRAFVVFREEVVTRRTKFLLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPTT 420

Query: 413 ARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDD 472
           AR +LM+R W A+D+  LI LIDD  +TI  D T  LSE Q RAIL+LRL RLT LGRD+
Sbjct: 421 AREQLMERRWPAADVAPLIRLIDDPRHTINEDNTYNLSEEQARAILDLRLQRLTALGRDE 480

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDC 532
           + +ELN +G EI++ LDIL SR R++ I+K+E+++V+DE  TPRRT I  G  +M+DED 
Sbjct: 481 VADELNKIGEEIRDYLDILGSRLRVMTIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDL 540

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
           I REDMVVTVSH GY+KRVPL+ YRAQRRGGKGRSG+  +DEDFVT LF+ +THT VLFF
Sbjct: 541 IAREDMVVTVSHAGYIKRVPLTTYRAQRRGGKGRSGMATKDEDFVTRLFVANTHTPVLFF 600

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           SS G VYKEKVWRLP+G+PQ+RGKALIN+L L QGERITTIMP PEDE SW NL V+F+T
Sbjct: 601 SSRGIVYKEKVWRLPVGTPQSRGKALINMLPLQQGERITTIMPLPEDEDSWANLDVMFST 660

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPIS 711
             G VRRNKLSDF+Q+NR+GKIAMKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++
Sbjct: 661 TRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVT 720

Query: 712 AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT-E 770
            +RVFAGRNS+GVRGI+LA GD+VISMAI+ H DAD  ER  Y+K   A+RR    D  +
Sbjct: 721 DVRVFAGRNSIGVRGINLADGDKVISMAILHHVDADAAERSAYLKRSIAERRAQGADDAD 780

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
           +I  +  +   E  ++EER QELK +EQ +LTVSE G+GKR+SSY+FR+S R GKGIRAT
Sbjct: 781 DIVVVGEEVGNETELNEERYQELKAREQTVLTVSEYGYGKRSSSYEFRVSGRGGKGIRAT 840

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
           D SK +EIG LVA+FPV  +DQI+LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+
Sbjct: 841 DTSKTDEIGKLVALFPVESSDQILLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEK 900

Query: 891 VVSVERIRESEIVDE 905
           VVSVERI E++  +E
Sbjct: 901 VVSVERISETDSDEE 915



 Score = 52.9 bits (125), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 56/130 (43%), Gaps = 6/130 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFIQINR--SGKIAMKLDSRDEI---LSVETCTQENDILLT 699
              V+  +++G  +R+   +F    R   G  A      DEI   +++      + ILL 
Sbjct: 807 EQTVLTVSEYGYGKRSSSYEFRVSGRGGKGIRATDTSKTDEIGKLVALFPVESSDQILLV 866

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  GQ +R P+  IR  AGR++ GV   + A G++V+S+  +   D+D +          
Sbjct: 867 SDGGQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISETDSDEENGGEGDASPE 925

Query: 760 AQRRLISGDT 769
            +      + 
Sbjct: 926 GEAPAAGSEE 935


>gi|254704388|ref|ZP_05166216.1| DNA gyrase subunit A [Brucella suis bv. 3 str. 686]
          Length = 934

 Score = 1007 bits (2604), Expect = 0.0,   Method: Composition-based stats.
 Identities = 595/915 (65%), Positives = 730/915 (79%), Gaps = 10/915 (1%)

Query: 1   MTEHIISSDEEE--------EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPV 52
           M++       ++          GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPV
Sbjct: 1   MSDQTPPPGSDDMNGGPNGGPSGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPV 60

Query: 53  HRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIE 112
           HRRIL  M +M + +N+ Y K A + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+
Sbjct: 61  HRRILHAMNEMNLAYNRPYRKSAGVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLID 120

Query: 113 GQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYP 172
           GQGNFGS+DGDPPAA RYTECRL+K    LL D+ KDTV+F+ NYDG  QEPVVL AR+P
Sbjct: 121 GQGNFGSIDGDPPAAMRYTECRLEKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFP 180

Query: 173 NVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVIL 232
           N+LVNG GGIAVGMATNIP HNLGEV+DGCVA+IDNP I+L  LME+I GPDFPTG +IL
Sbjct: 181 NLLVNGSGGIAVGMATNIPPHNLGEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIIL 240

Query: 233 GRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKR 292
           GR GI +AY TGRGS+++RG + IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KR
Sbjct: 241 GRNGINSAYTTGRGSVIMRGRATIEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKR 300

Query: 293 IVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERF 352
           I  I+DLRDESDR+GYRVV+ELKR A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ 
Sbjct: 301 IDGISDLRDESDREGYRVVVELKRDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQL 360

Query: 353 TLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPET 412
           TL+ +L+AFVAFREEVV RRTK+LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P T
Sbjct: 361 TLLDMLRAFVAFREEVVTRRTKFLLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPAT 420

Query: 413 ARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDD 472
           AR +LM+R W A D+  LI LIDD  +T+  D T  LSE Q RAIL+LRL RLT LGRD+
Sbjct: 421 AREQLMERRWPAVDVAPLIRLIDDPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDE 480

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDC 532
           + +ELN +G EI++ LDIL SR R++ I+K+E+++V+DE  TPRRT I  G  +M+DED 
Sbjct: 481 VADELNKIGEEIRDYLDILGSRLRVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDL 540

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
           I REDMVVTVSH GY+KRVPL+ YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFF
Sbjct: 541 IAREDMVVTVSHAGYIKRVPLTTYRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFF 600

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           SS G VYKEKVWRLP+G+PQ+RGKALIN+L L QGERITTIMP PEDE  W NL V+F+T
Sbjct: 601 SSRGIVYKEKVWRLPVGTPQSRGKALINMLPLQQGERITTIMPLPEDEDFWANLDVMFST 660

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPIS 711
             G VRRNKLSDF+Q+NR+GKIAMKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++
Sbjct: 661 TRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVT 720

Query: 712 AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT-E 770
            +RVFAGRNS+GVRGI+LA+GD+VISMAI+ H DA   ER  Y+K   A+RR    D  +
Sbjct: 721 DVRVFAGRNSIGVRGINLAEGDKVISMAILHHVDATPAERSAYLKRSIAERRAQGADDAD 780

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
           +I  +  D   E  +SE+R QELK +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRAT
Sbjct: 781 DIVVVGEDVDAEAELSEDRYQELKAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRAT 840

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
           D SK +EIG LVA+FPV  +DQI+LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+
Sbjct: 841 DTSKTDEIGKLVALFPVEGSDQILLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEK 900

Query: 891 VVSVERIRESEIVDE 905
           VVSVERI +++  +E
Sbjct: 901 VVSVERISDADSDEE 915



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 50/295 (16%), Positives = 90/295 (30%), Gaps = 58/295 (19%)

Query: 530 EDCIVREDMVVTV-----SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVS 584
                 ED    +     +  G V+R  LS +    R GK    +    ++    +   +
Sbjct: 642 MPLPEDEDFWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDEI-LSVDTCT 700

Query: 585 THTSVLFFSSLGFVYK---------------------------------EKVWRLPIGSP 611
               VL   + G   +                                            
Sbjct: 701 EFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDKVISMAILHHVDATPAER 760

Query: 612 QARGKALINILSLNQGERITTIMPFPEDESSW----NNLY---------VVFATKHGNVR 658
            A  K  I        +    I+   ED  +      + Y         V+  ++ G  +
Sbjct: 761 SAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQELKAREETVLTVSEFGYGK 820

Query: 659 RNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVRFPISAI 713
           R+   +F        G  A      DEI   +++      + ILL +  GQ +R P+  I
Sbjct: 821 RSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDGGQLIRVPVDGI 880

Query: 714 RVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGD 768
           R  AGR++ GV   + A G++V+S+  +  AD+D +                + +
Sbjct: 881 R-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDTPAATQE 934


>gi|256044756|ref|ZP_05447660.1| DNA gyrase subunit A [Brucella melitensis bv. 1 str. Rev.1]
          Length = 934

 Score = 1007 bits (2603), Expect = 0.0,   Method: Composition-based stats.
 Identities = 595/915 (65%), Positives = 731/915 (79%), Gaps = 10/915 (1%)

Query: 1   MTEHIISSDEEE--------EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPV 52
           M++       ++          GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPV
Sbjct: 1   MSDQTPPPGSDDMNGGPNGGPSGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPV 60

Query: 53  HRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIE 112
           HRRIL  M +M + +N+ Y K A + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+
Sbjct: 61  HRRILHAMNEMNLAYNRPYRKSAGVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLID 120

Query: 113 GQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYP 172
           GQGNFGS+DGDPPAA RYTECRL+K    LL D+ KDTV+F+ NYDG  QEPVVL AR+P
Sbjct: 121 GQGNFGSIDGDPPAAMRYTECRLEKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFP 180

Query: 173 NVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVIL 232
           N+LVNG GGIAVGMATNIP HNLGEV+DGCVA+IDNP I+L  LME+I GPDFPTG +IL
Sbjct: 181 NLLVNGSGGIAVGMATNIPPHNLGEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIIL 240

Query: 233 GRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKR 292
           GR GI +AY TGRGS+++RG + IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KR
Sbjct: 241 GRNGINSAYTTGRGSVIMRGRATIEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKR 300

Query: 293 IVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERF 352
           I  I+DLRDESDR+GYRVV+ELKR A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ 
Sbjct: 301 IDGISDLRDESDREGYRVVVELKRDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQL 360

Query: 353 TLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPET 412
           TL+ +L+AFVAFREEVV RRTK+LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P T
Sbjct: 361 TLLDMLRAFVAFREEVVTRRTKFLLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPAT 420

Query: 413 ARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDD 472
           AR +LM+R W A D+  LI LIDD  +T+  D T  LSE Q RAIL+LRL RLT LGRD+
Sbjct: 421 AREQLMERRWPAVDVAPLIRLIDDPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDE 480

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDC 532
           + +ELN +G EI++ LDIL SR R++ I+K+E+++V+DE  TPRRT I  G  +M+DED 
Sbjct: 481 VADELNKIGEEIRDYLDILGSRLRVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDL 540

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
           I REDMVVTVSH GY+KRVPL+ YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFF
Sbjct: 541 IAREDMVVTVSHAGYIKRVPLTTYRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFF 600

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           SS G VYKEK+WRLP+G+PQ+RGKALIN+L L QGERITTIMP PEDE SW NL V+F+T
Sbjct: 601 SSRGIVYKEKLWRLPVGTPQSRGKALINMLPLQQGERITTIMPLPEDEDSWANLDVMFST 660

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPIS 711
             G VRRNKLSDF+Q+NR+GKIAMKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++
Sbjct: 661 TRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVT 720

Query: 712 AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT-E 770
            +RVFAGRNS+GVRGI+LA+GD+VISMAI+ H DA   ER  Y+K   A+RR    D  +
Sbjct: 721 DVRVFAGRNSIGVRGINLAEGDKVISMAILHHVDATPAERSAYLKRSIAERRAQGADDAD 780

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
           +I  +  D   E  +SE+R QELK +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRAT
Sbjct: 781 DIVVVGEDVDAEAELSEDRYQELKAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRAT 840

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
           D SK +EIG LVA+FPV  +DQI+LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+
Sbjct: 841 DTSKTDEIGKLVALFPVEGSDQILLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEK 900

Query: 891 VVSVERIRESEIVDE 905
           VVSVERI +++  +E
Sbjct: 901 VVSVERISDADSDEE 915



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 810 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 869

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 870 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 928

Query: 763 RLISGD 768
              + +
Sbjct: 929 PAATQE 934


>gi|189024253|ref|YP_001935021.1| DNA gyrase subunit A [Brucella abortus S19]
 gi|237815520|ref|ZP_04594517.1| DNA gyrase, A subunit [Brucella abortus str. 2308 A]
 gi|254697459|ref|ZP_05159287.1| DNA gyrase subunit A [Brucella abortus bv. 2 str. 86/8/59]
 gi|254706715|ref|ZP_05168543.1| DNA gyrase subunit A [Brucella pinnipedialis M163/99/10]
 gi|254710177|ref|ZP_05171988.1| DNA gyrase subunit A [Brucella pinnipedialis B2/94]
 gi|254714175|ref|ZP_05175986.1| DNA gyrase subunit A [Brucella ceti M644/93/1]
 gi|254730356|ref|ZP_05188934.1| DNA gyrase subunit A [Brucella abortus bv. 4 str. 292]
 gi|256031671|ref|ZP_05445285.1| DNA gyrase subunit A [Brucella pinnipedialis M292/94/1]
 gi|256113656|ref|ZP_05454467.1| DNA gyrase subunit A [Brucella melitensis bv. 3 str. Ether]
 gi|256159822|ref|ZP_05457559.1| DNA gyrase subunit A [Brucella ceti M490/95/1]
 gi|189019825|gb|ACD72547.1| DNA gyrase subunit A [Brucella abortus S19]
 gi|237788818|gb|EEP63029.1| DNA gyrase, A subunit [Brucella abortus str. 2308 A]
 gi|326409120|gb|ADZ66185.1| DNA gyrase subunit A [Brucella melitensis M28]
          Length = 934

 Score = 1007 bits (2602), Expect = 0.0,   Method: Composition-based stats.
 Identities = 596/915 (65%), Positives = 731/915 (79%), Gaps = 10/915 (1%)

Query: 1   MTEHIISSDEEE--------EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPV 52
           M++       ++          GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPV
Sbjct: 1   MSDQTPPPGSDDMNGGPNGGPSGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPV 60

Query: 53  HRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIE 112
           HRRIL  M +M + +N+ Y K A + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+
Sbjct: 61  HRRILHAMNEMNLAYNRPYRKSAGVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLID 120

Query: 113 GQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYP 172
           GQGNFGS+DGDPPAA RYTECRL+K    LL D+ KDTV+F+ NYDG  QEPVVL AR+P
Sbjct: 121 GQGNFGSIDGDPPAAMRYTECRLEKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFP 180

Query: 173 NVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVIL 232
           N+LVNG GGIAVGMATNIP HNLGEV+DGCVA+IDNP I+L  LME+I GPDFPTG +IL
Sbjct: 181 NLLVNGSGGIAVGMATNIPPHNLGEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIIL 240

Query: 233 GRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKR 292
           GR GI +AY TGRGS+++RG + IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KR
Sbjct: 241 GRNGINSAYTTGRGSVIMRGRATIEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKR 300

Query: 293 IVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERF 352
           I  I+DLRDESDR+GYRVV+ELKR A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ 
Sbjct: 301 IDGISDLRDESDREGYRVVVELKRDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQL 360

Query: 353 TLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPET 412
           TL+ +L+AFVAFREEVV RRTK+LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P T
Sbjct: 361 TLLDMLRAFVAFREEVVTRRTKFLLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPAT 420

Query: 413 ARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDD 472
           AR +LM+R W A D+  LI LIDD  +T+  D T  LSE Q RAIL+LRL RLT LGRD+
Sbjct: 421 AREQLMERRWPAVDVAPLIRLIDDPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDE 480

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDC 532
           + +ELN +G EI++ LDIL SR R++ I+K+E+++V+DE  TPRRT I  G  +M+DED 
Sbjct: 481 VADELNKIGEEIRDYLDILGSRLRVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDL 540

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
           I REDMVVTVSH GY+KRVPL+ YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFF
Sbjct: 541 IAREDMVVTVSHAGYIKRVPLTTYRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFF 600

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           SS G VYKEKVWRLP+G+PQ+RGKALIN+L L QGERITTIMP PEDE SW NL V+F+T
Sbjct: 601 SSRGIVYKEKVWRLPVGTPQSRGKALINMLPLQQGERITTIMPLPEDEDSWANLDVMFST 660

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPIS 711
             G VRRNKLSDF+Q+NR+GKIAMKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++
Sbjct: 661 TRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVT 720

Query: 712 AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT-E 770
            +RVFAGRNS+GVRGI+LA+GD+VISMAI+ H DA   ER  Y+K   A+RR    D  +
Sbjct: 721 DVRVFAGRNSIGVRGINLAEGDKVISMAILHHVDATPAERSAYLKRSIAERRAQGADDAD 780

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
           +I  +  D   E  +SE+R QELK +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRAT
Sbjct: 781 DIVVVGEDVDAEAELSEDRYQELKAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRAT 840

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
           D SK +EIG LVA+FPV  +DQI+LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+
Sbjct: 841 DTSKTDEIGKLVALFPVEGSDQILLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEK 900

Query: 891 VVSVERIRESEIVDE 905
           VVSVERI +++  +E
Sbjct: 901 VVSVERISDADSDEE 915



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 810 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 869

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 870 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 928

Query: 763 RLISGD 768
              + +
Sbjct: 929 PAATQE 934


>gi|254701844|ref|ZP_05163672.1| DNA gyrase subunit A [Brucella suis bv. 5 str. 513]
          Length = 934

 Score = 1006 bits (2601), Expect = 0.0,   Method: Composition-based stats.
 Identities = 596/915 (65%), Positives = 731/915 (79%), Gaps = 10/915 (1%)

Query: 1   MTEHIISSDEEE--------EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPV 52
           M++       ++          GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPV
Sbjct: 1   MSDQTPPPGSDDMNGGPNGGPSGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPV 60

Query: 53  HRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIE 112
           HRRIL  M +M + +N+ Y K A + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+
Sbjct: 61  HRRILHAMNEMNLAYNRPYRKSAGVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLID 120

Query: 113 GQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYP 172
           GQGNFGS+DGDPPAA RYTECRL+K    LL D+ KDTV+F+ NYDG  QEPVVL AR+P
Sbjct: 121 GQGNFGSIDGDPPAAMRYTECRLEKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFP 180

Query: 173 NVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVIL 232
           N+LVNG GGIAVGMATNIP HNLGEV+DGCVA+IDNP I+L  LME+I GPDFPTG +IL
Sbjct: 181 NLLVNGSGGIAVGMATNIPPHNLGEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIIL 240

Query: 233 GRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKR 292
           GR GI +AY TGRGS+++RG + IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KR
Sbjct: 241 GRNGINSAYTTGRGSVIMRGRATIEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKR 300

Query: 293 IVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERF 352
           I  I+DLRDESDR+GYRVV+ELKR A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ 
Sbjct: 301 IDGISDLRDESDREGYRVVVELKRDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQL 360

Query: 353 TLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPET 412
           TL+ +L+AFVAFREEVV RRTK+LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P T
Sbjct: 361 TLLDMLRAFVAFREEVVTRRTKFLLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPAT 420

Query: 413 ARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDD 472
           AR +LM+R W A D+  LI LIDD  +T+  D T  LSE Q RAIL+LRL RLT LGRD+
Sbjct: 421 AREQLMERRWPAVDVAPLIRLIDDPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDE 480

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDC 532
           + +ELN +G EI++ LDIL SR R++ I+K+E+++V+DE  TPRRT I  G  +M+DED 
Sbjct: 481 VADELNKIGEEIRDYLDILGSRLRVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDL 540

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
           I REDMVVTVSH GY+KRVPL+ YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFF
Sbjct: 541 IAREDMVVTVSHAGYIKRVPLTTYRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFF 600

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           SS G VYKEKVWRLP+G+PQ+RGKALIN+L L QGERITTIMP PEDE SW NL V+F+T
Sbjct: 601 SSRGIVYKEKVWRLPVGTPQSRGKALINMLPLQQGERITTIMPLPEDEDSWANLDVMFST 660

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPIS 711
             G VRRNKLSDF+Q+NR+GKIAMKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++
Sbjct: 661 TRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVT 720

Query: 712 AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT-E 770
            +RVFAGRNS+GVRGI+LA+GD+VISMAI+ H DA   ER  Y+K   A+RR    D  +
Sbjct: 721 DVRVFAGRNSIGVRGINLAEGDKVISMAILHHVDATPAERSAYLKRSIAERRAQGADDAD 780

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
           +I  +  D   E  +SE+R QELK +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRAT
Sbjct: 781 DIVVVGEDVDAEAELSEDRYQELKAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRAT 840

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
           D SK +EIG LVA+FPV  +DQI+LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+
Sbjct: 841 DTSKTDEIGKLVALFPVEGSDQILLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEK 900

Query: 891 VVSVERIRESEIVDE 905
           VVSVERI +++  +E
Sbjct: 901 VVSVERISDADSDEE 915



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 810 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 869

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 870 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEDDT 928

Query: 763 RLISGD 768
              + +
Sbjct: 929 PAATQE 934


>gi|162329639|ref|YP_469621.2| DNA gyrase subunit A [Rhizobium etli CFN 42]
          Length = 941

 Score = 1006 bits (2600), Expect = 0.0,   Method: Composition-based stats.
 Identities = 635/905 (70%), Positives = 754/905 (83%), Gaps = 1/905 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MTE       +   GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+GM
Sbjct: 1   MTEQTPPGGGKLPPGIEPISIMEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYGM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            ++G++WNKKYVKCAR++G+VMGKYHPHGNAAIYDALARMAQ WSLRL LI+GQGNFGSV
Sbjct: 61  SELGIDWNKKYVKCARVTGDVMGKYHPHGNAAIYDALARMAQPWSLRLPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAAERYTECRL+KAAH LLDDL K+TVDFR NYDG+  EPVV+ A++PN+LVNG G
Sbjct: 121 DGDPPAAERYTECRLEKAAHSLLDDLDKETVDFRDNYDGTLSEPVVVPAKFPNLLVNGAG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNL EV+DGC+A+I++P I+L  LM+II GPDFPTGA ILGR GI++A
Sbjct: 181 GIAVGMATNIPPHNLSEVIDGCIALINDPAIELPELMQIIPGPDFPTGAKILGRAGIRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGS+++RGV+ IE   GDREQI++TEIPYQVNKA M+EK+AELVREKRI  I+DLR
Sbjct: 241 YETGRGSVIMRGVATIEPMRGDREQIIITEIPYQVNKATMIEKMAELVREKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVVIELKR A+A+VILNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRQGYRVVIELKRDANAEVILNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FREEVV RRTK+LL KAR+RAHVLVGLAIAVAN+DEV+R+IR +P+P++AR ELM R
Sbjct: 361 FVSFREEVVSRRTKFLLRKARERAHVLVGLAIAVANIDEVIRVIRQAPDPQSAREELMTR 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D++ LI LIDD  + I  D T  LSE Q RAILELRLARLT LGRD+I +ELN +
Sbjct: 421 RWPAEDVESLIRLIDDPRHRINDDLTYNLSEEQARAILELRLARLTALGRDEIGDELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EI++ LDILSSR R+  I+K EL +V+DE  TPRRT IV+G L+M+DED I REDMVV
Sbjct: 481 GEEIRDYLDILSSRVRIQTIVKDELSAVRDEFGTPRRTEIVDGGLEMDDEDLIAREDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSHLGY+KRVPL+ YRAQRRGGKGRSG+  RDEDFV+ LF+V+THT VLFFSS G VYK
Sbjct: 541 TVSHLGYIKRVPLTTYRAQRRGGKGRSGMTTRDEDFVSRLFVVNTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+P +RGKALIN+L L  GERITTI+P PEDE+SW+NL V+F+T  G VRRN
Sbjct: 601 EKVWRLPIGTPTSRGKALINMLPLEPGERITTILPLPEDEASWDNLDVMFSTTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDF+Q+NR+GKIAMKL +  DEILSVETCT  +D+LLTT LGQC+RF +  +RVFAGR
Sbjct: 661 KLSDFVQVNRNGKIAMKLEEEGDEILSVETCTDRDDVLLTTALGQCIRFSVDDVRVFAGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NS+GVRGI+L +GD++ISM IV H DA+  ER  Y+K  +A+RR I  D E+I  +  + 
Sbjct: 721 NSIGVRGINLGEGDRIISMTIVGHVDAEPWERAAYLKRSAAERRAIGVDEEDIALVGEEV 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           + EG +S+ER +ELK +EQF+LTVSEKGFGKR+SSYDFRIS R GKGIRATD SK  EIG
Sbjct: 781 TEEGQLSDERYEELKAREQFVLTVSEKGFGKRSSSYDFRISGRGGKGIRATDTSKTGEIG 840

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FPV+D DQI+LVSD G LIRVPV  IRIASRATKGV IFSTAKDE+VVSVERI E
Sbjct: 841 ELVAAFPVDDGDQIMLVSDGGQLIRVPVGGIRIASRATKGVTIFSTAKDEKVVSVERISE 900

Query: 900 SEIVD 904
            E  D
Sbjct: 901 PEEDD 905



 Score = 51.7 bits (122), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 52/145 (35%), Gaps = 6/145 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFI-----QINRSGKIAMKLDSRDEILSVETCTQENDILLT 699
             +V+  ++ G  +R+   DF                K     E+++       + I+L 
Sbjct: 798 EQFVLTVSEKGFGKRSSSYDFRISGRGGKGIRATDTSKTGEIGELVAAFPVDDGDQIMLV 857

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  GQ +R P+  IR  A R + GV   S AK ++V+S+  +   + D  E        +
Sbjct: 858 SDGGQLIRVPVGGIR-IASRATKGVTIFSTAKDEKVVSVERISEPEEDDTEGAVDAAEAA 916

Query: 760 AQRRLISGDTEEITSLKNDSSVEGN 784
           A         E   +  +       
Sbjct: 917 AGADETPFADETPVADGDPGGAAEE 941


>gi|148560594|ref|YP_001259021.1| DNA gyrase subunit A [Brucella ovis ATCC 25840]
 gi|148371851|gb|ABQ61830.1| DNA gyrase, A subunit [Brucella ovis ATCC 25840]
          Length = 934

 Score = 1006 bits (2600), Expect = 0.0,   Method: Composition-based stats.
 Identities = 595/915 (65%), Positives = 730/915 (79%), Gaps = 10/915 (1%)

Query: 1   MTEHIISSDEEE--------EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPV 52
           M++       ++          GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPV
Sbjct: 1   MSDQTPPPGSDDMNGGPNGGPSGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPV 60

Query: 53  HRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIE 112
           HRRIL  M +M + +N+ Y K A + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+
Sbjct: 61  HRRILHAMNEMNLAYNRPYRKSAGVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLID 120

Query: 113 GQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYP 172
           GQGNFGS+DGDPPAA RYTECRL+K    LL D+ KDTV+F+ NYDG  QEPVVL AR+P
Sbjct: 121 GQGNFGSIDGDPPAAMRYTECRLEKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFP 180

Query: 173 NVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVIL 232
           N+LVNG GGIAVGMATNIP HNLGEV+DGCVA+IDNP I+L  LME+I GPDFPTG +IL
Sbjct: 181 NLLVNGSGGIAVGMATNIPPHNLGEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIIL 240

Query: 233 GRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKR 292
           GR GI +AY TG GS+++RG + IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KR
Sbjct: 241 GRNGINSAYTTGHGSVIMRGRATIEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKR 300

Query: 293 IVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERF 352
           I  I+DLRDESDR+GYRVV+ELKR A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ 
Sbjct: 301 IDGISDLRDESDREGYRVVVELKRDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQL 360

Query: 353 TLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPET 412
           TL+ +L+AFVAFREEVV RRTK+LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P T
Sbjct: 361 TLLDMLRAFVAFREEVVTRRTKFLLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPAT 420

Query: 413 ARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDD 472
           AR +LM+R W A D+  LI LIDD  +T+  D T  LSE Q RAIL+LRL RLT LGRD+
Sbjct: 421 AREQLMERRWPAVDVAPLIRLIDDPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDE 480

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDC 532
           + +ELN +G EI++ LDIL SR R++ I+K+E+++V+DE  TPRRT I  G  +M+DED 
Sbjct: 481 VADELNKIGEEIRDYLDILGSRLRVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDL 540

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
           I REDMVVTVSH GY+KRVPL+ YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFF
Sbjct: 541 IAREDMVVTVSHAGYIKRVPLTTYRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFF 600

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           SS G VYKEKVWRLP+G+PQ+RGKALIN+L L QGERITTIMP PEDE SW NL V+F+T
Sbjct: 601 SSRGIVYKEKVWRLPVGTPQSRGKALINMLPLQQGERITTIMPLPEDEDSWANLDVMFST 660

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPIS 711
             G VRRNKLSDF+Q+NR+GKIAMKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++
Sbjct: 661 TRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVT 720

Query: 712 AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT-E 770
            +RVFAGRNS+GVRGI+LA+GD+VISMAI+ H DA   ER  Y+K   A+RR    D  +
Sbjct: 721 DVRVFAGRNSIGVRGINLAEGDKVISMAILHHVDATPAERSAYLKRSIAERRAQGADDAD 780

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
           +I  +  D   E  +SE+R QELK +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRAT
Sbjct: 781 DIVVIGEDVDAEAELSEDRYQELKAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRAT 840

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
           D SK +EIG LVA+FPV  +DQI+LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+
Sbjct: 841 DTSKTDEIGKLVALFPVEGSDQILLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEK 900

Query: 891 VVSVERIRESEIVDE 905
           VVSVERI +++  +E
Sbjct: 901 VVSVERISDADSDEE 915



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 810 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 869

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 870 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 928

Query: 763 RLISGD 768
              + +
Sbjct: 929 PAATQE 934


>gi|254719163|ref|ZP_05180974.1| DNA gyrase subunit A [Brucella sp. 83/13]
 gi|306838155|ref|ZP_07471011.1| DNA gyrase, A subunit [Brucella sp. NF 2653]
 gi|306406745|gb|EFM62968.1| DNA gyrase, A subunit [Brucella sp. NF 2653]
          Length = 934

 Score = 1005 bits (2599), Expect = 0.0,   Method: Composition-based stats.
 Identities = 594/915 (64%), Positives = 729/915 (79%), Gaps = 10/915 (1%)

Query: 1   MTEHIISSDEEE--------EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPV 52
           M++       ++          GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPV
Sbjct: 1   MSDQTPPPGSDDMNGGPNGGPSGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPV 60

Query: 53  HRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIE 112
           HRRIL  M +M + +N+ Y K A + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+
Sbjct: 61  HRRILHAMNEMNLAYNRPYRKSAGVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLID 120

Query: 113 GQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYP 172
           GQGNFGS+DGDPPAA RYTECRL+K    LL D+ KDTV+F+ NYDG  QEPVVL AR+P
Sbjct: 121 GQGNFGSIDGDPPAAMRYTECRLEKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFP 180

Query: 173 NVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVIL 232
           N+LVNG GGIAVGMATNIP HNLGEV+DGCVA+IDNP I+L  LME+I GPDFPTG +IL
Sbjct: 181 NLLVNGSGGIAVGMATNIPPHNLGEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIIL 240

Query: 233 GRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKR 292
           GR GI +AY TGRGS+++RG + IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KR
Sbjct: 241 GRNGINSAYTTGRGSVIMRGRATIEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKR 300

Query: 293 IVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERF 352
           I  I+DLRDESDR+GYRVV+ELKR A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ 
Sbjct: 301 IDGISDLRDESDREGYRVVVELKRDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQL 360

Query: 353 TLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPET 412
           TL+ +L+AFVAFREEVV RRTK+LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P T
Sbjct: 361 TLLDMLRAFVAFREEVVTRRTKFLLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPAT 420

Query: 413 ARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDD 472
           AR +LM+R W A D+  LI LIDD  +T+  D T  LSE Q RAIL+LRL RLT LGRD+
Sbjct: 421 AREQLMERRWPAVDVAPLIRLIDDPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDE 480

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDC 532
           + +ELN +G EI++ LDIL SR R++ I+K+E+++V+DE  TPRRT I  G  +M+DED 
Sbjct: 481 VADELNKIGEEIRDYLDILGSRLRVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDL 540

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
           I REDMVVTVSH GY+KRVPL+ YRAQRRGGKGRSG+  ++EDFVT LF+ ++HT VLFF
Sbjct: 541 IAREDMVVTVSHAGYIKRVPLTTYRAQRRGGKGRSGMTTKEEDFVTRLFVANSHTPVLFF 600

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           SS G VYKEKVWRLP+G+PQ+RGKALIN+L L QGERITTIMP PEDE SW NL V+F+T
Sbjct: 601 SSRGIVYKEKVWRLPVGTPQSRGKALINMLPLQQGERITTIMPLPEDEDSWANLDVMFST 660

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPIS 711
             G VRRNKLSDF+Q+NR+GKIAMKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++
Sbjct: 661 TRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVT 720

Query: 712 AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT-E 770
            +RVFAGRNS+GVRGI LA+GD+VISMAI+ H DA   ER  Y+K   A+RR    D  +
Sbjct: 721 DVRVFAGRNSIGVRGIKLAEGDKVISMAILHHVDATPAERSAYLKRSIAERRAQGADDAD 780

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
           +I  +  D   E  +SE+R QELK +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRAT
Sbjct: 781 DIVVVGEDVDAEAELSEDRYQELKAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRAT 840

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
           D SK +EIG LVA+FPV  +DQI+LVSD G LIRVPV+ IRIA R+TKGV IF+ A  E+
Sbjct: 841 DTSKTDEIGKLVALFPVEGSDQILLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNMADGEK 900

Query: 891 VVSVERIRESEIVDE 905
           VVSVERI +++  +E
Sbjct: 901 VVSVERISDADSDEE 915



 Score = 54.8 bits (130), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 56/126 (44%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 810 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 869

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   ++A G++V+S+  +  AD+D +             
Sbjct: 870 GQLIRVPVDGIR-IAGRSTKGVTIFNMADGEKVVSVERISDADSDEENGNGGDAAPEGDT 928

Query: 763 RLISGD 768
              + +
Sbjct: 929 PAATQE 934


>gi|306843965|ref|ZP_07476560.1| DNA gyrase, A subunit [Brucella sp. BO1]
 gi|306275720|gb|EFM57444.1| DNA gyrase, A subunit [Brucella sp. BO1]
          Length = 934

 Score = 1005 bits (2598), Expect = 0.0,   Method: Composition-based stats.
 Identities = 595/915 (65%), Positives = 730/915 (79%), Gaps = 10/915 (1%)

Query: 1   MTEHIISSDEEE--------EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPV 52
           M++       ++          GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPV
Sbjct: 1   MSDQTPPPGSDDMNGGPNGGPSGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPV 60

Query: 53  HRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIE 112
           HRRIL  M +M + +N+ Y K A + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+
Sbjct: 61  HRRILHAMNEMNLAYNRPYRKSAGVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLID 120

Query: 113 GQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYP 172
           GQGNFGS+DGDPPAA RYTECRL+K    LL D+ KDTV+F+ NYDG  QEPVVL AR+P
Sbjct: 121 GQGNFGSIDGDPPAAMRYTECRLEKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFP 180

Query: 173 NVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVIL 232
           N+LVNG GGIAVGMATNIP HNLGEV+DGCVA+IDNP I+L  LME+I GPDFPTG +IL
Sbjct: 181 NLLVNGSGGIAVGMATNIPPHNLGEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIIL 240

Query: 233 GRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKR 292
           GR GI +AY TGRGS+++RG + IE   GDRE I++TEI YQVNKA+M+EK+AELVR+KR
Sbjct: 241 GRNGINSAYTTGRGSVIMRGRATIEPMRGDREAIIITEISYQVNKASMIEKMAELVRDKR 300

Query: 293 IVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERF 352
           I  I+DLRDESDR+GYRVV+ELKR A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ 
Sbjct: 301 IDGISDLRDESDREGYRVVVELKRDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQL 360

Query: 353 TLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPET 412
           TL+ +L+AFVAFREEVV RRTK+LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P T
Sbjct: 361 TLLDMLRAFVAFREEVVTRRTKFLLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPAT 420

Query: 413 ARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDD 472
           AR +LM+R W A D+  LI LIDD  +T+  D T  LSE Q RAIL+LRL RLT LGRD+
Sbjct: 421 AREQLMERRWPAVDVAPLIRLIDDPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDE 480

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDC 532
           + +ELN +G EI++ LDIL SR R++ I+K+E+++V+DE  TPRRT I  G  +M+DED 
Sbjct: 481 VADELNKIGEEIRDYLDILGSRLRVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDL 540

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
           I REDMVVTVSH GY+KRVPL+ YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFF
Sbjct: 541 IAREDMVVTVSHAGYIKRVPLTTYRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFF 600

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           SS G VYKEKVWRLP+G+PQ+RGKALIN+L L QGERITTIMP PEDE SW NL V+F+T
Sbjct: 601 SSRGIVYKEKVWRLPVGTPQSRGKALINMLPLQQGERITTIMPLPEDEDSWANLDVMFST 660

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPIS 711
             G VRRNKLSDF+Q+NR+GKIAMKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++
Sbjct: 661 TRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVT 720

Query: 712 AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT-E 770
            +RVFAGRNS+GVRGI+LA+GD+VISMAI+ H DA   ER  Y+K   A+RR    D  +
Sbjct: 721 DVRVFAGRNSIGVRGINLAEGDKVISMAILHHVDATPAERSAYLKRSIAERRAQGADDAD 780

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
           +I  +  D   E  +SE+R QELK +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRAT
Sbjct: 781 DIVVVGEDVDAEAELSEDRYQELKAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRAT 840

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
           D SK +EIG LVA+FPV  +DQI+LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+
Sbjct: 841 DTSKTDEIGKLVALFPVEGSDQILLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEK 900

Query: 891 VVSVERIRESEIVDE 905
           VVSVERI +++  +E
Sbjct: 901 VVSVERISDADSDEE 915



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 810 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 869

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 870 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 928

Query: 763 RLISGD 768
              + +
Sbjct: 929 PAATQE 934


>gi|256061183|ref|ZP_05451335.1| DNA gyrase subunit A [Brucella neotomae 5K33]
          Length = 934

 Score = 1005 bits (2598), Expect = 0.0,   Method: Composition-based stats.
 Identities = 594/915 (64%), Positives = 730/915 (79%), Gaps = 10/915 (1%)

Query: 1   MTEHIISSDEEE--------EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPV 52
           M++       ++          GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPV
Sbjct: 1   MSDQTPPPGSDDMNGGPNGGPSGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPV 60

Query: 53  HRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIE 112
           HRRIL  M +M + +N+ Y K A + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+
Sbjct: 61  HRRILHAMNEMNLAYNRPYRKSAGVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLID 120

Query: 113 GQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYP 172
           GQGNFGS+DGDPPAA RYTECRL+K    LL D+ KDTV+F+ NYDG  QEPVVL AR+P
Sbjct: 121 GQGNFGSIDGDPPAAMRYTECRLEKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFP 180

Query: 173 NVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVIL 232
           N+LVNG GGIAVGMATNIP HNLGEV+DGCVA+IDNP I+L  LME+I GPDFPTG +IL
Sbjct: 181 NLLVNGSGGIAVGMATNIPPHNLGEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIIL 240

Query: 233 GRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKR 292
           GR GI +AY TGRGS+++RG + IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KR
Sbjct: 241 GRNGINSAYTTGRGSVIMRGRATIEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKR 300

Query: 293 IVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERF 352
           I  I+DLRDESDR+GYRVV+ELKR A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ 
Sbjct: 301 IDGISDLRDESDREGYRVVVELKRDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQL 360

Query: 353 TLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPET 412
           TL+ +L+AFVAFREEVV RRTK+LLNKARDRAH+LVGLAIAVAN+DEV+ +IR +P+P T
Sbjct: 361 TLLDMLRAFVAFREEVVTRRTKFLLNKARDRAHMLVGLAIAVANIDEVIALIRRAPDPAT 420

Query: 413 ARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDD 472
           AR +LM+R W A D+  LI LIDD  +T+  D T  LSE Q RAIL+LRL RLT LGRD+
Sbjct: 421 AREQLMERRWPAVDVAPLIRLIDDPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDE 480

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDC 532
           + +ELN +G EI++ LDIL SR R++ I+K+E+++V+DE  TPRRT I  G  +M+DED 
Sbjct: 481 VADELNKIGEEIRDYLDILGSRLRVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDL 540

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
           I REDMVVTVSH GY+KRVPL+ YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFF
Sbjct: 541 IAREDMVVTVSHAGYIKRVPLTTYRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFF 600

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           SS G VYKEKVWRLP+G+PQ+RGKALIN+L L QGERITTIMP PEDE SW NL V+F+T
Sbjct: 601 SSRGIVYKEKVWRLPVGTPQSRGKALINMLPLQQGERITTIMPLPEDEDSWANLDVMFST 660

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPIS 711
             G VRRNKLSDF+Q+NR+GKIAMKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++
Sbjct: 661 TRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVT 720

Query: 712 AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT-E 770
            +RVFAGRNS+GVRGI+LA+GD+VISMAI+ H DA   ER  Y+K   A+RR    D  +
Sbjct: 721 DVRVFAGRNSIGVRGINLAEGDKVISMAILHHVDATPAERSAYLKRSIAERRAQGADDAD 780

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
           +I  +  D   E  +SE+R QELK +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRAT
Sbjct: 781 DIVVVGEDVDAEAELSEDRYQELKAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRAT 840

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
           D  K +EIG LVA+FPV  +DQI+LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+
Sbjct: 841 DTLKTDEIGKLVALFPVEGSDQILLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEK 900

Query: 891 VVSVERIRESEIVDE 905
           VVSVERI +++  +E
Sbjct: 901 VVSVERISDADSDEE 915



 Score = 54.8 bits (130), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDFI-----QINRSGKIAMKLDSRDEILSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F               +K D   +++++      + ILL +  
Sbjct: 810 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTLKTDEIGKLVALFPVEGSDQILLVSDG 869

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 870 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 928

Query: 763 RLISGD 768
              + +
Sbjct: 929 PAATQE 934


>gi|225627572|ref|ZP_03785609.1| DNA gyrase, A subunit [Brucella ceti str. Cudo]
 gi|225617577|gb|EEH14622.1| DNA gyrase, A subunit [Brucella ceti str. Cudo]
          Length = 934

 Score = 1004 bits (2595), Expect = 0.0,   Method: Composition-based stats.
 Identities = 595/915 (65%), Positives = 731/915 (79%), Gaps = 10/915 (1%)

Query: 1   MTEHIISSDEEE--------EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPV 52
           M++       ++          GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPV
Sbjct: 1   MSDQTPPPGSDDMNGGPNGGPSGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPV 60

Query: 53  HRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIE 112
           HRRIL  M +M + +N+ Y K A + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+
Sbjct: 61  HRRILHAMNEMNLAYNRPYRKSAGVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLID 120

Query: 113 GQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYP 172
           GQGNFGS+DGDPPAA RYTECRL+K    LL D+ KDTV+F+ NYDG  QEPVV+ AR+P
Sbjct: 121 GQGNFGSIDGDPPAAMRYTECRLEKVTESLLSDIDKDTVNFQDNYDGREQEPVVVPARFP 180

Query: 173 NVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVIL 232
           N+LVNG GGIAVGMATNIP HNLGEV+DGCVA+IDNP I+L  LME+I GPDFPTG +IL
Sbjct: 181 NLLVNGSGGIAVGMATNIPPHNLGEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIIL 240

Query: 233 GRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKR 292
           GR GI +AY TGRGS+++RG + IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KR
Sbjct: 241 GRNGINSAYTTGRGSVIMRGRATIEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKR 300

Query: 293 IVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERF 352
           I  I+DLRDESDR+GYRVV+ELKR A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ 
Sbjct: 301 IDGISDLRDESDREGYRVVVELKRDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQL 360

Query: 353 TLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPET 412
           TL+ +L+AFVAFREEVV RRTK+LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P T
Sbjct: 361 TLLDMLRAFVAFREEVVTRRTKFLLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPAT 420

Query: 413 ARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDD 472
           AR +LM+R W A D+  LI LIDD  +T+  D T  LSE Q RAIL+LRL RLT LGRD+
Sbjct: 421 AREQLMERRWPAVDVAPLIRLIDDPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDE 480

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDC 532
           + +ELN +G EI++ LDIL SR R++ I+K+E+++V+DE  TPRRT I  G  +M+DED 
Sbjct: 481 VADELNKIGEEIRDYLDILGSRLRVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDL 540

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
           I REDMVVTVSH GY+KRVPL+ YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFF
Sbjct: 541 IAREDMVVTVSHAGYIKRVPLTTYRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFF 600

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           SS G VYKEKVWRLP+G+PQ+RGKALIN+L L QGERITTIMP PEDE SW NL V+F+T
Sbjct: 601 SSRGIVYKEKVWRLPVGTPQSRGKALINMLPLQQGERITTIMPLPEDEDSWANLDVMFST 660

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPIS 711
             G VRRNKLSDF+Q+NR+GKIAMKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++
Sbjct: 661 TRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVT 720

Query: 712 AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT-E 770
            +RVFAGRNS+GVRGI+LA+GD+VISMAI+ H DA   ER  Y+K   A+RR    D  +
Sbjct: 721 DVRVFAGRNSIGVRGINLAEGDKVISMAILHHVDATPAERSAYLKRSIAERRAQGADDAD 780

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
           +I  +  D   E  +SE+R QELK +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRAT
Sbjct: 781 DIVVVGEDVDAEAELSEDRYQELKAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRAT 840

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
           D SK +EIG LVA+FPV  +DQI+LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+
Sbjct: 841 DTSKTDEIGKLVALFPVEGSDQILLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEK 900

Query: 891 VVSVERIRESEIVDE 905
           VVSVERI +++  +E
Sbjct: 901 VVSVERISDADSDEE 915



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 810 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 869

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 870 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 928

Query: 763 RLISGD 768
              + +
Sbjct: 929 PAATQE 934


>gi|256255073|ref|ZP_05460609.1| DNA gyrase subunit A [Brucella ceti B1/94]
          Length = 934

 Score = 1003 bits (2593), Expect = 0.0,   Method: Composition-based stats.
 Identities = 595/915 (65%), Positives = 730/915 (79%), Gaps = 10/915 (1%)

Query: 1   MTEHIISSDEEE--------EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPV 52
           M++       ++          GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPV
Sbjct: 1   MSDQTPPPGSDDMNGGPNGGPSGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPV 60

Query: 53  HRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIE 112
           HRRIL  M +M + +N+ Y K A + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+
Sbjct: 61  HRRILHAMNEMNLAYNRPYRKSAGVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLID 120

Query: 113 GQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYP 172
           GQGNFGS+DGDPPAA RYTECRL+K    LL D+ KDTV+F+ NYDG  QEPVVL AR+P
Sbjct: 121 GQGNFGSIDGDPPAAMRYTECRLEKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFP 180

Query: 173 NVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVIL 232
           N+LVNG GGIAVGMATNI  HNLGEV+DGCVA+IDNP I+L  LME+I GPDFPTG +IL
Sbjct: 181 NLLVNGSGGIAVGMATNILPHNLGEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIIL 240

Query: 233 GRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKR 292
           GR GI +AY TGRGS+++RG + IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KR
Sbjct: 241 GRNGINSAYTTGRGSVIMRGRATIEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKR 300

Query: 293 IVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERF 352
           I  I+DLRDESDR+GYRVV+ELKR A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ 
Sbjct: 301 IDGISDLRDESDREGYRVVVELKRDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQL 360

Query: 353 TLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPET 412
           TL+ +L+AFVAFREEVV RRTK+LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P T
Sbjct: 361 TLLDMLRAFVAFREEVVTRRTKFLLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPAT 420

Query: 413 ARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDD 472
           AR +LM+R W A D+  LI LIDD  +T+  D T  LSE Q RAIL+LRL RLT LGRD+
Sbjct: 421 AREQLMERRWPAVDVAPLIRLIDDPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDE 480

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDC 532
           + +ELN +G EI++ LDIL SR R++ I+K+E+++V+DE  TPRRT I  G  +M+DED 
Sbjct: 481 VADELNKIGEEIRDYLDILGSRLRVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDL 540

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
           I REDMVVTVSH GY+KRVPL+ YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFF
Sbjct: 541 IAREDMVVTVSHAGYIKRVPLTTYRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFF 600

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           SS G VYKEKVWRLP+G+PQ+RGKALIN+L L QGERITTIMP PEDE SW NL V+F+T
Sbjct: 601 SSRGIVYKEKVWRLPVGTPQSRGKALINMLPLQQGERITTIMPLPEDEDSWANLDVMFST 660

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPIS 711
             G VRRNKLSDF+Q+NR+GKIAMKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++
Sbjct: 661 TRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVT 720

Query: 712 AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT-E 770
            +RVFAGRNS+GVRGI+LA+GD+VISMAI+ H DA   ER  Y+K   A+RR    D  +
Sbjct: 721 DVRVFAGRNSIGVRGINLAEGDKVISMAILHHVDATPAERSAYLKRSIAERRAQGADDAD 780

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
           +I  +  D   E  +SE+R QELK +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRAT
Sbjct: 781 DIVVVGEDVDAEAELSEDRYQELKAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRAT 840

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
           D SK +EIG LVA+FPV  +DQI+LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+
Sbjct: 841 DTSKTDEIGKLVALFPVEGSDQILLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEK 900

Query: 891 VVSVERIRESEIVDE 905
           VVSVERI +++  +E
Sbjct: 901 VVSVERISDADSDEE 915



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 810 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 869

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 870 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 928

Query: 763 RLISGD 768
              + +
Sbjct: 929 PAATQE 934


>gi|163868581|ref|YP_001609790.1| DNA gyrase subunit A [Bartonella tribocorum CIP 105476]
 gi|161018237|emb|CAK01795.1| DNA gyrase subunit A [Bartonella tribocorum CIP 105476]
          Length = 916

 Score = 1003 bits (2592), Expect = 0.0,   Method: Composition-based stats.
 Identities = 588/900 (65%), Positives = 714/900 (79%), Gaps = 3/900 (0%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
            GI  +SI DEMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M +MG+ +NK Y K
Sbjct: 3   SGIEPISIIDEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAMNEMGLVFNKPYRK 62

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            A + GEVMGK+HPHG+A+IYDAL RMAQD+SLR  LI+GQGNFGSVDGDPPAA RYTEC
Sbjct: 63  SAGVVGEVMGKFHPHGDASIYDALVRMAQDFSLRNPLIDGQGNFGSVDGDPPAAMRYTEC 122

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           RL+K +  LL D+ KDTVDF+ NYDG  +EPVVL AR+PN+LVNG GGIAVGMATNIP H
Sbjct: 123 RLEKVSEELLADIDKDTVDFQDNYDGREREPVVLPARFPNLLVNGSGGIAVGMATNIPPH 182

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NL EVVDGC+A+IDNPDI LD ++EII GPDFPTG +ILGR+G+++AY TGRGSI++R  
Sbjct: 183 NLSEVVDGCIALIDNPDITLDQIIEIIPGPDFPTGGIILGRSGVRSAYETGRGSIIMRAK 242

Query: 254 SHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
             IE+    R+ I+V+EIPYQVNKA M+EK+AELVR+KRI  I+DLRDESDR GYRVVIE
Sbjct: 243 VDIEEIRSGRQAIIVSEIPYQVNKATMIEKMAELVRDKRIEGISDLRDESDRDGYRVVIE 302

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           LK+   A+V+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFVAFREEVV RRT
Sbjct: 303 LKKDVVAEVVLNQLYRYTPLQTSFGCNMVALNGGKPEQMTLLDMLRAFVAFREEVVSRRT 362

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
           KYLL KAR+RAHVLVGLA+AVAN+DE++ +IR +P+P+TAR +LM+R W A D+  LI L
Sbjct: 363 KYLLRKARERAHVLVGLALAVANIDEIIALIRKAPDPQTARAQLMERRWPAMDVAPLIKL 422

Query: 434 IDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSS 493
           IDD  + I  DGT  LSE Q RAILELRL RLT LGRD+I +ELN +G++I + LDIL+S
Sbjct: 423 IDDPRHIIHEDGTYNLSEEQARAILELRLQRLTALGRDEIADELNKIGVDIADYLDILAS 482

Query: 494 RSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPL 553
           R R++ I+K EL ++++E  TPRRT    G  +ME ED I  EDMVVTVSH GY+KRVPL
Sbjct: 483 RVRIMHIVKDELSALREEFATPRRTVFGFGSAEMESEDLIAPEDMVVTVSHSGYIKRVPL 542

Query: 554 SVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQA 613
           + YRAQRRGGKGRSG+  +DEDFVT LF+ +THT VLFFSS G VYKEKVWRLP+G+PQ+
Sbjct: 543 NTYRAQRRGGKGRSGMSTKDEDFVTRLFVANTHTPVLFFSSRGIVYKEKVWRLPLGTPQS 602

Query: 614 RGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGK 673
           RG+ALIN+L L QGERITTIMP PEDE+SW+ L ++FAT  G VRRNKLSDF+Q+NR+GK
Sbjct: 603 RGRALINMLPLQQGERITTIMPLPEDEASWSALDIMFATTRGTVRRNKLSDFVQVNRNGK 662

Query: 674 IAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGD 733
           IAMKLD  DEILSVETCT+ +D++LTT  GQC+RFP+  +RVFAGRNSVGVRGI+LAKGD
Sbjct: 663 IAMKLDEEDEILSVETCTEHDDVVLTTANGQCIRFPVLDVRVFAGRNSVGVRGINLAKGD 722

Query: 734 QVISMAIVLHADADYDERICYMKHMSAQRRLISGD---TEEITSLKNDSSVEGNISEERC 790
           +VISM I+ H +A   ER  Y+K +  +RR    D    + I+  + D   E ++++ER 
Sbjct: 723 KVISMTILEHVEATSFERSAYIKRVMNERRAAGADADVEDIISLDEEDGGGETDLTDERY 782

Query: 791 QELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDN 850
            EL  +EQ +LTVSE G+GKR+SSY+FRIS R GKGIRATD SK  EIG LVA FPV   
Sbjct: 783 AELHAREQMLLTVSEFGYGKRSSSYEFRISGRGGKGIRATDPSKTAEIGKLVAAFPVKAQ 842

Query: 851 DQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAESTE 910
           DQI+LVSD G LIRVPV  IR A R+TKGV IF+TA+ ERVVSVERI E E    +   E
Sbjct: 843 DQIMLVSDGGQLIRVPVEGIRTAGRSTKGVTIFNTAEGERVVSVERISEPEDDTRSLEDE 902



 Score = 59.0 bits (141), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 89/246 (36%), Gaps = 9/246 (3%)

Query: 528 EDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHT 587
             E C   +D+V+T +  G   R P+   R     G+   GV   +      +  ++   
Sbjct: 675 SVETCTEHDDVVLT-TANGQCIRFPVLDVRV--FAGRNSVGVRGINLAKGDKVISMTILE 731

Query: 588 SVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLY 647
            V   S     Y ++V      +        I  L    G   T +      E       
Sbjct: 732 HVEATSFERSAYIKRVMNERRAAGADADVEDIISLDEEDGGGETDLTDERYAELHAREQM 791

Query: 648 VVFATKHGNVRRNKLSDFI-QINRSGKIAM----KLDSRDEILSVETCTQENDILLTTKL 702
           ++  ++ G  +R+   +F         I      K     ++++      ++ I+L +  
Sbjct: 792 LLTVSEFGYGKRSSSYEFRISGRGGKGIRATDPSKTAEIGKLVAAFPVKAQDQIMLVSDG 851

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A+G++V+S+  +   + D        +  S   
Sbjct: 852 GQLIRVPVEGIRT-AGRSTKGVTIFNTAEGERVVSVERISEPEDDTRSLEDEGEKHSDIV 910

Query: 763 RLISGD 768
            +   +
Sbjct: 911 NMSEEE 916


>gi|23501975|ref|NP_698102.1| DNA gyrase subunit A [Brucella suis 1330]
 gi|261755064|ref|ZP_05998773.1| DNA gyrase subunit A [Brucella suis bv. 3 str. 686]
 gi|23347924|gb|AAN30017.1| DNA gyrase, A subunit [Brucella suis 1330]
 gi|261744817|gb|EEY32743.1| DNA gyrase subunit A [Brucella suis bv. 3 str. 686]
          Length = 922

 Score = 1003 bits (2592), Expect = 0.0,   Method: Composition-based stats.
 Identities = 593/892 (66%), Positives = 724/892 (81%), Gaps = 2/892 (0%)

Query: 16  ITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCA 75
           I  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M +M + +N+ Y K A
Sbjct: 12  IEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAMNEMNLAYNRPYRKSA 71

Query: 76  RISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRL 135
            + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+GQGNFGS+DGDPPAA RYTECRL
Sbjct: 72  GVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLIDGQGNFGSIDGDPPAAMRYTECRL 131

Query: 136 QKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNL 195
           +K    LL D+ KDTV+F+ NYDG  QEPVVL AR+PN+LVNG GGIAVGMATNIP HNL
Sbjct: 132 EKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFPNLLVNGSGGIAVGMATNIPPHNL 191

Query: 196 GEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSH 255
           GEV+DGCVA+IDNP I+L  LME+I GPDFPTG +ILGR GI +AY TGRGS+++RG + 
Sbjct: 192 GEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIILGRNGINSAYTTGRGSVIMRGRAT 251

Query: 256 IEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELK 315
           IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KRI  I+DLRDESDR+GYRVV+ELK
Sbjct: 252 IEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKRIDGISDLRDESDREGYRVVVELK 311

Query: 316 RGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKY 375
           R A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFVAFREEVV RRTK+
Sbjct: 312 RDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRAFVAFREEVVTRRTKF 371

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
           LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P TAR +LM+R W A D+  LI LID
Sbjct: 372 LLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPATAREQLMERRWPAVDVAPLIRLID 431

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRS 495
           D  +T+  D T  LSE Q RAIL+LRL RLT LGRD++ +ELN +G EI++ LDIL SR 
Sbjct: 432 DPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDEVADELNKIGEEIRDYLDILGSRL 491

Query: 496 RLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSV 555
           R++ I+K+E+++V+DE  TPRRT I  G  +M+DED I REDMVVTVSH GY+KRVPL+ 
Sbjct: 492 RVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDLIAREDMVVTVSHAGYIKRVPLTT 551

Query: 556 YRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARG 615
           YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFFSS G VYKEKVWRLP+G+PQ+RG
Sbjct: 552 YRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFFSSRGIVYKEKVWRLPVGTPQSRG 611

Query: 616 KALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIA 675
           KALIN+L L QGERITTIMP PEDE  W NL V+F+T  G VRRNKLSDF+Q+NR+GKIA
Sbjct: 612 KALINMLPLQQGERITTIMPLPEDEDFWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIA 671

Query: 676 MKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQ 734
           MKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++ +RVFAGRNS+GVRGI+LA+GD+
Sbjct: 672 MKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDK 731

Query: 735 VISMAIVLHADADYDERICYMKHMSAQRRLISGDT-EEITSLKNDSSVEGNISEERCQEL 793
           VISMAI+ H DA   ER  Y+K   A+RR    D  ++I  +  D   E  +SE+R QEL
Sbjct: 732 VISMAILHHVDATPAERSAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQEL 791

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
           K +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRATD SK +EIG LVA+FPV  +DQI
Sbjct: 792 KAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQI 851

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           +LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+VVSVERI +++  +E
Sbjct: 852 LLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEKVVSVERISDADSDEE 903



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 50/295 (16%), Positives = 90/295 (30%), Gaps = 58/295 (19%)

Query: 530 EDCIVREDMVVTV-----SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVS 584
                 ED    +     +  G V+R  LS +    R GK    +    ++    +   +
Sbjct: 630 MPLPEDEDFWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDEI-LSVDTCT 688

Query: 585 THTSVLFFSSLGFVYK---------------------------------EKVWRLPIGSP 611
               VL   + G   +                                            
Sbjct: 689 EFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDKVISMAILHHVDATPAER 748

Query: 612 QARGKALINILSLNQGERITTIMPFPEDESSW----NNLY---------VVFATKHGNVR 658
            A  K  I        +    I+   ED  +      + Y         V+  ++ G  +
Sbjct: 749 SAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQELKAREETVLTVSEFGYGK 808

Query: 659 RNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVRFPISAI 713
           R+   +F        G  A      DEI   +++      + ILL +  GQ +R P+  I
Sbjct: 809 RSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDGGQLIRVPVDGI 868

Query: 714 RVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGD 768
           R  AGR++ GV   + A G++V+S+  +  AD+D +                + +
Sbjct: 869 R-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDTPAATQE 922


>gi|161619050|ref|YP_001592937.1| DNA gyrase subunit A [Brucella canis ATCC 23365]
 gi|260566365|ref|ZP_05836835.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|161335861|gb|ABX62166.1| DNA gyrase, A subunit [Brucella canis ATCC 23365]
 gi|260155883|gb|EEW90963.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
          Length = 922

 Score = 1003 bits (2592), Expect = 0.0,   Method: Composition-based stats.
 Identities = 594/892 (66%), Positives = 724/892 (81%), Gaps = 2/892 (0%)

Query: 16  ITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCA 75
           I  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M +M + +N+ Y K A
Sbjct: 12  IEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAMNEMNLAYNRPYRKSA 71

Query: 76  RISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRL 135
            + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+GQGNFGS+DGDPPAA RYTECRL
Sbjct: 72  GVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLIDGQGNFGSIDGDPPAAMRYTECRL 131

Query: 136 QKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNL 195
           +K    LL D+ KDTV+F+ NYDG  QEPVVL AR+PN+LVNG GGIAVGMATNIP HNL
Sbjct: 132 EKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFPNLLVNGSGGIAVGMATNIPPHNL 191

Query: 196 GEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSH 255
           GEV+DGCVA+IDNP I+L  LME+I GPDFPTG +ILGR GI +AY TGRGS+++RG + 
Sbjct: 192 GEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIILGRNGINSAYTTGRGSVIMRGRAT 251

Query: 256 IEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELK 315
           IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KRI  I+DLRDESDR+GYRVV+ELK
Sbjct: 252 IEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKRIDGISDLRDESDREGYRVVVELK 311

Query: 316 RGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKY 375
           R A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFVAFREEVV RRTK+
Sbjct: 312 RDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRAFVAFREEVVTRRTKF 371

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
           LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P TAR +LM+R W A D+  LI LID
Sbjct: 372 LLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPATAREQLMERRWPAVDVAPLIRLID 431

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRS 495
           D  +T+  D T  LSE Q RAIL+LRL RLT LGRD++ +ELN +G EI++ LDIL SR 
Sbjct: 432 DPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDEVADELNKIGEEIRDYLDILGSRL 491

Query: 496 RLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSV 555
           R++ I+K+E+++V+DE  TPRRT I  G  +M+DED I REDMVVTVSH GY+KRVPL+ 
Sbjct: 492 RVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDLIAREDMVVTVSHAGYIKRVPLTT 551

Query: 556 YRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARG 615
           YRAQRRGGKGRSG+  ++EDFVT LF+ STHT VLFFSS G VYKEKVWRLP+G+PQ+RG
Sbjct: 552 YRAQRRGGKGRSGMATKEEDFVTRLFVASTHTPVLFFSSRGIVYKEKVWRLPVGTPQSRG 611

Query: 616 KALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIA 675
           KALIN+L L QGERITTIMP PEDE  W NL V+F+T  G VRRNKLSDF+Q+NR+GKIA
Sbjct: 612 KALINMLPLQQGERITTIMPLPEDEDFWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIA 671

Query: 676 MKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQ 734
           MKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++ +RVFAGRNS+GVRGI+LA+GD+
Sbjct: 672 MKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDK 731

Query: 735 VISMAIVLHADADYDERICYMKHMSAQRRLISGDT-EEITSLKNDSSVEGNISEERCQEL 793
           VISMAI+ H DA   ER  Y+K   A+RR    D  ++I  +  D   E  +SE+R QEL
Sbjct: 732 VISMAILHHVDATPAERSAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQEL 791

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
           K +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRATD SK +EIG LVA+FPV  +DQI
Sbjct: 792 KAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQI 851

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           +LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+VVSVERI +++  +E
Sbjct: 852 LLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEKVVSVERISDADSDEE 903



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 50/295 (16%), Positives = 90/295 (30%), Gaps = 58/295 (19%)

Query: 530 EDCIVREDMVVTV-----SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVS 584
                 ED    +     +  G V+R  LS +    R GK    +    ++    +   +
Sbjct: 630 MPLPEDEDFWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDEI-LSVDTCT 688

Query: 585 THTSVLFFSSLGFVYK---------------------------------EKVWRLPIGSP 611
               VL   + G   +                                            
Sbjct: 689 EFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDKVISMAILHHVDATPAER 748

Query: 612 QARGKALINILSLNQGERITTIMPFPEDESSW----NNLY---------VVFATKHGNVR 658
            A  K  I        +    I+   ED  +      + Y         V+  ++ G  +
Sbjct: 749 SAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQELKAREETVLTVSEFGYGK 808

Query: 659 RNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVRFPISAI 713
           R+   +F        G  A      DEI   +++      + ILL +  GQ +R P+  I
Sbjct: 809 RSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDGGQLIRVPVDGI 868

Query: 714 RVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGD 768
           R  AGR++ GV   + A G++V+S+  +  AD+D +                + +
Sbjct: 869 R-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDTPAATQE 922


>gi|161511141|ref|NP_539801.2| DNA gyrase subunit A [Brucella melitensis bv. 1 str. 16M]
 gi|260565641|ref|ZP_05836125.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|265991179|ref|ZP_06103736.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260151709|gb|EEW86803.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|263001963|gb|EEZ14538.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 922

 Score = 1002 bits (2591), Expect = 0.0,   Method: Composition-based stats.
 Identities = 593/892 (66%), Positives = 725/892 (81%), Gaps = 2/892 (0%)

Query: 16  ITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCA 75
           I  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M +M + +N+ Y K A
Sbjct: 12  IEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAMNEMNLAYNRPYRKSA 71

Query: 76  RISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRL 135
            + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+GQGNFGS+DGDPPAA RYTECRL
Sbjct: 72  GVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLIDGQGNFGSIDGDPPAAMRYTECRL 131

Query: 136 QKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNL 195
           +K    LL D+ KDTV+F+ NYDG  QEPVVL AR+PN+LVNG GGIAVGMATNIP HNL
Sbjct: 132 EKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFPNLLVNGSGGIAVGMATNIPPHNL 191

Query: 196 GEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSH 255
           GEV+DGCVA+IDNP I+L  LME+I GPDFPTG +ILGR GI +AY TGRGS+++RG + 
Sbjct: 192 GEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIILGRNGINSAYTTGRGSVIMRGRAT 251

Query: 256 IEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELK 315
           IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KRI  I+DLRDESDR+GYRVV+ELK
Sbjct: 252 IEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKRIDGISDLRDESDREGYRVVVELK 311

Query: 316 RGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKY 375
           R A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFVAFREEVV RRTK+
Sbjct: 312 RDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRAFVAFREEVVTRRTKF 371

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
           LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P TAR +LM+R W A D+  LI LID
Sbjct: 372 LLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPATAREQLMERRWPAVDVAPLIRLID 431

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRS 495
           D  +T+  D T  LSE Q RAIL+LRL RLT LGRD++ +ELN +G EI++ LDIL SR 
Sbjct: 432 DPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDEVADELNKIGEEIRDYLDILGSRL 491

Query: 496 RLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSV 555
           R++ I+K+E+++V+DE  TPRRT I  G  +M+DED I REDMVVTVSH GY+KRVPL+ 
Sbjct: 492 RVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDLIAREDMVVTVSHAGYIKRVPLTT 551

Query: 556 YRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARG 615
           YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFFSS G VYKEK+WRLP+G+PQ+RG
Sbjct: 552 YRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFFSSRGIVYKEKLWRLPVGTPQSRG 611

Query: 616 KALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIA 675
           KALIN+L L QGERITTIMP PEDE SW NL V+F+T  G VRRNKLSDF+Q+NR+GKIA
Sbjct: 612 KALINMLPLQQGERITTIMPLPEDEDSWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIA 671

Query: 676 MKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQ 734
           MKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++ +RVFAGRNS+GVRGI+LA+GD+
Sbjct: 672 MKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDK 731

Query: 735 VISMAIVLHADADYDERICYMKHMSAQRRLISGDT-EEITSLKNDSSVEGNISEERCQEL 793
           VISMAI+ H DA   ER  Y+K   A+RR    D  ++I  +  D   E  +SE+R QEL
Sbjct: 732 VISMAILHHVDATPAERSAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQEL 791

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
           K +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRATD SK +EIG LVA+FPV  +DQI
Sbjct: 792 KAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQI 851

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           +LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+VVSVERI +++  +E
Sbjct: 852 LLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEKVVSVERISDADSDEE 903



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 798 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 857

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 858 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 916

Query: 763 RLISGD 768
              + +
Sbjct: 917 PAATQE 922


>gi|62290012|ref|YP_221805.1| DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941]
 gi|82699940|ref|YP_414514.1| DNA gyrase subunit A [Brucella melitensis biovar Abortus 2308]
 gi|225852600|ref|YP_002732833.1| DNA gyrase subunit A [Brucella melitensis ATCC 23457]
 gi|254689326|ref|ZP_05152580.1| DNA gyrase subunit A [Brucella abortus bv. 6 str. 870]
 gi|254717610|ref|ZP_05179421.1| DNA gyrase subunit A [Brucella ceti M13/05/1]
 gi|256263907|ref|ZP_05466439.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260546566|ref|ZP_05822305.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260754841|ref|ZP_05867189.1| DNA gyrase subunit A [Brucella abortus bv. 6 str. 870]
 gi|260758058|ref|ZP_05870406.1| DNA gyrase subunit A [Brucella abortus bv. 4 str. 292]
 gi|260761882|ref|ZP_05874225.1| DNA gyrase subunit A [Brucella abortus bv. 2 str. 86/8/59]
 gi|261219445|ref|ZP_05933726.1| hypothetical protein BAJG_02890 [Brucella ceti M13/05/1]
 gi|261314178|ref|ZP_05953375.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261317733|ref|ZP_05956930.1| hypothetical protein BAHG_01382 [Brucella pinnipedialis B2/94]
 gi|261321941|ref|ZP_05961138.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|265988764|ref|ZP_06101321.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265995015|ref|ZP_06107572.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998229|ref|ZP_06110786.1| hypothetical protein BAPG_01350 [Brucella ceti M490/95/1]
 gi|294852438|ref|ZP_06793111.1| hypothetical protein BAZG_01365 [Brucella sp. NVSL 07-0026]
 gi|62196144|gb|AAX74444.1| GyrA, DNA gyrase, A subunit [Brucella abortus bv. 1 str. 9-941]
 gi|82616041|emb|CAJ11077.1| DNA gyrase/topoisomerase IV, subunit A:DNA gyrase, subunit A:DNA
           gyrase C-terminal repeat, beta-propeller [Brucella
           melitensis biovar Abortus 2308]
 gi|225640965|gb|ACO00879.1| DNA gyrase, A subunit [Brucella melitensis ATCC 23457]
 gi|260095616|gb|EEW79493.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260668376|gb|EEX55316.1| DNA gyrase subunit A [Brucella abortus bv. 4 str. 292]
 gi|260672314|gb|EEX59135.1| DNA gyrase subunit A [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674949|gb|EEX61770.1| DNA gyrase subunit A [Brucella abortus bv. 6 str. 870]
 gi|260924534|gb|EEX91102.1| hypothetical protein BAJG_02890 [Brucella ceti M13/05/1]
 gi|261294631|gb|EEX98127.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296956|gb|EEY00453.1| hypothetical protein BAHG_01382 [Brucella pinnipedialis B2/94]
 gi|261303204|gb|EEY06701.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|262552697|gb|EEZ08687.1| hypothetical protein BAPG_01350 [Brucella ceti M490/95/1]
 gi|262766128|gb|EEZ11917.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263094040|gb|EEZ17974.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264660961|gb|EEZ31222.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|294821027|gb|EFG38026.1| hypothetical protein BAZG_01365 [Brucella sp. NVSL 07-0026]
 gi|326538827|gb|ADZ87042.1| DNA gyrase, A subunit [Brucella melitensis M5-90]
          Length = 922

 Score = 1002 bits (2590), Expect = 0.0,   Method: Composition-based stats.
 Identities = 594/892 (66%), Positives = 725/892 (81%), Gaps = 2/892 (0%)

Query: 16  ITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCA 75
           I  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M +M + +N+ Y K A
Sbjct: 12  IEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAMNEMNLAYNRPYRKSA 71

Query: 76  RISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRL 135
            + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+GQGNFGS+DGDPPAA RYTECRL
Sbjct: 72  GVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLIDGQGNFGSIDGDPPAAMRYTECRL 131

Query: 136 QKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNL 195
           +K    LL D+ KDTV+F+ NYDG  QEPVVL AR+PN+LVNG GGIAVGMATNIP HNL
Sbjct: 132 EKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFPNLLVNGSGGIAVGMATNIPPHNL 191

Query: 196 GEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSH 255
           GEV+DGCVA+IDNP I+L  LME+I GPDFPTG +ILGR GI +AY TGRGS+++RG + 
Sbjct: 192 GEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIILGRNGINSAYTTGRGSVIMRGRAT 251

Query: 256 IEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELK 315
           IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KRI  I+DLRDESDR+GYRVV+ELK
Sbjct: 252 IEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKRIDGISDLRDESDREGYRVVVELK 311

Query: 316 RGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKY 375
           R A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFVAFREEVV RRTK+
Sbjct: 312 RDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRAFVAFREEVVTRRTKF 371

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
           LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P TAR +LM+R W A D+  LI LID
Sbjct: 372 LLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPATAREQLMERRWPAVDVAPLIRLID 431

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRS 495
           D  +T+  D T  LSE Q RAIL+LRL RLT LGRD++ +ELN +G EI++ LDIL SR 
Sbjct: 432 DPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDEVADELNKIGEEIRDYLDILGSRL 491

Query: 496 RLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSV 555
           R++ I+K+E+++V+DE  TPRRT I  G  +M+DED I REDMVVTVSH GY+KRVPL+ 
Sbjct: 492 RVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDLIAREDMVVTVSHAGYIKRVPLTT 551

Query: 556 YRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARG 615
           YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFFSS G VYKEKVWRLP+G+PQ+RG
Sbjct: 552 YRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFFSSRGIVYKEKVWRLPVGTPQSRG 611

Query: 616 KALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIA 675
           KALIN+L L QGERITTIMP PEDE SW NL V+F+T  G VRRNKLSDF+Q+NR+GKIA
Sbjct: 612 KALINMLPLQQGERITTIMPLPEDEDSWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIA 671

Query: 676 MKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQ 734
           MKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++ +RVFAGRNS+GVRGI+LA+GD+
Sbjct: 672 MKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDK 731

Query: 735 VISMAIVLHADADYDERICYMKHMSAQRRLISGDT-EEITSLKNDSSVEGNISEERCQEL 793
           VISMAI+ H DA   ER  Y+K   A+RR    D  ++I  +  D   E  +SE+R QEL
Sbjct: 732 VISMAILHHVDATPAERSAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQEL 791

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
           K +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRATD SK +EIG LVA+FPV  +DQI
Sbjct: 792 KAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQI 851

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           +LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+VVSVERI +++  +E
Sbjct: 852 LLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEKVVSVERISDADSDEE 903



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 798 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 857

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 858 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 916

Query: 763 RLISGD 768
              + +
Sbjct: 917 PAATQE 922


>gi|163843366|ref|YP_001627770.1| DNA gyrase subunit A [Brucella suis ATCC 23445]
 gi|163674089|gb|ABY38200.1| DNA gyrase, A subunit [Brucella suis ATCC 23445]
          Length = 922

 Score = 1002 bits (2590), Expect = 0.0,   Method: Composition-based stats.
 Identities = 592/892 (66%), Positives = 723/892 (81%), Gaps = 2/892 (0%)

Query: 16  ITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCA 75
           I  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M +M + +N+ Y K A
Sbjct: 12  IEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAMNEMNLAYNRPYRKSA 71

Query: 76  RISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRL 135
            + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+GQGNFGS+DGDPPAA RYTECRL
Sbjct: 72  GVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLIDGQGNFGSIDGDPPAAMRYTECRL 131

Query: 136 QKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNL 195
           +K    LL D+ KDTV+F+ NYDG  QEPVVL AR+PN+LVNG GGIAVGMATNIP HNL
Sbjct: 132 EKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFPNLLVNGSGGIAVGMATNIPPHNL 191

Query: 196 GEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSH 255
           GEV+DGCVA+IDNP I+L  LME+I GPDFPTG +ILGR GI +AY TGRGS+++RG + 
Sbjct: 192 GEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIILGRNGINSAYTTGRGSVIMRGRAT 251

Query: 256 IEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELK 315
           IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KRI  I+DLRDESDR+GYRVV+ELK
Sbjct: 252 IEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKRIDGISDLRDESDREGYRVVVELK 311

Query: 316 RGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKY 375
           R A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFVAFREEVV RRTK+
Sbjct: 312 RDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRAFVAFREEVVTRRTKF 371

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
           LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P TAR +LM+R W A D+  LI LID
Sbjct: 372 LLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPATAREQLMERRWPAVDVAPLIRLID 431

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRS 495
           D  +T+  D T  LSE Q RAIL+LRL RLT LGRD++ +ELN +G EI++ LDIL SR 
Sbjct: 432 DPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDEVADELNKIGEEIRDYLDILGSRL 491

Query: 496 RLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSV 555
           R++ I+K+E+++V+DE  TPRRT I  G  +M+DED I REDMVVTVSH GY+KRVPL+ 
Sbjct: 492 RVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDLIAREDMVVTVSHAGYIKRVPLTT 551

Query: 556 YRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARG 615
           YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFFSS G VYKEKVWRLP+G+PQ+RG
Sbjct: 552 YRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFFSSRGIVYKEKVWRLPVGTPQSRG 611

Query: 616 KALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIA 675
           KALIN+L L QGERITTIMP PEDE  W NL V+F+T  G VRRNKLSDF+Q+NR+GKIA
Sbjct: 612 KALINMLPLQQGERITTIMPLPEDEDFWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIA 671

Query: 676 MKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQ 734
           MKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++ +RVFAGRNS+GVRGI+LA+GD+
Sbjct: 672 MKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDK 731

Query: 735 VISMAIVLHADADYDERICYMKHMSAQRRLISGDT-EEITSLKNDSSVEGNISEERCQEL 793
           VISMAI+ H D    ER  Y+K   A+RR    D  ++I  +  D   E  +SE+R QEL
Sbjct: 732 VISMAILHHVDVTPAERSAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQEL 791

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
           K +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRATD SK +EIG LVA+FPV  +DQI
Sbjct: 792 KAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQI 851

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           +LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+VVSVERI +++  +E
Sbjct: 852 LLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEKVVSVERISDADSDEE 903



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 50/295 (16%), Positives = 91/295 (30%), Gaps = 58/295 (19%)

Query: 530 EDCIVREDMVVTV-----SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVS 584
                 ED    +     +  G V+R  LS +    R GK    +    ++    +   +
Sbjct: 630 MPLPEDEDFWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDEI-LSVDTCT 688

Query: 585 THTSVLFFSSLGFVYK---------------------------------EKVWRLPIGSP 611
               VL   + G   +                                      +     
Sbjct: 689 EFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDKVISMAILHHVDVTPAER 748

Query: 612 QARGKALINILSLNQGERITTIMPFPEDESSW----NNLY---------VVFATKHGNVR 658
            A  K  I        +    I+   ED  +      + Y         V+  ++ G  +
Sbjct: 749 SAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQELKAREETVLTVSEFGYGK 808

Query: 659 RNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVRFPISAI 713
           R+   +F        G  A      DEI   +++      + ILL +  GQ +R P+  I
Sbjct: 809 RSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDGGQLIRVPVDGI 868

Query: 714 RVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGD 768
           R  AGR++ GV   + A G++V+S+  +  AD+D +                + +
Sbjct: 869 R-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDTPAATQE 922


>gi|121602587|ref|YP_989035.1| DNA gyrase subunit A [Bartonella bacilliformis KC583]
 gi|18920720|gb|AAL82403.1|AF469609_2 gyrase A subunit [Bartonella bacilliformis]
 gi|120614764|gb|ABM45365.1| DNA gyrase, A subunit [Bartonella bacilliformis KC583]
          Length = 928

 Score = 1002 bits (2590), Expect = 0.0,   Method: Composition-based stats.
 Identities = 587/915 (64%), Positives = 721/915 (78%), Gaps = 5/915 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+     + +   GI  VSI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M
Sbjct: 1   MTDLTRLPEHDVSTGIEPVSIIEEMQCSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            +MG+ +NK Y K A + GEVMGK+HPHG+A+IYDAL RMAQD+SLR  LI+GQGNFGSV
Sbjct: 61  NEMGLLFNKPYRKSAGVVGEVMGKFHPHGDASIYDALVRMAQDFSLRNPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTECRL+K A  LL D+ KDTVDF+ NYDG   EP+VL AR+PN+LVNG G
Sbjct: 121 DGDPPAAMRYTECRLEKVAEELLADIDKDTVDFQDNYDGREHEPIVLPARFPNLLVNGSG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEV+DGCVA+IDNP+I +D ++ II GPDFPTG +ILG +G+++A
Sbjct: 181 GIAVGMATNIPPHNLGEVIDGCVALIDNPNITIDEMLAIIPGPDFPTGGIILGHSGVRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGSI++R    IE+    R+ I+V+EIPYQVNKA M+EK+AELVR+KRI  I+DLR
Sbjct: 241 YETGRGSIIMRAKVEIEEIRNQRQAIIVSEIPYQVNKATMVEKMAELVRDKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR GYRVVIELKR A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRDGYRVVIELKREAVADVVLNQLYRYTPLQASFGCNMVALNGGKPEQMTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FREEVV RRTKYLL KAR+RAHVLVGLAIAVAN+DE++ +IR + +P+TAR +LM+R
Sbjct: 361 FVSFREEVVSRRTKYLLRKARERAHVLVGLAIAVANIDEIIELIRKAHDPQTARTQLMER 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W AS++  LI LIDD  + I  D T  LSE Q RAILELRL RLT LGR++I +ELN++
Sbjct: 421 RWPASEVAALIKLIDDPRHIIHEDNTYNLSEEQARAILELRLQRLTALGRNEIADELNAI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G +I + L IL+SRSR++ I+K EL ++++   TPRRT    G  +M+ ED IV EDMVV
Sbjct: 481 GEDIADYLGILASRSRIMDIVKSELSALRETFATPRRTVFGFGSAEMDCEDLIVPEDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSH GY+KRVPL+ YRAQRRGGKGRSG+  +D+DFVT LF+ +THT VLFFSS G VYK
Sbjct: 541 TVSHSGYIKRVPLNTYRAQRRGGKGRSGMATKDQDFVTRLFVANTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLP+G+PQ+RG+ALIN+L L QGERITTIMP PEDE+SW  L ++FAT  G VRRN
Sbjct: 601 EKVWRLPVGTPQSRGRALINMLPLQQGERITTIMPLPEDEASWGKLDIMFATTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKLD-SRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDFIQ+NR+GKIAMKLD   DEILSVETCT+ +D++L T  GQC+RFP++ IRVF+GR
Sbjct: 661 KLSDFIQVNRNGKIAMKLDEEGDEILSVETCTEHDDVVLITANGQCIRFPVTDIRVFSGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NS+GVRGI++ +GD+VISM I+ H +A   ER  Y+K    +RR+   D E+I ++  D 
Sbjct: 721 NSMGVRGINMVEGDKVISMTILEHVEATSVERSAYIKRAINERRVAGSDDEDILTVDEDG 780

Query: 780 SV-EGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEI 838
              E  +++ER  EL   EQ +LTVSE G+GKR+SSYDFRIS R GKGIRATD+SK  EI
Sbjct: 781 EETEVELTDERYAELSAHEQMLLTVSEFGYGKRSSSYDFRISGRGGKGIRATDLSKAAEI 840

Query: 839 GALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
           G LVA FPV + DQI+LVSD G LIRVPVN IRIA R+TKGV +F+TAK E+VVSVERI 
Sbjct: 841 GKLVAAFPVGERDQIMLVSDGGQLIRVPVNCIRIAGRSTKGVTVFNTAKGEKVVSVERIS 900

Query: 899 ESEIVD---EAESTE 910
           ESE      + ES E
Sbjct: 901 ESENDTNQLDIESEE 915



 Score = 55.6 bits (132), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 47/241 (19%), Positives = 96/241 (39%), Gaps = 14/241 (5%)

Query: 535 REDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSS 594
             D VV ++  G   R P++  R     G+   GV   +      +  ++    V   S 
Sbjct: 693 EHDDVVLITANGQCIRFPVTDIRV--FSGRNSMGVRGINMVEGDKVISMTILEHVEATSV 750

Query: 595 LGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWN--NLYVVFAT 652
               Y ++         +  G    +IL++++    T +    E  +  +     ++  +
Sbjct: 751 ERSAYIKRAINE----RRVAGSDDEDILTVDEDGEETEVELTDERYAELSAHEQMLLTVS 806

Query: 653 KHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVR 707
           + G  +R+   DF        G  A  L    EI   ++     + + I+L +  GQ +R
Sbjct: 807 EFGYGKRSSSYDFRISGRGGKGIRATDLSKAAEIGKLVAAFPVGERDQIMLVSDGGQLIR 866

Query: 708 FPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISG 767
            P++ IR  AGR++ GV   + AKG++V+S+  +  ++ D ++     +  S    +   
Sbjct: 867 VPVNCIR-IAGRSTKGVTVFNTAKGEKVVSVERISESENDTNQLDIESEEHSGTVSMSEE 925

Query: 768 D 768
            
Sbjct: 926 K 926


>gi|254693811|ref|ZP_05155639.1| DNA gyrase subunit A [Brucella abortus bv. 3 str. Tulya]
 gi|261214092|ref|ZP_05928373.1| DNA gyrase subunit A [Brucella abortus bv. 3 str. Tulya]
 gi|260915699|gb|EEX82560.1| DNA gyrase subunit A [Brucella abortus bv. 3 str. Tulya]
          Length = 922

 Score = 1002 bits (2589), Expect = 0.0,   Method: Composition-based stats.
 Identities = 595/892 (66%), Positives = 725/892 (81%), Gaps = 2/892 (0%)

Query: 16  ITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCA 75
           I  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M +M + +N+ Y K A
Sbjct: 12  IEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAMNEMNLAYNRPYRKSA 71

Query: 76  RISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRL 135
            + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+GQGNFGS+DGDPPAA RYTECRL
Sbjct: 72  GVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLIDGQGNFGSIDGDPPAAMRYTECRL 131

Query: 136 QKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNL 195
           +K    LL D+ KDTV+F+ NYDG  QEPVVL AR+PN+LVNG GGIAVGMATNIP HNL
Sbjct: 132 EKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFPNLLVNGSGGIAVGMATNIPPHNL 191

Query: 196 GEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSH 255
           GEV+DGCVA+IDNP IDL  LME+I GPDFPTG +ILGR GI +AY TGRGS+++RG + 
Sbjct: 192 GEVIDGCVALIDNPAIDLSELMELIPGPDFPTGGIILGRNGINSAYTTGRGSVIMRGRAT 251

Query: 256 IEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELK 315
           IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KRI  I+DLRDESDR+GYRVV+ELK
Sbjct: 252 IEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKRIDGISDLRDESDREGYRVVVELK 311

Query: 316 RGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKY 375
           R A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFVAFREEVV RRTK+
Sbjct: 312 RDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRAFVAFREEVVTRRTKF 371

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
           LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P TAR +LM+R W A D+  LI LID
Sbjct: 372 LLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPATAREQLMERRWPAVDVAPLIRLID 431

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRS 495
           D  +T+  D T  LSE Q RAIL+LRL RLT LGRD++ +ELN +G EI++ LDIL SR 
Sbjct: 432 DPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDEVADELNKIGEEIRDYLDILGSRL 491

Query: 496 RLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSV 555
           R++ I+K+E+++V+DE  TPRRT I  G  +M+DED I REDMVVTVSH GY+KRVPL+ 
Sbjct: 492 RVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDLIAREDMVVTVSHAGYIKRVPLTT 551

Query: 556 YRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARG 615
           YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFFSS G VYKEKVWRLP+G+PQ+RG
Sbjct: 552 YRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFFSSRGIVYKEKVWRLPVGTPQSRG 611

Query: 616 KALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIA 675
           KALIN+L L QGERITTIMP PEDE SW NL V+F+T  G VRRNKLSDF+Q+NR+GKIA
Sbjct: 612 KALINMLPLQQGERITTIMPLPEDEDSWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIA 671

Query: 676 MKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQ 734
           MKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++ +RVFAGRNS+GVRGI+LA+GD+
Sbjct: 672 MKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDK 731

Query: 735 VISMAIVLHADADYDERICYMKHMSAQRRLISGDT-EEITSLKNDSSVEGNISEERCQEL 793
           VISMAI+ H DA   ER  Y+K   A+RR    D  ++I  +  D   E  +SE+R QEL
Sbjct: 732 VISMAILHHVDATPAERSAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQEL 791

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
           K +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRATD SK +EIG LVA+FPV  +DQI
Sbjct: 792 KAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQI 851

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           +LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+VVSVERI +++  +E
Sbjct: 852 LLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEKVVSVERISDADSDEE 903



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 798 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 857

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 858 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 916

Query: 763 RLISGD 768
              + +
Sbjct: 917 PAATQE 922


>gi|261752404|ref|ZP_05996113.1| DNA gyrase subunit A [Brucella suis bv. 5 str. 513]
 gi|261742157|gb|EEY30083.1| DNA gyrase subunit A [Brucella suis bv. 5 str. 513]
          Length = 922

 Score = 1002 bits (2589), Expect = 0.0,   Method: Composition-based stats.
 Identities = 594/892 (66%), Positives = 725/892 (81%), Gaps = 2/892 (0%)

Query: 16  ITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCA 75
           I  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M +M + +N+ Y K A
Sbjct: 12  IEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAMNEMNLAYNRPYRKSA 71

Query: 76  RISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRL 135
            + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+GQGNFGS+DGDPPAA RYTECRL
Sbjct: 72  GVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLIDGQGNFGSIDGDPPAAMRYTECRL 131

Query: 136 QKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNL 195
           +K    LL D+ KDTV+F+ NYDG  QEPVVL AR+PN+LVNG GGIAVGMATNIP HNL
Sbjct: 132 EKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFPNLLVNGSGGIAVGMATNIPPHNL 191

Query: 196 GEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSH 255
           GEV+DGCVA+IDNP I+L  LME+I GPDFPTG +ILGR GI +AY TGRGS+++RG + 
Sbjct: 192 GEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIILGRNGINSAYTTGRGSVIMRGRAT 251

Query: 256 IEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELK 315
           IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KRI  I+DLRDESDR+GYRVV+ELK
Sbjct: 252 IEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKRIDGISDLRDESDREGYRVVVELK 311

Query: 316 RGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKY 375
           R A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFVAFREEVV RRTK+
Sbjct: 312 RDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRAFVAFREEVVTRRTKF 371

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
           LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P TAR +LM+R W A D+  LI LID
Sbjct: 372 LLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPATAREQLMERRWPAVDVAPLIRLID 431

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRS 495
           D  +T+  D T  LSE Q RAIL+LRL RLT LGRD++ +ELN +G EI++ LDIL SR 
Sbjct: 432 DPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDEVADELNKIGEEIRDYLDILGSRL 491

Query: 496 RLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSV 555
           R++ I+K+E+++V+DE  TPRRT I  G  +M+DED I REDMVVTVSH GY+KRVPL+ 
Sbjct: 492 RVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDLIAREDMVVTVSHAGYIKRVPLTT 551

Query: 556 YRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARG 615
           YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFFSS G VYKEKVWRLP+G+PQ+RG
Sbjct: 552 YRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFFSSRGIVYKEKVWRLPVGTPQSRG 611

Query: 616 KALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIA 675
           KALIN+L L QGERITTIMP PEDE SW NL V+F+T  G VRRNKLSDF+Q+NR+GKIA
Sbjct: 612 KALINMLPLQQGERITTIMPLPEDEDSWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIA 671

Query: 676 MKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQ 734
           MKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++ +RVFAGRNS+GVRGI+LA+GD+
Sbjct: 672 MKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDK 731

Query: 735 VISMAIVLHADADYDERICYMKHMSAQRRLISGDT-EEITSLKNDSSVEGNISEERCQEL 793
           VISMAI+ H DA   ER  Y+K   A+RR    D  ++I  +  D   E  +SE+R QEL
Sbjct: 732 VISMAILHHVDATPAERSAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQEL 791

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
           K +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRATD SK +EIG LVA+FPV  +DQI
Sbjct: 792 KAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQI 851

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           +LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+VVSVERI +++  +E
Sbjct: 852 LLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEKVVSVERISDADSDEE 903



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 798 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 857

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 858 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEDDT 916

Query: 763 RLISGD 768
              + +
Sbjct: 917 PAATQE 922


>gi|256257573|ref|ZP_05463109.1| DNA gyrase subunit A [Brucella abortus bv. 9 str. C68]
 gi|260883853|ref|ZP_05895467.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|297248414|ref|ZP_06932132.1| DNA gyrase, A subunit [Brucella abortus bv. 5 str. B3196]
 gi|260873381|gb|EEX80450.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|297175583|gb|EFH34930.1| DNA gyrase, A subunit [Brucella abortus bv. 5 str. B3196]
          Length = 922

 Score = 1002 bits (2589), Expect = 0.0,   Method: Composition-based stats.
 Identities = 593/892 (66%), Positives = 725/892 (81%), Gaps = 2/892 (0%)

Query: 16  ITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCA 75
           I  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M +M + +N+ Y K A
Sbjct: 12  IEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAMNEMNLAYNRPYRKSA 71

Query: 76  RISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRL 135
            + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+GQGNFGS+DGDPPAA RYTECRL
Sbjct: 72  GVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLIDGQGNFGSIDGDPPAAMRYTECRL 131

Query: 136 QKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNL 195
           +K    LL D+ KDTV+F+ NYDG  QEPVVL AR+PN+LVNG GGIAVGMATNIP HNL
Sbjct: 132 EKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFPNLLVNGSGGIAVGMATNIPPHNL 191

Query: 196 GEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSH 255
           GEV+DGCVA+IDNP I+L  LME+I GPDFPTG +ILGR GI +AY TGRGS+++RG + 
Sbjct: 192 GEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIILGRNGINSAYTTGRGSVIMRGRAT 251

Query: 256 IEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELK 315
           IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KRI  I+DLRDESDR+GYRVV+ELK
Sbjct: 252 IEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKRIDGISDLRDESDREGYRVVVELK 311

Query: 316 RGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKY 375
           R A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFVAFREEVV RRTK+
Sbjct: 312 RDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRAFVAFREEVVTRRTKF 371

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
           LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P TAR +LM+R W A D+  LI LID
Sbjct: 372 LLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPATAREQLMERRWPAVDVAPLIRLID 431

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRS 495
           D  +T+  D T  LSE Q RAIL+LRL RLT LGRD++ +ELN +G EI++ LDIL SR 
Sbjct: 432 DPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDEVADELNKIGEEIRDYLDILGSRL 491

Query: 496 RLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSV 555
           R++ I+K+E+++V+DE  TPRRT I  G  +M+DED I REDMVVTVSH GY+KRVPL+ 
Sbjct: 492 RVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDLIAREDMVVTVSHAGYIKRVPLTT 551

Query: 556 YRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARG 615
           YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFFSS G VYKEKVWRLP+G+PQ+RG
Sbjct: 552 YRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFFSSRGIVYKEKVWRLPVGTPQSRG 611

Query: 616 KALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIA 675
           KALIN+L L QGERITTIMP PEDE SW NL V+F+T  G VRRNKLSDF+Q+NR+GKIA
Sbjct: 612 KALINMLPLQQGERITTIMPLPEDEDSWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIA 671

Query: 676 MKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQ 734
           MKL D  D+ILSV+TCT+ +D+LLT   GQC+RFP++ +RVFAGRNS+GVRGI+LA+GD+
Sbjct: 672 MKLEDEGDKILSVDTCTEFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDK 731

Query: 735 VISMAIVLHADADYDERICYMKHMSAQRRLISGDT-EEITSLKNDSSVEGNISEERCQEL 793
           VISMAI+ H DA   ER  Y+K   A+RR    D  ++I  +  D   E  +SE+R QEL
Sbjct: 732 VISMAILHHVDATPAERSAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQEL 791

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
           K +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRATD SK +EIG LVA+FPV  +DQI
Sbjct: 792 KAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQI 851

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           +LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+VVSVERI +++  +E
Sbjct: 852 LLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEKVVSVERISDADSDEE 903



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 798 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 857

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 858 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 916

Query: 763 RLISGD 768
              + +
Sbjct: 917 PAATQE 922


>gi|222085986|ref|YP_002544518.1| DNA gyrase, A subunit [Agrobacterium radiobacter K84]
 gi|221723434|gb|ACM26590.1| DNA gyrase, A subunit [Agrobacterium radiobacter K84]
          Length = 934

 Score = 1002 bits (2589), Expect = 0.0,   Method: Composition-based stats.
 Identities = 641/911 (70%), Positives = 759/911 (83%), Gaps = 1/911 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MTE       +   GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+GM
Sbjct: 1   MTEQTPPGGGKLPPGIEPISIMEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYGM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            ++G++WNKKYVKCAR++G+VMGKYHPHGN AIYDALARMAQ WSLRL LI+GQGNFGSV
Sbjct: 61  SELGIDWNKKYVKCARVTGDVMGKYHPHGNLAIYDALARMAQPWSLRLPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAAERYTECRLQK AH LLDDL K+TVDFR NYDG+  EPVV+ A++PN+LVNG G
Sbjct: 121 DGDPPAAERYTECRLQKVAHSLLDDLDKETVDFRDNYDGTLSEPVVVPAKFPNLLVNGSG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNL EV+DGC+A+IDNP I+L  +M+II GPDFPTGA ILGR GI++A
Sbjct: 181 GIAVGMATNIPPHNLSEVIDGCIALIDNPAIELPEIMQIIPGPDFPTGAKILGRAGIRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGSIV+RGV+ IE   GDREQI++TEIPYQVNKA M+EK+AELVREKRI  I+DLR
Sbjct: 241 YETGRGSIVMRGVAAIEPMRGDREQIIITEIPYQVNKATMIEKMAELVREKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVV+ELKR A+ADVILNQLYRYT LQ+ F  N+VALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRQGYRVVVELKRDANADVILNQLYRYTPLQTSFGANVVALNGGKPEQLTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FRE+VV RRTKYLL KAR+RAHVLVGLAIAVAN+DEV+R+IR +P+P++AR ELM R
Sbjct: 361 FVSFREDVVSRRTKYLLRKARERAHVLVGLAIAVANIDEVIRVIRRAPDPQSAREELMTR 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D++ LI LIDD  + I  DGT  LSE Q RAILELRLARLT LGRD+I +ELN +
Sbjct: 421 RWPAEDVESLIRLIDDPRHRINEDGTYNLSEEQARAILELRLARLTALGRDEIGDELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EIK+ LDILSSR R+  I+K+EL++V+DE  TPRRT IV+G L+M+DED I REDMVV
Sbjct: 481 GAEIKDYLDILSSRVRIQTIVKEELIAVRDEFGTPRRTEIVDGGLEMDDEDLIAREDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSHLGY+KRVPL+ YRAQRRGGKGRSG+  RDEDFVT LF+++THT VLFFSS G VYK
Sbjct: 541 TVSHLGYIKRVPLTTYRAQRRGGKGRSGMTTRDEDFVTRLFVLNTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+P +RGKALIN+L L  GERITTIMP PEDE+SW+NL V+F+T  G VRRN
Sbjct: 601 EKVWRLPIGTPTSRGKALINMLPLEPGERITTIMPLPEDETSWDNLDVMFSTTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDF+Q+NR+GKIAMKL +  DEILSVETCT+ +D+LLTT LGQC+RF +S +RVFAGR
Sbjct: 661 KLSDFVQVNRNGKIAMKLEEEGDEILSVETCTEHDDVLLTTALGQCIRFQVSDVRVFAGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NS+GVRGISLA GD +ISM IV H DA+  ER  Y+K  +++RR  +G+ EEI  +  + 
Sbjct: 721 NSIGVRGISLASGDSIISMTIVNHVDAEPWERAAYLKRSTSERRSTTGEEEEIALVGEEV 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           + EG +S+ER +ELK  EQF+LTVSEKGFGKR+SSYDFRIS R GKGIRATD SK  EIG
Sbjct: 781 TEEGQLSDERYEELKALEQFVLTVSEKGFGKRSSSYDFRISGRGGKGIRATDTSKTAEIG 840

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FPV D++QI+LVSD G LIRVPV  IRIASRATKGV IFSTAKDE+VVSVERI E
Sbjct: 841 ELVAAFPVEDSNQIMLVSDGGQLIRVPVGGIRIASRATKGVTIFSTAKDEKVVSVERISE 900

Query: 900 SEIVDEAESTE 910
            E  D+A   +
Sbjct: 901 PEGDDDAVEAD 911



 Score = 50.9 bits (120), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 51/138 (36%), Gaps = 6/138 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFI-----QINRSGKIAMKLDSRDEILSVETCTQENDILLT 699
             +V+  ++ G  +R+   DF                K     E+++       N I+L 
Sbjct: 798 EQFVLTVSEKGFGKRSSSYDFRISGRGGKGIRATDTSKTAEIGELVAAFPVEDSNQIMLV 857

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  GQ +R P+  IR  A R + GV   S AK ++V+S+  +   + D D      +   
Sbjct: 858 SDGGQLIRVPVGGIR-IASRATKGVTIFSTAKDEKVVSVERISEPEGDDDAVEADAEDGV 916

Query: 760 AQRRLISGDTEEITSLKN 777
                     E   + + 
Sbjct: 917 PNGEAEVPAGEAEGTSEE 934


>gi|256369524|ref|YP_003107034.1| DNA gyrase subunit A [Brucella microti CCM 4915]
 gi|255999686|gb|ACU48085.1| DNA gyrase subunit A [Brucella microti CCM 4915]
          Length = 922

 Score = 1002 bits (2589), Expect = 0.0,   Method: Composition-based stats.
 Identities = 594/892 (66%), Positives = 725/892 (81%), Gaps = 2/892 (0%)

Query: 16  ITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCA 75
           I  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M +M + +N+ Y K A
Sbjct: 12  IEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAMNEMNLAYNRPYRKSA 71

Query: 76  RISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRL 135
            + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+GQGNFGS+DGDPPAA RYTECRL
Sbjct: 72  GVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLIDGQGNFGSIDGDPPAAMRYTECRL 131

Query: 136 QKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNL 195
           +K    LL D+ KDTV+F+ NYDG  QEPVVL AR+PN+LVNG GGIAVGMATNIP HNL
Sbjct: 132 EKVTKSLLSDIDKDTVNFQDNYDGREQEPVVLPARFPNLLVNGSGGIAVGMATNIPPHNL 191

Query: 196 GEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSH 255
           GEV+DGCVA+IDNP I+L  LME+I GPDFPTG +ILGR GI +AY TGRGS+++RG + 
Sbjct: 192 GEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIILGRNGINSAYTTGRGSVIMRGRAT 251

Query: 256 IEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELK 315
           IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KRI  I+DLRDESDR+GYRVV+ELK
Sbjct: 252 IEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKRIDGISDLRDESDREGYRVVVELK 311

Query: 316 RGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKY 375
           R A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFVAFREEVV RRTK+
Sbjct: 312 RDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRAFVAFREEVVTRRTKF 371

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
           LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P TAR +LM+R W A D+  LI LID
Sbjct: 372 LLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPATAREQLMERRWPAVDVAPLIRLID 431

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRS 495
           D  +T+  D T  LSE Q RAIL+LRL RLT LGRD++ +ELN +G EI++ LDIL SR 
Sbjct: 432 DPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDEVADELNKIGEEIRDYLDILGSRL 491

Query: 496 RLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSV 555
           R++ I+K+E+++V+DE  TPRRT I  G  +M+DED I REDMVVTVSH GY+KRVPL+ 
Sbjct: 492 RVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDLIAREDMVVTVSHAGYIKRVPLTT 551

Query: 556 YRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARG 615
           YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFFSS G VYKEKVWRLP+G+PQ+RG
Sbjct: 552 YRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFFSSRGIVYKEKVWRLPVGTPQSRG 611

Query: 616 KALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIA 675
           KALIN+L L QGERITTIMP PEDE SW NL V+F+T  G VRRNKLSDF+Q+NR+GKIA
Sbjct: 612 KALINMLPLQQGERITTIMPLPEDEDSWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIA 671

Query: 676 MKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQ 734
           MKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++ +RVFAGRNS+GVRGI+LA+GD+
Sbjct: 672 MKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDK 731

Query: 735 VISMAIVLHADADYDERICYMKHMSAQRRLISGDT-EEITSLKNDSSVEGNISEERCQEL 793
           VISMAI+ H DA   ER  Y+K   A+RR    D  ++I  +  D   E  +SE+R QEL
Sbjct: 732 VISMAILHHVDATPAERSAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQEL 791

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
           K +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRATD SK +EIG LVA+FPV  +DQI
Sbjct: 792 KAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQI 851

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           +LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+VVSVERI +++  +E
Sbjct: 852 LLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEKVVSVERISDADSDEE 903



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 798 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 857

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 858 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 916

Query: 763 RLISGD 768
              + +
Sbjct: 917 PAGTQE 922


>gi|325292861|ref|YP_004278725.1| DNA gyrase subunit A [Agrobacterium sp. H13-3]
 gi|325060714|gb|ADY64405.1| DNA gyrase subunit A [Agrobacterium sp. H13-3]
          Length = 930

 Score = 1001 bits (2588), Expect = 0.0,   Method: Composition-based stats.
 Identities = 626/909 (68%), Positives = 756/909 (83%), Gaps = 1/909 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+       +   GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+GM
Sbjct: 1   MTDQSPPGGGKLPPGIEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYGM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            ++G++WNKKYVKCAR++G+VMGK+HPHGNAAIYDALARMAQDWSLRL LI+GQGNFGS+
Sbjct: 61  SELGIDWNKKYVKCARVTGDVMGKFHPHGNAAIYDALARMAQDWSLRLPLIDGQGNFGSI 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAAERYTECRL+KAAH LLDDL K+TVDFR NYDG+  EPVV+ A++PN+LVNG G
Sbjct: 121 DGDPPAAERYTECRLEKAAHSLLDDLDKETVDFRDNYDGTLHEPVVIPAKFPNLLVNGAG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNL EV+DGC+A+IDNP I+L  LM+II GPDFPTGA+I+GR+GI++A
Sbjct: 181 GIAVGMATNIPPHNLSEVIDGCIALIDNPAIELLELMQIISGPDFPTGALIMGRSGIRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGS+++RG + IE   GDREQI++TE+PYQVNKA M+EK+AELV+EKRI  I+DLR
Sbjct: 241 YETGRGSVIMRGRATIEPMRGDREQIIITEVPYQVNKATMIEKMAELVKEKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVV+ELKR A+A+VILNQ+YRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRQGYRVVVELKRDANAEVILNQIYRYTPLQTSFGCNMVALNGGKPEQMTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FRE+VV RRTKYLL KARDRAHVLVGLAI+VAN+DEV+R+IR +P+P +AR ELM R
Sbjct: 361 FVSFREDVVSRRTKYLLRKARDRAHVLVGLAISVANIDEVIRVIRHAPDPASAREELMTR 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D++ LI LIDD  + I  DGT  LSE Q RAILELRLARLT LGRD+I +ELN +
Sbjct: 421 RWPAQDVESLIRLIDDPRHRINEDGTYNLSEEQARAILELRLARLTALGRDEIGDELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EI E L+ILSSR R++ I+K EL++++DE  TPRR+ IVEG  DM+DED I REDMVV
Sbjct: 481 GAEISEYLEILSSRLRIMQIVKDELIAIRDEFGTPRRSEIVEGGPDMDDEDLISREDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSHLGY+KRVPL+ YRAQRRGGKGRSG+  RDEDFV  LF+ +THT VLFFSS G VYK
Sbjct: 541 TVSHLGYIKRVPLTTYRAQRRGGKGRSGMATRDEDFVNRLFVANTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+PQ++GKALIN+L L  GERITTIMP PEDE++W  L V+F+T  G VRRN
Sbjct: 601 EKVWRLPIGTPQSKGKALINMLPLEPGERITTIMPLPEDETTWETLDVMFSTTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KL DF+Q+NR+GKIAMKL +  DEILSVETCT ++D+LLTT LGQC+RFP+  +RVFAGR
Sbjct: 661 KLGDFVQVNRNGKIAMKLEEEGDEILSVETCTDQDDVLLTTALGQCIRFPVDDVRVFAGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NSVGVRGI++A GD++ISM IV H +A+  ER  Y+K  + +RR    D E+I  +  + 
Sbjct: 721 NSVGVRGINMADGDRIISMTIVGHVEAEPWERAAYLKRSATERRAAGVDEEDIALVGEEV 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           + EG +SEER QELK +E+F+LTVSEKG+GKR+SSYDFR S R GKGIRATD SK  EIG
Sbjct: 781 AEEGELSEERYQELKAREEFVLTVSEKGYGKRSSSYDFRTSGRGGKGIRATDTSKTTEIG 840

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FPV++ DQI+LVSD G LIRVPVN IRIASRATKGV IFSTAKDE+VVSVERI E
Sbjct: 841 ELVAAFPVDEGDQIMLVSDGGQLIRVPVNGIRIASRATKGVTIFSTAKDEKVVSVERINE 900

Query: 900 SEIVDEAES 908
            E  +EAE+
Sbjct: 901 PEGDEEAEN 909



 Score = 53.3 bits (126), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/134 (20%), Positives = 54/134 (40%), Gaps = 6/134 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFIQINR-----SGKIAMKLDSRDEILSVETCTQENDILLT 699
             +V+  ++ G  +R+   DF    R           K     E+++     + + I+L 
Sbjct: 798 EEFVLTVSEKGYGKRSSSYDFRTSGRGGKGIRATDTSKTTEIGELVAAFPVDEGDQIMLV 857

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  GQ +R P++ IR  A R + GV   S AK ++V+S+  +   + D +      + ++
Sbjct: 858 SDGGQLIRVPVNGIR-IASRATKGVTIFSTAKDEKVVSVERINEPEGDEEAENGNGEDVA 916

Query: 760 AQRRLISGDTEEIT 773
                     E   
Sbjct: 917 DTLPDTPEAPESEA 930


>gi|265984159|ref|ZP_06096894.1| hypothetical protein BAKG_00488 [Brucella sp. 83/13]
 gi|264662751|gb|EEZ33012.1| hypothetical protein BAKG_00488 [Brucella sp. 83/13]
          Length = 922

 Score = 1001 bits (2587), Expect = 0.0,   Method: Composition-based stats.
 Identities = 592/892 (66%), Positives = 723/892 (81%), Gaps = 2/892 (0%)

Query: 16  ITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCA 75
           I  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M +M + +N+ Y K A
Sbjct: 12  IEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAMNEMNLAYNRPYRKSA 71

Query: 76  RISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRL 135
            + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+GQGNFGS+DGDPPAA RYTECRL
Sbjct: 72  GVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLIDGQGNFGSIDGDPPAAMRYTECRL 131

Query: 136 QKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNL 195
           +K    LL D+ KDTV+F+ NYDG  QEPVVL AR+PN+LVNG GGIAVGMATNIP HNL
Sbjct: 132 EKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFPNLLVNGSGGIAVGMATNIPPHNL 191

Query: 196 GEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSH 255
           GEV+DGCVA+IDNP I+L  LME+I GPDFPTG +ILGR GI +AY TGRGS+++RG + 
Sbjct: 192 GEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIILGRNGINSAYTTGRGSVIMRGRAT 251

Query: 256 IEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELK 315
           IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KRI  I+DLRDESDR+GYRVV+ELK
Sbjct: 252 IEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKRIDGISDLRDESDREGYRVVVELK 311

Query: 316 RGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKY 375
           R A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFVAFREEVV RRTK+
Sbjct: 312 RDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRAFVAFREEVVTRRTKF 371

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
           LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P TAR +LM+R W A D+  LI LID
Sbjct: 372 LLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPATAREQLMERRWPAVDVAPLIRLID 431

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRS 495
           D  +T+  D T  LSE Q RAIL+LRL RLT LGRD++ +ELN +G EI++ LDIL SR 
Sbjct: 432 DPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDEVADELNKIGEEIRDYLDILGSRL 491

Query: 496 RLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSV 555
           R++ I+K+E+++V+DE  TPRRT I  G  +M+DED I REDMVVTVSH GY+KRVPL+ 
Sbjct: 492 RVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDLIAREDMVVTVSHAGYIKRVPLTT 551

Query: 556 YRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARG 615
           YRAQRRGGKGRSG+  ++EDFVT LF+ ++HT VLFFSS G VYKEKVWRLP+G+PQ+RG
Sbjct: 552 YRAQRRGGKGRSGMTTKEEDFVTRLFVANSHTPVLFFSSRGIVYKEKVWRLPVGTPQSRG 611

Query: 616 KALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIA 675
           KALIN+L L QGERITTIMP PEDE SW NL V+F+T  G VRRNKLSDF+Q+NR+GKIA
Sbjct: 612 KALINMLPLQQGERITTIMPLPEDEDSWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIA 671

Query: 676 MKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQ 734
           MKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++ +RVFAGRNS+GVRGI LA+GD+
Sbjct: 672 MKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGIKLAEGDK 731

Query: 735 VISMAIVLHADADYDERICYMKHMSAQRRLISGDT-EEITSLKNDSSVEGNISEERCQEL 793
           VISMAI+ H DA   ER  Y+K   A+RR    D  ++I  +  D   E  +SE+R QEL
Sbjct: 732 VISMAILHHVDATPAERSAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQEL 791

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
           K +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRATD SK +EIG LVA+FPV  +DQI
Sbjct: 792 KAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQI 851

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           +LVSD G LIRVPV+ IRIA R+TKGV IF+ A  E+VVSVERI +++  +E
Sbjct: 852 LLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNMADGEKVVSVERISDADSDEE 903



 Score = 54.4 bits (129), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 56/126 (44%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 798 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 857

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   ++A G++V+S+  +  AD+D +             
Sbjct: 858 GQLIRVPVDGIR-IAGRSTKGVTIFNMADGEKVVSVERISDADSDEENGNGGDAAPEGDT 916

Query: 763 RLISGD 768
              + +
Sbjct: 917 PAATQE 922


>gi|261325188|ref|ZP_05964385.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261301168|gb|EEY04665.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 922

 Score = 1000 bits (2586), Expect = 0.0,   Method: Composition-based stats.
 Identities = 592/892 (66%), Positives = 724/892 (81%), Gaps = 2/892 (0%)

Query: 16  ITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCA 75
           I  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M +M + +N+ Y K A
Sbjct: 12  IEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAMNEMNLAYNRPYRKSA 71

Query: 76  RISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRL 135
            + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+GQGNFGS+DGDPPAA RYTECRL
Sbjct: 72  GVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLIDGQGNFGSIDGDPPAAMRYTECRL 131

Query: 136 QKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNL 195
           +K    LL D+ KDTV+F+ NYDG  QEPVVL AR+PN+LVNG GGIAVGMATNIP HNL
Sbjct: 132 EKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFPNLLVNGSGGIAVGMATNIPPHNL 191

Query: 196 GEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSH 255
           GEV+DGCVA+IDNP I+L  LME+I GPDFPTG +ILGR GI +AY TGRGS+++RG + 
Sbjct: 192 GEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIILGRNGINSAYTTGRGSVIMRGRAT 251

Query: 256 IEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELK 315
           IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KRI  I+DLRDESDR+GYRVV+ELK
Sbjct: 252 IEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKRIDGISDLRDESDREGYRVVVELK 311

Query: 316 RGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKY 375
           R A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFVAFREEVV RRTK+
Sbjct: 312 RDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRAFVAFREEVVTRRTKF 371

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
           LLNKARDRAH+LVGLAIAVAN+DEV+ +IR +P+P TAR +LM+R W A D+  LI LID
Sbjct: 372 LLNKARDRAHMLVGLAIAVANIDEVIALIRRAPDPATAREQLMERRWPAVDVAPLIRLID 431

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRS 495
           D  +T+  D T  LSE Q RAIL+LRL RLT LGRD++ +ELN +G EI++ LDIL SR 
Sbjct: 432 DPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDEVADELNKIGEEIRDYLDILGSRL 491

Query: 496 RLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSV 555
           R++ I+K+E+++V+DE  TPRRT I  G  +M+DED I REDMVVTVSH GY+KRVPL+ 
Sbjct: 492 RVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDLIAREDMVVTVSHAGYIKRVPLTT 551

Query: 556 YRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARG 615
           YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFFSS G VYKEKVWRLP+G+PQ+RG
Sbjct: 552 YRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFFSSRGIVYKEKVWRLPVGTPQSRG 611

Query: 616 KALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIA 675
           KALIN+L L QGERITTIMP PEDE SW NL V+F+T  G VRRNKLSDF+Q+NR+GKIA
Sbjct: 612 KALINMLPLQQGERITTIMPLPEDEDSWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIA 671

Query: 676 MKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQ 734
           MKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++ +RVFAGRNS+GVRGI+LA+GD+
Sbjct: 672 MKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDK 731

Query: 735 VISMAIVLHADADYDERICYMKHMSAQRRLISGDT-EEITSLKNDSSVEGNISEERCQEL 793
           VISMAI+ H DA   ER  Y+K   A+RR    D  ++I  +  D   E  +SE+R QEL
Sbjct: 732 VISMAILHHVDATPAERSAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQEL 791

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
           K +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRATD  K +EIG LVA+FPV  +DQI
Sbjct: 792 KAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTLKTDEIGKLVALFPVEGSDQI 851

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           +LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+VVSVERI +++  +E
Sbjct: 852 LLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEKVVSVERISDADSDEE 903



 Score = 54.8 bits (130), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDFI-----QINRSGKIAMKLDSRDEILSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F               +K D   +++++      + ILL +  
Sbjct: 798 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTLKTDEIGKLVALFPVEGSDQILLVSDG 857

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 858 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 916

Query: 763 RLISGD 768
              + +
Sbjct: 917 PAATQE 922


>gi|260168805|ref|ZP_05755616.1| DNA gyrase subunit A [Brucella sp. F5/99]
 gi|261758289|ref|ZP_06001998.1| DNA gyrase subunit A [Brucella sp. F5/99]
 gi|261738273|gb|EEY26269.1| DNA gyrase subunit A [Brucella sp. F5/99]
          Length = 922

 Score = 1000 bits (2584), Expect = 0.0,   Method: Composition-based stats.
 Identities = 593/892 (66%), Positives = 725/892 (81%), Gaps = 2/892 (0%)

Query: 16  ITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCA 75
           I  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M +M + +N+ Y K A
Sbjct: 12  IEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAMNEMNLAYNRPYRKSA 71

Query: 76  RISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRL 135
            + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+GQGNFGS+DGDPPAA RYTECRL
Sbjct: 72  GVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLIDGQGNFGSIDGDPPAAMRYTECRL 131

Query: 136 QKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNL 195
           +K    LL D+ KDTV+F+ NYDG  QEPVV+ AR+PN+LVNG GGIAVGMATNIP HNL
Sbjct: 132 EKVTESLLSDIDKDTVNFQDNYDGREQEPVVVPARFPNLLVNGSGGIAVGMATNIPPHNL 191

Query: 196 GEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSH 255
           GEV+DGCVA+IDNP I+L  LME+I GPDFPTG +ILGR GI +AY TGRGS+++RG + 
Sbjct: 192 GEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIILGRNGINSAYTTGRGSVIMRGRAT 251

Query: 256 IEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELK 315
           IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KRI  I+DLRDESDR+GYRVV+ELK
Sbjct: 252 IEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKRIDGISDLRDESDREGYRVVVELK 311

Query: 316 RGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKY 375
           R A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFVAFREEVV RRTK+
Sbjct: 312 RDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRAFVAFREEVVTRRTKF 371

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
           LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P TAR +LM+R W A D+  LI LID
Sbjct: 372 LLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPATAREQLMERRWPAVDVAPLIRLID 431

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRS 495
           D  +T+  D T  LSE Q RAIL+LRL RLT LGRD++ +ELN +G EI++ LDIL SR 
Sbjct: 432 DPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDEVADELNKIGEEIRDYLDILGSRL 491

Query: 496 RLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSV 555
           R++ I+K+E+++V+DE  TPRRT I  G  +M+DED I REDMVVTVSH GY+KRVPL+ 
Sbjct: 492 RVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDLIAREDMVVTVSHAGYIKRVPLTT 551

Query: 556 YRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARG 615
           YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFFSS G VYKEKVWRLP+G+PQ+RG
Sbjct: 552 YRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFFSSRGIVYKEKVWRLPVGTPQSRG 611

Query: 616 KALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIA 675
           KALIN+L L QGERITTIMP PEDE SW NL V+F+T  G VRRNKLSDF+Q+NR+GKIA
Sbjct: 612 KALINMLPLQQGERITTIMPLPEDEDSWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIA 671

Query: 676 MKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQ 734
           MKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++ +RVFAGRNS+GVRGI+LA+GD+
Sbjct: 672 MKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDK 731

Query: 735 VISMAIVLHADADYDERICYMKHMSAQRRLISGDT-EEITSLKNDSSVEGNISEERCQEL 793
           VISMAI+ H DA   ER  Y+K   A+RR    D  ++I  +  D   E  +SE+R QEL
Sbjct: 732 VISMAILHHVDATPAERSAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQEL 791

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
           K +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRATD SK +EIG LVA+FPV  +DQI
Sbjct: 792 KAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQI 851

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           +LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+VVSVERI +++  +E
Sbjct: 852 LLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEKVVSVERISDADSDEE 903



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 798 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 857

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 858 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 916

Query: 763 RLISGD 768
              + +
Sbjct: 917 PAATQE 922


>gi|222148750|ref|YP_002549707.1| DNA gyrase subunit A [Agrobacterium vitis S4]
 gi|221735736|gb|ACM36699.1| DNA gyrase A subunit [Agrobacterium vitis S4]
          Length = 930

 Score =  998 bits (2581), Expect = 0.0,   Method: Composition-based stats.
 Identities = 627/908 (69%), Positives = 751/908 (82%), Gaps = 2/908 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MTE      +     I  +SI  EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRILFGM
Sbjct: 1   MTEQSTPGGKMPSD-IEPISIITEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILFGM 59

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            ++G++WNKKYVKCAR++G+VMGK+HPHGN+AIYDALARMAQDWSLRL LI+GQGNFGS+
Sbjct: 60  SELGIDWNKKYVKCARVTGDVMGKFHPHGNSAIYDALARMAQDWSLRLPLIDGQGNFGSI 119

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAAERYTECRLQKAAH LLDDL KDTVDFR NYDG+  EPVV+ A++PN+LVNG G
Sbjct: 120 DGDPPAAERYTECRLQKAAHSLLDDLDKDTVDFRDNYDGTLSEPVVVPAKFPNLLVNGAG 179

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNL EV++GC+A+I+NP IDL  LM+II GPDFPTGA+ILGR+GI++A
Sbjct: 180 GIAVGMATNIPPHNLVEVINGCIALIENPAIDLPELMQIIPGPDFPTGALILGRSGIRSA 239

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGS+++RGV+ IE   GDREQI++TEIPYQVNK+ M+EK+AELVR+KRI  I+DLR
Sbjct: 240 YETGRGSVIMRGVARIEPMRGDREQIIITEIPYQVNKSTMIEKMAELVRDKRIEGISDLR 299

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVV+ELKR A+ADVILNQLYRYT LQS F  NMVALNG KPE+ TL+ +L+A
Sbjct: 300 DESDRQGYRVVVELKRDANADVILNQLYRYTPLQSSFGCNMVALNGGKPEQLTLLDMLRA 359

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FREEV+ RRTKYLL KARDRAHVLVGLAIAVAN+DEV+R+IR +P+P+TAR +LM+R
Sbjct: 360 FVSFREEVISRRTKYLLRKARDRAHVLVGLAIAVANIDEVIRLIRQAPDPQTAREQLMER 419

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A+D++ LI LIDD  + I  D T  LSE Q RAILELRLARLT LGRD+I  ELN +
Sbjct: 420 RWPAADVESLIRLIDDPRHRINEDNTYNLSEEQARAILELRLARLTALGRDEIDEELNKI 479

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EI + LDILSSR+R+  I+  EL++V+DE  TPRR++I+EG  DM+DED I REDMVV
Sbjct: 480 GAEISDYLDILSSRTRIQTIVVDELVAVRDEFGTPRRSQIMEGGPDMDDEDLIAREDMVV 539

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSHLGY+KRVPL  YRAQRRGGKGRSG+  RDEDFVT LF+ +THT VLFFSS G VYK
Sbjct: 540 TVSHLGYIKRVPLVTYRAQRRGGKGRSGMATRDEDFVTRLFVANTHTPVLFFSSRGIVYK 599

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+PQ+RGKALIN+L L  GERITTIMP PEDE+SW+NL V+F+T  G VRRN
Sbjct: 600 EKVWRLPIGTPQSRGKALINMLPLEPGERITTIMPLPEDEASWDNLDVMFSTTRGTVRRN 659

Query: 661 KLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDF+Q+NR+GKIAMKL +  DEILSVETCT ++D+LLTT LGQ +RFP+  +RVFAGR
Sbjct: 660 KLSDFVQVNRNGKIAMKLEEEGDEILSVETCTIDDDVLLTTALGQAIRFPVDEVRVFAGR 719

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NS+GVRGISL   D++ISM I+ H DA+  +R  Y+K  + +RR    D ++I  +  + 
Sbjct: 720 NSIGVRGISLQPNDRIISMTILSHVDAEPWQRAAYLKRSATERRASGVDEDDIALVGEEV 779

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
              G++SEER QELK +EQF+LT+SE+G GKR+SSYDFR S R GKGIRATD SK  EIG
Sbjct: 780 GEIGDLSEERYQELKAREQFVLTISERGIGKRSSSYDFRTSGRGGKGIRATDTSKTLEIG 839

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FPV D DQI+LVSD G LIRVPV+ IRIASRATKGV IF+TAKDE+VVSVERI E
Sbjct: 840 QLVAAFPVEDKDQIMLVSDGGQLIRVPVDGIRIASRATKGVTIFNTAKDEKVVSVERINE 899

Query: 900 SEIVDEAE 907
            E  ++ E
Sbjct: 900 PEGEEDGE 907



 Score = 51.7 bits (122), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 54/136 (39%), Gaps = 8/136 (5%)

Query: 645 NLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEI------LSVETCTQENDILL 698
             +V+  ++ G  +R+   DF      G   ++     +       ++      ++ I+L
Sbjct: 797 EQFVLTISERGIGKRSSSYDFRTS-GRGGKGIRATDTSKTLEIGQLVAAFPVEDKDQIML 855

Query: 699 TTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHM 758
            +  GQ +R P+  IR  A R + GV   + AK ++V+S+  +   + + D  I      
Sbjct: 856 VSDGGQLIRVPVDGIR-IASRATKGVTIFNTAKDEKVVSVERINEPEGEEDGEIGAETSA 914

Query: 759 SAQRRLISGDTEEITS 774
                  +   +E  +
Sbjct: 915 EEGVATDTATPDESAT 930


>gi|261222265|ref|ZP_05936546.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260920849|gb|EEX87502.1| conserved hypothetical protein [Brucella ceti B1/94]
          Length = 922

 Score =  998 bits (2581), Expect = 0.0,   Method: Composition-based stats.
 Identities = 593/892 (66%), Positives = 724/892 (81%), Gaps = 2/892 (0%)

Query: 16  ITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCA 75
           I  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M +M + +N+ Y K A
Sbjct: 12  IEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAMNEMNLAYNRPYRKSA 71

Query: 76  RISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRL 135
            + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  LI+GQGNFGS+DGDPPAA RYTECRL
Sbjct: 72  GVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLIDGQGNFGSIDGDPPAAMRYTECRL 131

Query: 136 QKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNL 195
           +K    LL D+ KDTV+F+ NYDG  QEPVVL AR+PN+LVNG GGIAVGMATNI  HNL
Sbjct: 132 EKVTESLLSDIDKDTVNFQDNYDGREQEPVVLPARFPNLLVNGSGGIAVGMATNILPHNL 191

Query: 196 GEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSH 255
           GEV+DGCVA+IDNP I+L  LME+I GPDFPTG +ILGR GI +AY TGRGS+++RG + 
Sbjct: 192 GEVIDGCVALIDNPAIELSELMELIPGPDFPTGGIILGRNGINSAYTTGRGSVIMRGRAT 251

Query: 256 IEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELK 315
           IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KRI  I+DLRDESDR+GYRVV+ELK
Sbjct: 252 IEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKRIDGISDLRDESDREGYRVVVELK 311

Query: 316 RGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKY 375
           R A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFVAFREEVV RRTK+
Sbjct: 312 RDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRAFVAFREEVVTRRTKF 371

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
           LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P TAR +LM+R W A D+  LI LID
Sbjct: 372 LLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPATAREQLMERRWPAVDVAPLIRLID 431

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRS 495
           D  +T+  D T  LSE Q RAIL+LRL RLT LGRD++ +ELN +G EI++ LDIL SR 
Sbjct: 432 DPRHTLNEDNTYNLSEEQARAILDLRLQRLTALGRDEVADELNKIGEEIRDYLDILGSRL 491

Query: 496 RLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSV 555
           R++ I+K+E+++V+DE  TPRRT I  G  +M+DED I REDMVVTVSH GY+KRVPL+ 
Sbjct: 492 RVMNIVKEEMIAVRDEFATPRRTEIGFGGAEMDDEDLIAREDMVVTVSHAGYIKRVPLTT 551

Query: 556 YRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARG 615
           YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFFSS G VYKEKVWRLP+G+PQ+RG
Sbjct: 552 YRAQRRGGKGRSGMATKEEDFVTRLFVANTHTPVLFFSSRGIVYKEKVWRLPVGTPQSRG 611

Query: 616 KALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIA 675
           KALIN+L L QGERITTIMP PEDE SW NL V+F+T  G VRRNKLSDF+Q+NR+GKIA
Sbjct: 612 KALINMLPLQQGERITTIMPLPEDEDSWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIA 671

Query: 676 MKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQ 734
           MKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++ +RVFAGRNS+GVRGI+LA+GD+
Sbjct: 672 MKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDK 731

Query: 735 VISMAIVLHADADYDERICYMKHMSAQRRLISGDT-EEITSLKNDSSVEGNISEERCQEL 793
           VISMAI+ H DA   ER  Y+K   A+RR    D  ++I  +  D   E  +SE+R QEL
Sbjct: 732 VISMAILHHVDATPAERSAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQEL 791

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
           K +E+ +LTVSE G+GKR+SSY+FRIS R GKGIRATD SK +EIG LVA+FPV  +DQI
Sbjct: 792 KAREETVLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQI 851

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           +LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+VVSVERI +++  +E
Sbjct: 852 LLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEKVVSVERISDADSDEE 903



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 798 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 857

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 858 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 916

Query: 763 RLISGD 768
              + +
Sbjct: 917 PAATQE 922


>gi|49474366|ref|YP_032408.1| DNA gyrase subunit A [Bartonella quintana str. Toulouse]
 gi|49239870|emb|CAF26268.1| DNA gyrase subunit a [Bartonella quintana str. Toulouse]
          Length = 925

 Score =  998 bits (2579), Expect = 0.0,   Method: Composition-based stats.
 Identities = 580/911 (63%), Positives = 714/911 (78%), Gaps = 1/911 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+     + +   GI  +SI DEMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M
Sbjct: 1   MTDFNPLPERDVLTGIEPISIIDEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            +MG+ +NK Y K A + GEVMGK+HPHG+A+IYDAL RMAQD+SLR  LI+GQGNFGSV
Sbjct: 61  NEMGLAFNKPYRKSAGVVGEVMGKFHPHGDASIYDALVRMAQDFSLRNPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTECRL+K +  LL D+ KDTVDF+ NYDG  +EPVVL AR+PN+LVNG G
Sbjct: 121 DGDPPAAMRYTECRLEKVSEELLADIDKDTVDFQDNYDGRDREPVVLPARFPNLLVNGSG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEVVD C+A+ID+P+I LD ++EII GPDFPTG +ILG +GI++A
Sbjct: 181 GIAVGMATNIPPHNLGEVVDACIALIDDPNIALDKIIEIIPGPDFPTGGIILGHSGIRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGSI++R    IE+    R+ I+V+EIPYQVNKA M+EK+AELVR+KRI  I+DLR
Sbjct: 241 YETGRGSIIMRAKVDIEEMHNGRQAIIVSEIPYQVNKATMIEKMAELVRDKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR GYRVVIELK+   A+V+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRDGYRVVIELKKDVIAEVVLNQLYRYTLLQTSFGCNMVALNGGKPEQMTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FREEVV RRTKYLL KAR+RAHVLVGLA+AVAN+DE++ +IR + +P+ AR +LM+R
Sbjct: 361 FVSFREEVVSRRTKYLLRKARERAHVLVGLALAVANIDEIIALIRKASDPQIARSQLMER 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A+D+  LI LIDD  + I  D T  LSE Q RAILELRL RLT LGRD+I +ELN +
Sbjct: 421 RWLAADVASLIKLIDDPRHIIYGDNTYNLSEEQARAILELRLQRLTALGRDEIADELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G++I + L IL+SRSR++ I+K EL  +++   TPRRT    G  +M+ ED I  EDMVV
Sbjct: 481 GVDIADYLHILASRSRIMSIVKDELNVLREAFATPRRTIFGFGSAEMDCEDLIAPEDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSH GY+KRVPL+ YRAQRRGGKGRSG+  +DEDFVT LF+V+THT VLFFS+ G VYK
Sbjct: 541 TVSHSGYIKRVPLNTYRAQRRGGKGRSGMSTKDEDFVTHLFVVNTHTPVLFFSTRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+PQ+RG+ALIN+L L QGERITTIMP PEDE+SW+ L V+FAT  G VRRN
Sbjct: 601 EKVWRLPIGTPQSRGRALINMLPLQQGERITTIMPLPEDEASWSALDVMFATTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
           KLSDF+Q+NR+GKIAMKLD  DEILSVETCT+ +D++LTT  GQC+RFP+  +R+FAGRN
Sbjct: 661 KLSDFVQVNRNGKIAMKLDEEDEILSVETCTEHDDVVLTTANGQCIRFPVVEVRIFAGRN 720

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEI-TSLKNDS 779
           SVGVRGI+L  GD+VISM ++ H +A   ER  Y+K +  +RR    D E+I    +ND 
Sbjct: 721 SVGVRGINLTNGDKVISMTLLEHVEATSVERSAYIKRVIHERRAAGADAEDILVLDENDV 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
             E  +++ER  EL  +EQ +LT+SE G+GKR+SSY+FRIS R GKGIRATD SK  EIG
Sbjct: 781 GTETELTDERYAELNAREQMLLTLSEFGYGKRSSSYEFRISGRGGKGIRATDPSKTAEIG 840

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FPV   DQI+LVSD G LIRVPV+ IRI  R+TKGV IF+TA+ ++VVSVERI E
Sbjct: 841 KLVAAFPVKAQDQIMLVSDGGQLIRVPVDGIRIGGRSTKGVKIFNTAEGKKVVSVERISE 900

Query: 900 SEIVDEAESTE 910
           SE        E
Sbjct: 901 SEDDVSQLDDE 911


>gi|153009512|ref|YP_001370727.1| DNA gyrase subunit A [Ochrobactrum anthropi ATCC 49188]
 gi|151561400|gb|ABS14898.1| DNA gyrase, A subunit [Ochrobactrum anthropi ATCC 49188]
          Length = 923

 Score =  996 bits (2576), Expect = 0.0,   Method: Composition-based stats.
 Identities = 590/896 (65%), Positives = 722/896 (80%), Gaps = 2/896 (0%)

Query: 16  ITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCA 75
           I  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M +M + +N+ Y K A
Sbjct: 12  IEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAMNEMNLAYNRPYRKSA 71

Query: 76  RISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRL 135
            + GEVMGKYHPHG+A+IYDAL RMAQD+S+R  L++GQGNFGS+DGDPPAA RYTECRL
Sbjct: 72  GVVGEVMGKYHPHGDASIYDALVRMAQDFSMRDPLVDGQGNFGSIDGDPPAAMRYTECRL 131

Query: 136 QKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNL 195
           +K    +L D+ KDTVDF+ NYDG  QEPVV+ AR+PN+LVNG GGIAVGMATNIP HNL
Sbjct: 132 EKLTESILSDIDKDTVDFQDNYDGREQEPVVMPARFPNLLVNGSGGIAVGMATNIPPHNL 191

Query: 196 GEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSH 255
           GEV+DGCVA+I+NP I L+ ++EII GPDFPTG +ILGR GI +AY TGRGS+++RG + 
Sbjct: 192 GEVIDGCVALIENPAIQLEEMIEIIPGPDFPTGGIILGRAGINSAYTTGRGSVIMRGRAT 251

Query: 256 IEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELK 315
           IE   GDRE I++TEIPYQVNKA+M+EK+AELVR+KRI  I+DLRDESDR+GYRVV+ELK
Sbjct: 252 IEPMRGDREAIIITEIPYQVNKASMIEKMAELVRDKRIEGISDLRDESDREGYRVVVELK 311

Query: 316 RGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKY 375
           R A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+  L+ +L+AFVAFREEVV RRTK+
Sbjct: 312 RDAVADVVLNQLYRYTPLQTSFGCNMVALNGGKPEQLNLLDMLRAFVAFREEVVTRRTKF 371

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
           LLNKARDRAHVLVGLAIAVAN+DEV+ +IR +P+P TAR +LM+R W A D+  LI LID
Sbjct: 372 LLNKARDRAHVLVGLAIAVANIDEVIALIRRAPDPTTAREQLMERRWPAVDVAPLIRLID 431

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRS 495
           D  + I  D T  LSE Q RAIL+LRL RLT LGRD++ +ELN +G EI++ LDILSSR 
Sbjct: 432 DPRHRINEDDTYNLSEEQARAILDLRLQRLTALGRDEVADELNKIGEEIRDYLDILSSRL 491

Query: 496 RLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSV 555
           R++ I+K E+++V+DE  TPRRT I  G  +M+DED I REDMVVTVSH GY+KRVPL+ 
Sbjct: 492 RVMTIVKDEMIAVRDEFATPRRTEIGFGGAEMDDEDLIAREDMVVTVSHAGYIKRVPLTT 551

Query: 556 YRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARG 615
           YRAQRRGGKGRSG+  +DEDFVT LF+ +THT VLFFSS G VYKEKVWRLP+G+PQ+RG
Sbjct: 552 YRAQRRGGKGRSGMATKDEDFVTRLFVANTHTPVLFFSSRGIVYKEKVWRLPVGTPQSRG 611

Query: 616 KALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIA 675
           KALIN+L L QGERITTIMP PEDE SW NL V+F+T  G VRRNKLSDF+Q+NR+GKIA
Sbjct: 612 KALINMLPLQQGERITTIMPLPEDEESWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIA 671

Query: 676 MKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQ 734
           MKL D  DEILSV+TCT+ +D+LLT   GQC+RFP++ +RVFAGRNS+GVRGI+LA GD+
Sbjct: 672 MKLEDEGDEILSVDTCTEFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLADGDK 731

Query: 735 VISMAIVLHADADYDERICYMKHMSAQRRLISGDT-EEITSLKNDSSVEGNISEERCQEL 793
           VISMAI+ H DAD   R  Y+K   A+RR    D  ++I  +  D   +  ++EE  QEL
Sbjct: 732 VISMAILHHVDADASTRSAYLKRSIAERRAQGADDADDIVVVGEDVGTDAELTEELYQEL 791

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
           K +E+ +LTVSE G+GKR+SSY+FR+S R GKGIRATD SK +EIG LVA+FPV  +DQI
Sbjct: 792 KAREETVLTVSEYGYGKRSSSYEFRVSGRGGKGIRATDTSKTDEIGKLVALFPVEASDQI 851

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAEST 909
           +LVSD G LIRVPV+ IRIA R+TKGV IF+TA  E+VVSVERI E++  +E  S 
Sbjct: 852 LLVSDGGQLIRVPVDGIRIAGRSTKGVTIFNTADGEKVVSVERISEADSDEENGSE 907



 Score = 52.5 bits (124), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 6/127 (4%)

Query: 648 VVFATKHGNVRRNKLSDFIQINR--SGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  +++G  +R+   +F    R   G  A      DEI   +++      + ILL +  
Sbjct: 798 VLTVSEYGYGKRSSSYEFRVSGRGGKGIRATDTSKTDEIGKLVALFPVEASDQILLVSDG 857

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +           + 
Sbjct: 858 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISEADSDEENGSEGEAASEGEA 916

Query: 763 RLISGDT 769
            +   + 
Sbjct: 917 PIADTEE 923


>gi|146340928|ref|YP_001205976.1| DNA gyrase subunit A [Bradyrhizobium sp. ORS278]
 gi|146193734|emb|CAL77751.1| DNA gyrase, subunit A, type II topoisomerase [Bradyrhizobium sp.
           ORS278]
          Length = 916

 Score =  996 bits (2575), Expect = 0.0,   Method: Composition-based stats.
 Identities = 559/913 (61%), Positives = 692/913 (75%), Gaps = 5/913 (0%)

Query: 1   MTE--HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILF 58
           M++       +      I  VSI DEM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+
Sbjct: 1   MSDKEDEKPGEPGGPSDIRPVSILDEMKRSYLDYAMSVIVARALPDARDGLKPVHRRILY 60

Query: 59  GMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFG 118
           GM + G EWNK Y K AR  G+V+GKYHPHG+ ++Y AL RMAQD+S+R+ LI+GQGNFG
Sbjct: 61  GMYENGFEWNKPYRKSARTVGDVIGKYHPHGDQSVYGALVRMAQDFSMRVPLIDGQGNFG 120

Query: 119 SVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNG 178
           SVDGD PAA RYTE RL K A  LLDDL KDTVDF+PNYD S +EP VL A++PN+LVNG
Sbjct: 121 SVDGDMPAAMRYTESRLTKIAQSLLDDLDKDTVDFQPNYDSSEKEPSVLPAKFPNLLVNG 180

Query: 179 GGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIK 238
            GGIAVGMATNIP HNLGEV+D C+A+ DNP + +D L +II GPDFPTG +ILGR GI+
Sbjct: 181 AGGIAVGMATNIPPHNLGEVIDACIALTDNPALSIDELNQIIPGPDFPTGGIILGRAGIR 240

Query: 239 NAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIAD 298
           +AY TGRGSIV+RG   I+    DRE I++TEIPYQVNKA+M+E+IAELVREK+I  I+D
Sbjct: 241 SAYHTGRGSIVMRGKVTIDTIRKDREAILITEIPYQVNKASMVERIAELVREKKIEGISD 300

Query: 299 LRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGIL 358
           LRDESDR G+RVV+ELKR A  DV+LNQLY++T LQ+ F  NMVAL+G +P+   L  +L
Sbjct: 301 LRDESDRDGFRVVVELKRDAVPDVVLNQLYKFTPLQTNFGANMVALDGGRPQTMNLKDLL 360

Query: 359 KAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELM 418
           + FVAFRE+VV RRTK+LLNKARDRAH+LVGLAIAVAN+DE++R+IR SP+P TAR  LM
Sbjct: 361 QVFVAFREQVVTRRTKFLLNKARDRAHILVGLAIAVANIDEIIRVIRTSPDPNTARETLM 420

Query: 419 QRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELN 478
            R W A D+  +I LIDD  + I  DGT  LS  Q +AIL+LRL RLT LGR++I +EL+
Sbjct: 421 SRDWPAQDVAAMITLIDDPRHRINPDGTARLSLEQAKAILDLRLQRLTALGREEISDELD 480

Query: 479 SLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDM 538
            L +EI + LDIL SR+R+  I+K EL ++K E  TPRRT I E   +MEDED I REDM
Sbjct: 481 KLAVEIADYLDILRSRARVQDIVKTELSAIKAEFATPRRTVIAEQEGEMEDEDLIQREDM 540

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           VVTVSH GY KRVPLS YRAQRRGGKGR+G+  R+EDFV+ LF+ STHT VLFFSS G V
Sbjct: 541 VVTVSHAGYTKRVPLSAYRAQRRGGKGRTGMQTREEDFVSRLFVASTHTPVLFFSSRGQV 600

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVR 658
           YKEKVWRLPI +P  RGKALINIL L QGERITTIMP PEDESSW NL V+FAT  GNVR
Sbjct: 601 YKEKVWRLPIAAPNGRGKALINILPLEQGERITTIMPLPEDESSWANLDVMFATTGGNVR 660

Query: 659 RNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAG 718
           RNKLSDF+ + RSG IAMKLD  +EI++V+ CT+ +D+LLT   GQC+RFP++ +RVF G
Sbjct: 661 RNKLSDFVDVRRSGIIAMKLDEGEEIVNVQICTERDDVLLTAAGGQCIRFPVTDVRVFTG 720

Query: 719 RNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKND 778
           R S+GVRGI+LA+GD++IS+ I+ H +   DER  Y+K   A     + +    T  +  
Sbjct: 721 RTSMGVRGIALAEGDKLISLTILRHVETTSDERTAYLKMRRAMSGETAAEEPVETEGEEA 780

Query: 779 SSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEI 838
           ++    +S+ER  E+  +EQ +LTVS  G+GKRTSSY++R + R GKGI A  V+  N  
Sbjct: 781 AAGAIQLSQERYVEMSAQEQVVLTVSVNGYGKRTSSYEYRTTGRGGKGIVAMSVNNRN-- 838

Query: 839 GALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERI- 897
           G LVA FPV D+DQI+LV+DKG LIR PV+ IRIA R+T+GV++F+TA DE VVSVE I 
Sbjct: 839 GKLVASFPVEDSDQIMLVTDKGQLIRCPVDGIRIAGRSTQGVIVFNTADDEHVVSVEHIG 898

Query: 898 RESEIVDEAESTE 910
            E+E  + A  TE
Sbjct: 899 EEAENGNGANGTE 911


>gi|209549340|ref|YP_002281257.1| DNA gyrase subunit A [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535096|gb|ACI55031.1| DNA gyrase, A subunit [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 941

 Score =  996 bits (2575), Expect = 0.0,   Method: Composition-based stats.
 Identities = 632/899 (70%), Positives = 751/899 (83%), Gaps = 1/899 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MTE       +   GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+GM
Sbjct: 1   MTEQTPPGGGKLPPGIEPISIMEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYGM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            ++G++WNKKYVKCAR++G+VMGKYHPHGN+AIYDALARMAQ WSLRL LI+GQGNFGSV
Sbjct: 61  SELGIDWNKKYVKCARVTGDVMGKYHPHGNSAIYDALARMAQPWSLRLPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAAERYTECRL+KAAH LLDDL K+TVDFR NYDG+  EPVV+ A++PN+LVNG G
Sbjct: 121 DGDPPAAERYTECRLEKAAHSLLDDLDKETVDFRDNYDGTLSEPVVVPAKFPNLLVNGAG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNL EV+DGC+A+I++P I+L  LM+II GPDFPTGA ILGR GI++A
Sbjct: 181 GIAVGMATNIPPHNLSEVIDGCIALINDPAIELPDLMQIIPGPDFPTGAKILGRAGIRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGS+++RGV+ IE   GDREQI++TEIPYQVNKA M+EK+AELVR+KRI  I+DLR
Sbjct: 241 YETGRGSVIMRGVAAIEPMRGDREQIIITEIPYQVNKATMIEKMAELVRDKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVV+ELKR A+A+VILNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRQGYRVVVELKRDANAEVILNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FREEVV RRTK+LL KARDRAHVLVGLAIAVAN+DEV+R+IR +P+P++AR ELM R
Sbjct: 361 FVSFREEVVSRRTKFLLRKARDRAHVLVGLAIAVANIDEVIRVIRQAPDPQSAREELMTR 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D++ LI LIDD  + I  D T  LSE Q RAILELRLARLT LGRD+I +ELN +
Sbjct: 421 RWPAEDVESLIRLIDDPRHRINEDLTYNLSEEQARAILELRLARLTALGRDEIGDELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EIK+ LDILSSR R+  I+K EL++V+DE  TPRRT IV+G L+M+DED I REDMVV
Sbjct: 481 GEEIKDYLDILSSRVRIQTIVKDELIAVRDEFGTPRRTEIVDGGLEMDDEDLIAREDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSHLGY+KRVPL+ YRAQRRGGKGRSG+  RDEDFV+ LF+V+THT VLFFSS G VYK
Sbjct: 541 TVSHLGYIKRVPLTTYRAQRRGGKGRSGMTTRDEDFVSRLFVVNTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+P +RGKALIN+L L  GERITTI+P PEDE SW+NL V+F+T  G VRRN
Sbjct: 601 EKVWRLPIGTPTSRGKALINMLPLAPGERITTILPLPEDEESWDNLDVMFSTTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDF+Q+NR+GKIAMKL +  DEILSVETCT+ +D+LLTT LGQC+RF +  +RVFAGR
Sbjct: 661 KLSDFVQVNRNGKIAMKLEEEGDEILSVETCTESDDVLLTTALGQCIRFSVDDVRVFAGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NS+GVRGISLA GD++ISM IV H +A+  ER  Y+K  +  RRL +G+ EEI  +  + 
Sbjct: 721 NSIGVRGISLAGGDRIISMTIVRHVNAEPWERAAYLKRAANDRRLTTGEAEEIALVGEEV 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           + EG +S+ER +ELK  EQF+LTVSEKGFGKR+SSYDFRIS R GKGIRATD SK  EIG
Sbjct: 781 TEEGQLSDERYEELKQLEQFVLTVSEKGFGKRSSSYDFRISGRGGKGIRATDTSKTGEIG 840

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
            LVA FPV+D DQI+LVSD G LIRVPV  IRIASRATKGV IFSTAKDE+VVSVERI 
Sbjct: 841 ELVAAFPVDDGDQIMLVSDGGQLIRVPVGGIRIASRATKGVTIFSTAKDEKVVSVERIS 899



 Score = 50.6 bits (119), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 53/145 (36%), Gaps = 6/145 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFI-----QINRSGKIAMKLDSRDEILSVETCTQENDILLT 699
             +V+  ++ G  +R+   DF                K     E+++       + I+L 
Sbjct: 798 EQFVLTVSEKGFGKRSSSYDFRISGRGGKGIRATDTSKTGEIGELVAAFPVDDGDQIMLV 857

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  GQ +R P+  IR  A R + GV   S AK ++V+S+  +   + D  E    +    
Sbjct: 858 SDGGQLIRVPVGGIR-IASRATKGVTIFSTAKDEKVVSVERISEPEEDETEEAVEVAEGG 916

Query: 760 AQRRLISGDTEEITSLKNDSSVEGN 784
           A         E   +  + +     
Sbjct: 917 APATDEGAAGEAPIADGDPAGPAEE 941


>gi|110633753|ref|YP_673961.1| DNA gyrase subunit A [Mesorhizobium sp. BNC1]
 gi|110284737|gb|ABG62796.1| DNA gyrase subunit A [Chelativorans sp. BNC1]
          Length = 929

 Score =  996 bits (2574), Expect = 0.0,   Method: Composition-based stats.
 Identities = 596/908 (65%), Positives = 724/908 (79%), Gaps = 3/908 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+      +E +  I  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+  
Sbjct: 1   MTDQTTRGPDEPDD-IEPISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYAS 59

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            + G  WN+KYVK AR   +VMGKYHPHG+A+IYDAL RMAQDWS+R+ LI+GQGNFGS+
Sbjct: 60  YESGYHWNRKYVKSARPVADVMGKYHPHGDASIYDALVRMAQDWSMRVPLIDGQGNFGSI 119

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTE RL K AH LL+D+ KDTVDF+  YDG+  EP +L AR+PN+LVNG G
Sbjct: 120 DGDPPAAMRYTEARLTKVAHELLEDIDKDTVDFQDTYDGTGSEPRILPARFPNLLVNGSG 179

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNL EVV+GCVA+IDNP + L  L+EII GPDFPTG +ILGR+GI +A
Sbjct: 180 GIAVGMATNIPPHNLSEVVNGCVALIDNPALQLPQLLEIIPGPDFPTGGIILGRSGIHSA 239

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           YATGRGS+V+RG + IE+   +RE I++TE+PYQVNKA M+EK+AELVREKRI  I+D+R
Sbjct: 240 YATGRGSVVMRGKTSIEQIRNEREAIIITEVPYQVNKAQMIEKMAELVREKRIEGISDIR 299

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVVIELKR A+A+VILNQLYR+T LQ+ F  NMVALNG KPE   L+ +L+A
Sbjct: 300 DESDRQGYRVVIELKRDANAEVILNQLYRFTPLQTSFGANMVALNGGKPEVMNLLDMLRA 359

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FVAFREEVV RRTKYLL K R+RAHVLVGLAIAVAN+DEV+++IR +P+P+TAR +LM+R
Sbjct: 360 FVAFREEVVTRRTKYLLRKVRERAHVLVGLAIAVANIDEVIQLIRRAPDPQTAREQLMER 419

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D++ LI LI D  + I  DGT  LSE Q RAIL+LRL RLT LGRD+I +ELN +
Sbjct: 420 RWPAQDVESLILLIADPRHKINDDGTYNLSEEQARAILDLRLQRLTALGRDEIADELNKI 479

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EI++ LDILSSR+R+ GI+K EL++V+DE  TPRRT I EG  DMEDED I REDMVV
Sbjct: 480 GAEIQDYLDILSSRARVQGIVKDELIAVRDEFGTPRRTEITEGGADMEDEDLIPREDMVV 539

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TV+H GY+KRVPLS+YRAQ RGGKGRSG+  +DEDFVT LF+ +THT +LFFSS G VYK
Sbjct: 540 TVTHKGYIKRVPLSIYRAQARGGKGRSGMSTKDEDFVTRLFVANTHTPILFFSSRGIVYK 599

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLP+G+PQ+ GK L N+L L +GERIT+IMP PEDE SW  L V+FAT  G VRRN
Sbjct: 600 EKVWRLPVGTPQSVGKFLRNMLPLVEGERITSIMPLPEDEESWAALDVMFATTRGTVRRN 659

Query: 661 KLSDFIQINRSGKIAMKLD-SRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDF Q+NR+GKIAMKLD   DEIL+V TCT+++D+LLT   GQC+RFP++ +RVFAGR
Sbjct: 660 KLSDFTQVNRNGKIAMKLDEEGDEILAVFTCTEDDDVLLTAASGQCIRFPVTDVRVFAGR 719

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISG-DTEEITSLKND 778
           NS+GVRGI+L  GD+VISMAIV H DA   ER  Y+K  +A+RRL +G D EEI     +
Sbjct: 720 NSIGVRGINLPDGDKVISMAIVGHVDATPAERAAYLKQAAAERRLSNGSDEEEIALTNEE 779

Query: 779 SSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEI 838
              E  +S ER +ELK +EQF+LTVSE G+GKR+SSYDFR+  R GKGIRATDVSK  EI
Sbjct: 780 VGEETVLSPERYEELKAREQFVLTVSEYGYGKRSSSYDFRVIGRGGKGIRATDVSKREEI 839

Query: 839 GALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
           G+L+A FPV   DQI+LVS+ G +IRVPV  IRIASRATKGV IF+TA  ERVVSV+RI 
Sbjct: 840 GSLIAAFPVAPEDQIMLVSNAGQIIRVPVTGIRIASRATKGVTIFNTADGERVVSVDRIS 899

Query: 899 ESEIVDEA 906
           E +  +E 
Sbjct: 900 EPQNGEED 907



 Score = 56.0 bits (133), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 51/301 (16%), Positives = 97/301 (32%), Gaps = 58/301 (19%)

Query: 528 EDEDCIVREDMVVTV-----SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFI 582
                   E+    +     +  G V+R  LS +    R GK    +    ++    +F 
Sbjct: 631 SIMPLPEDEESWAALDVMFATTRGTVRRNKLSDFTQVNRNGKIAMKLDEEGDEI-LAVFT 689

Query: 583 VSTHTSVLFFSSLGFVYKEKVWRLP-IGSPQARGKALIN--------------------- 620
            +    VL  ++ G   +  V  +       + G   IN                     
Sbjct: 690 CTEDDDVLLTAASGQCIRFPVTDVRVFAGRNSIGVRGINLPDGDKVISMAIVGHVDATPA 749

Query: 621 ------------------------ILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGN 656
                                    L+  +    T + P   +E      +V+  +++G 
Sbjct: 750 ERAAYLKQAAAERRLSNGSDEEEIALTNEEVGEETVLSPERYEELKAREQFVLTVSEYGY 809

Query: 657 VRRNKLSDFIQINR--SGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVRFPIS 711
            +R+   DF  I R   G  A  +  R+EI   ++      E+ I+L +  GQ +R P++
Sbjct: 810 GKRSSSYDFRVIGRGGKGIRATDVSKREEIGSLIAAFPVAPEDQIMLVSNAGQIIRVPVT 869

Query: 712 AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEE 771
            IR  A R + GV   + A G++V+S+  +       ++                G+   
Sbjct: 870 GIR-IASRATKGVTIFNTADGERVVSVDRISEPQNGEEDAAVPEGAGEIPPADSEGEGGA 928

Query: 772 I 772
            
Sbjct: 929 E 929


>gi|299133975|ref|ZP_07027169.1| DNA gyrase, A subunit [Afipia sp. 1NLS2]
 gi|298591811|gb|EFI52012.1| DNA gyrase, A subunit [Afipia sp. 1NLS2]
          Length = 904

 Score =  994 bits (2570), Expect = 0.0,   Method: Composition-based stats.
 Identities = 555/903 (61%), Positives = 695/903 (76%), Gaps = 5/903 (0%)

Query: 1   MTEHIISSDEEEE-KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFG 59
           MT+    +D+      I  VSI+DEM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+G
Sbjct: 1   MTDPKDPADDSSSPADIKPVSISDEMKRSYLDYAMSVIVSRALPDARDGLKPVHRRILYG 60

Query: 60  MMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS 119
           M + G EWNK Y K AR  G+V+GKYHPHG+ ++YDAL RMAQD+S+R+ LI+GQGNFGS
Sbjct: 61  MYENGFEWNKPYRKSARTVGDVIGKYHPHGDQSVYDALVRMAQDFSMRVPLIDGQGNFGS 120

Query: 120 VDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGG 179
           VDGD PAA RYTE RLQK AH LLDD+ KDTVDF+PNYD S +EP VL A++PN+LVNG 
Sbjct: 121 VDGDMPAAMRYTESRLQKIAHSLLDDIDKDTVDFQPNYDSSEREPKVLPAKFPNLLVNGA 180

Query: 180 GGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKN 239
           GGIAVGMATNIP HNLGEV+D C+A+IDNP + +D L+ I+ GPDFPTG +ILG+ GI++
Sbjct: 181 GGIAVGMATNIPPHNLGEVIDACIALIDNPGLGIDDLINIVPGPDFPTGGIILGKQGIRS 240

Query: 240 AYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           AY  GRGSIV+RG   IE    DRE I+V+EIPYQVNKA M+E+IAELVR+K+I  I+DL
Sbjct: 241 AYHLGRGSIVMRGKVSIETIRKDREAIIVSEIPYQVNKATMVERIAELVRDKKIEGISDL 300

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDESDR GYRVV+ELKR A  DV+LNQLY++T LQ+ F  NMVAL+G +P+   L  +L 
Sbjct: 301 RDESDRDGYRVVVELKRDAVPDVVLNQLYKFTPLQTSFGANMVALDGGRPQVMNLKDLLT 360

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
            FVAFRE VV RRTK+LLNKARDRAH+LVGLAIAVAN+DE++R+IR SP+P TAR  LM 
Sbjct: 361 VFVAFRENVVSRRTKFLLNKARDRAHILVGLAIAVANIDEIIRVIRTSPDPATARDTLMS 420

Query: 420 RSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           R W A D++ ++ LIDD  + I +DGT  LS  Q +AIL+LRL RLT LGRD+I +EL+ 
Sbjct: 421 RDWPAKDVETMMMLIDDPRHRISADGTARLSMEQAKAILDLRLQRLTALGRDEISDELDK 480

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           L +EI + LDIL SR+R+ GI++ EL +VK+E  TPRRT IV+   ++EDED I REDMV
Sbjct: 481 LAVEIADYLDILRSRARVQGIVRDELTAVKNEFATPRRTVIVDQEGEVEDEDLIQREDMV 540

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           VTVSH GYVKRVPLS YRAQ+RGGKGRSG+  RDEDFV+ LF+ STHT VLFFSS G VY
Sbjct: 541 VTVSHAGYVKRVPLSTYRAQKRGGKGRSGMQTRDEDFVSRLFVASTHTPVLFFSSRGQVY 600

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           KEKVWRLP+ +P ARGKALINIL + QGERITTIMP PEDESSW+ L V+FAT  GNVRR
Sbjct: 601 KEKVWRLPMAAPNARGKALINILPMEQGERITTIMPLPEDESSWSELDVMFATTGGNVRR 660

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           NKLSDF+ + RSG IAMKLD  + I+ V+   + +D+LLT   GQC+RFP++ +RVF GR
Sbjct: 661 NKLSDFVDVRRSGIIAMKLDEGESIVDVQIAKENDDVLLTAAGGQCIRFPVTDVRVFQGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
            S+GVRGI+L  GD++IS+ I+ H D + DER  Y++  +A RR   G  +E  +   ++
Sbjct: 721 TSMGVRGINLGDGDKLISLTILRHMDVNADERAAYLRRANAVRR--GGVEDEAGTDSEEA 778

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           +    + E+R  E+   EQF+LT+SE G+GKRTSSY++R + R GKGI A  V+  N  G
Sbjct: 779 TGAIELGEQRYVEMSANEQFVLTISENGYGKRTSSYEYRTTGRGGKGIVAMSVNGRN--G 836

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FPV D+DQI+LV+DKG LIR PV +IRIA R+T+GV +F+T+ DERVVSVE + +
Sbjct: 837 KLVASFPVEDSDQIMLVTDKGQLIRCPVEDIRIAGRSTQGVTVFNTSDDERVVSVEHLTD 896

Query: 900 SEI 902
              
Sbjct: 897 EGE 899



 Score =  104 bits (259), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 41/221 (18%), Positives = 78/221 (35%), Gaps = 13/221 (5%)

Query: 693 ENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAI------VLHADA 746
           E+ ++  +  G   R P+S  R    R   G  G+     D V  + +      VL   +
Sbjct: 537 EDMVVTVSHAGYVKRVPLSTYRAQK-RGGKGRSGMQTRDEDFVSRLFVASTHTPVLFFSS 595

Query: 747 DYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEK 806
                   +  +        G                 I      E    E  ++  +  
Sbjct: 596 RGQVYKEKVWRLPMAAPNARGKALINILPMEQGERITTIMPLPEDESSWSELDVMFATTG 655

Query: 807 GFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVP 866
           G  +R    DF    R   GI A  + +     ++V V    +ND ++L +  G  IR P
Sbjct: 656 GNVRRNKLSDFVDVRR--SGIIAMKLDEGE---SIVDVQIAKENDDVLLTAAGGQCIRFP 710

Query: 867 VNEIRI-ASRATKGVVIFSTAKDERVVSVERIRESEIVDEA 906
           V ++R+   R + GV   +    ++++S+  +R  ++  + 
Sbjct: 711 VTDVRVFQGRTSMGVRGINLGDGDKLISLTILRHMDVNADE 751



 Score = 56.7 bits (135), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 54/113 (47%), Gaps = 4/113 (3%)

Query: 641 SSWNNLYVVFATKHGNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDIL 697
            S N  +V+  +++G  +R    ++    R   G +AM ++    ++++       + I+
Sbjct: 792 MSANEQFVLTISENGYGKRTSSYEYRTTGRGGKGIVAMSVNGRNGKLVASFPVEDSDQIM 851

Query: 698 LTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDE 750
           L T  GQ +R P+  IR  AGR++ GV   + +  ++V+S+  +        E
Sbjct: 852 LVTDKGQLIRCPVEDIR-IAGRSTQGVTVFNTSDDERVVSVEHLTDEGEQSGE 903


>gi|254469835|ref|ZP_05083240.1| DNA gyrase, A subunit [Pseudovibrio sp. JE062]
 gi|211961670|gb|EEA96865.1| DNA gyrase, A subunit [Pseudovibrio sp. JE062]
          Length = 930

 Score =  993 bits (2568), Expect = 0.0,   Method: Composition-based stats.
 Identities = 551/910 (60%), Positives = 687/910 (75%), Gaps = 11/910 (1%)

Query: 1   MTE-HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFG 59
           M +  + +        I  VSITDEM+ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+ 
Sbjct: 1   MADQDLSTPPGGLPSDIRPVSITDEMKRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYS 60

Query: 60  MMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS 119
           M + G EWNK Y K AR+ G+VMGKYHPHG++AIYDAL RMAQD+S+RL LI GQGNFGS
Sbjct: 61  MHENGYEWNKPYRKSARVVGDVMGKYHPHGDSAIYDALVRMAQDFSMRLPLINGQGNFGS 120

Query: 120 VDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGG 179
           +DGD  AA RYTECRL+K AH  L D+ KDTV+F  NYDGS QEP VL ARYPN+LVNG 
Sbjct: 121 IDGDRAAAMRYTECRLEKVAHTQLSDIDKDTVNFHENYDGSEQEPEVLPARYPNLLVNGA 180

Query: 180 GGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKN 239
           GGIAVGMATNIP HN+GEV+DG +A+I+ P+I L  LMEII GPDFPTG +ILGR GIK 
Sbjct: 181 GGIAVGMATNIPPHNMGEVIDGTIAMIERPEITLPELMEIIPGPDFPTGGIILGRAGIKA 240

Query: 240 AYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           AY  GRGS+++R     E+    R  I+V+EIPYQVNK+AM+EKIAELVREKRI  I+D+
Sbjct: 241 AYENGRGSVIMRSKVDTEEIRAGRMAIIVSEIPYQVNKSAMIEKIAELVREKRIEGISDI 300

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDESDRQG RVVIELK+ A  DVI+NQLYRY+ LQ  F  NMVALNG +PE+  L  +LK
Sbjct: 301 RDESDRQGMRVVIELKKDAVPDVIVNQLYRYSQLQQSFGCNMVALNGGRPEQLALKDMLK 360

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
           AF+AFREEVV RRT++LL KARDRAHVLVGLA+A AN+D+V+ +IR +P+P TARR+LM+
Sbjct: 361 AFIAFREEVVGRRTRFLLAKARDRAHVLVGLAVATANIDDVIHLIRTAPDPATARRQLME 420

Query: 420 RSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           R+W A DI+ LI LIDD  Y I  DGT  LSE Q RAIL+LRL RLT LGRD+I +EL+ 
Sbjct: 421 RNWPAKDIEPLIQLIDDPRYAIQEDGTFKLSEDQARAILDLRLQRLTALGRDEIGDELDK 480

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           L  EIK+ LDIL SR R+L I++ EL  V+DE  TPRRT I +G  D++DED I REDMV
Sbjct: 481 LAAEIKDYLDILKSRERILEIVRTELEEVRDEFATPRRTEITDGGGDLDDEDLIQREDMV 540

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           VTVSH GY+KRVPL  YRAQRRGGKGRSG+  +DEDFVT LF+ +THT VLFFSS G  Y
Sbjct: 541 VTVSHSGYIKRVPLDTYRAQRRGGKGRSGMQTKDEDFVTRLFVANTHTPVLFFSSRGIAY 600

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           K KVWRLP+  PQARG AL+N+L L QGERIT+I+P PE+E +W  L V+FATK G +RR
Sbjct: 601 KMKVWRLPLAGPQARGNALVNMLPLEQGERITSILPLPENEETWAELDVLFATKRGTIRR 660

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           NKLSDF QIN++GKIAMKL+  D I++V T T+++D+LLTT  G C+RFP + +RVF+GR
Sbjct: 661 NKLSDFAQINKNGKIAMKLEEGDGIVNVMTSTEDDDVLLTTSAGMCIRFPTTDVRVFSGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NSVGVRGI+LA+GD VISM I+ H D D DER  Y+K   A       ++          
Sbjct: 721 NSVGVRGINLAEGDHVISMTILRHFDCDSDERTAYLKLSRAMSGEEGAESVSFE------ 774

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
             +  +++ER + +    + ILTVSE G+GKRTSSY++R + R GKGI A  V+  N  G
Sbjct: 775 --DAGMTKERFEAMDENAEVILTVSENGYGKRTSSYEYRTTGRGGKGIAAMTVNDRN--G 830

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA F   ++D+I+LV++ G LIR PV+ IR+A R+T+GV++F+T+ DE+VV+VERI E
Sbjct: 831 RLVASFRSEESDEIMLVTNGGQLIRCPVHGIRVAGRSTQGVIVFNTSADEKVVAVERISE 890

Query: 900 SEIVDEAEST 909
           ++  +  E+ 
Sbjct: 891 ADDDENVEAE 900



 Score = 65.6 bits (158), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 45/290 (15%), Positives = 103/290 (35%), Gaps = 47/290 (16%)

Query: 536 EDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSL 595
           E  V+  +  G ++R  LS +    + GK    + + + D + ++   +    VL  +S 
Sbjct: 646 ELDVLFATKRGTIRRNKLSDFAQINKNGKI--AMKLEEGDGIVNVMTSTEDDDVLLTTSA 703

Query: 596 GFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLY-------- 647
           G   +     +       R    +  ++L +G+ + ++      +   +           
Sbjct: 704 GMCIRFPTTDVR--VFSGRNSVGVRGINLAEGDHVISMTILRHFDCDSDERTAYLKLSRA 761

Query: 648 -------------------------------VVFATKHGNVRRNKLSDFIQINR--SGKI 674
                                          ++  +++G  +R    ++    R   G  
Sbjct: 762 MSGEEGAESVSFEDAGMTKERFEAMDENAEVILTVSENGYGKRTSSYEYRTTGRGGKGIA 821

Query: 675 AMKLDSRDEILSVETCTQE-NDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGD 733
           AM ++ R+  L     ++E ++I+L T  GQ +R P+  IRV AGR++ GV   + +  +
Sbjct: 822 AMTVNDRNGRLVASFRSEESDEIMLVTNGGQLIRCPVHGIRV-AGRSTQGVIVFNTSADE 880

Query: 734 QVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEG 783
           +V+++  +  AD D +     +    A                 ++    
Sbjct: 881 KVVAVERISEADDDENVEAEGVSEGGADNGEAGAVPPAPEGDGGETPSAE 930


>gi|209885354|ref|YP_002289211.1| DNA gyrase, A subunit [Oligotropha carboxidovorans OM5]
 gi|209873550|gb|ACI93346.1| DNA gyrase, A subunit [Oligotropha carboxidovorans OM5]
          Length = 905

 Score =  992 bits (2565), Expect = 0.0,   Method: Composition-based stats.
 Identities = 552/909 (60%), Positives = 691/909 (76%), Gaps = 5/909 (0%)

Query: 1   MTEHIISSDEEEEK-GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFG 59
           MT+    ++       I  VSI+DEM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+G
Sbjct: 1   MTDPKDPTESGSGPVDIKPVSISDEMKRSYLDYAMSVIVSRALPDARDGLKPVHRRILYG 60

Query: 60  MMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS 119
           M + G EWNK Y K AR  G+V+GKYHPHG+ ++YDAL RMAQD+S+R+ LI+GQGNFGS
Sbjct: 61  MYENGFEWNKPYRKSARTVGDVIGKYHPHGDQSVYDALVRMAQDFSMRVPLIDGQGNFGS 120

Query: 120 VDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGG 179
           VDGD PAA RYTE RLQK AH LLDD+ KDTVDF+PNYD S +EP VL A++PN+LVNG 
Sbjct: 121 VDGDMPAAMRYTESRLQKIAHSLLDDIDKDTVDFQPNYDASEREPKVLPAKFPNLLVNGA 180

Query: 180 GGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKN 239
           GGIAVGMATNIP HNLGEV+D C+A+IDNP + +D L+ I+ GPDFPTG +ILGR GI++
Sbjct: 181 GGIAVGMATNIPPHNLGEVIDACIALIDNPALGIDDLINIVPGPDFPTGGIILGRQGIRS 240

Query: 240 AYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           AY  GRGSIV+RG   IE    DRE IVV+EIPYQVNKA M+E+IAELVR+K+I  ++DL
Sbjct: 241 AYHLGRGSIVMRGKVSIETIRKDREAIVVSEIPYQVNKATMVERIAELVRDKKIEGVSDL 300

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDESDR+GYRVV+ELKR A  DV+LNQLY++T LQ+ F  NMVAL+G +P+   L  +L 
Sbjct: 301 RDESDREGYRVVVELKRDAVPDVVLNQLYKFTPLQTSFGANMVALDGGRPQVMNLKDLLT 360

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
            FVAFRE VV RRTK+LLNKARDRAH+LVGLAIAVAN+DEV+R+IR SP+P TAR  LM 
Sbjct: 361 VFVAFRENVVSRRTKFLLNKARDRAHILVGLAIAVANIDEVIRVIRTSPDPATARDTLMS 420

Query: 420 RSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           R W A D++ ++ LIDD  + I  DGT  LS  Q +AIL+LRL RLT LGRD+I  EL+ 
Sbjct: 421 RDWPARDVETMMMLIDDPRHRIAEDGTARLSMEQAKAILDLRLQRLTALGRDEISEELDK 480

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           L +EI + LDIL SR+R+  I++ EL ++K+E  TPRRT I++   ++EDED I REDMV
Sbjct: 481 LAVEIADYLDILRSRARVQDIVRNELNAIKEEFATPRRTMIIDQEGEVEDEDLIQREDMV 540

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           VTVSH GYVKRVPLS YRAQ+RGGKGRSG+  R+EDFV  LF+ STHT VLFFSS G VY
Sbjct: 541 VTVSHAGYVKRVPLSTYRAQKRGGKGRSGMQTREEDFVARLFVASTHTPVLFFSSRGQVY 600

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           KEKVWRLP+ +P ARGKALINIL + QGERITTIMP PEDESSW  L V+FAT  GNVRR
Sbjct: 601 KEKVWRLPMAAPSARGKALINILPMEQGERITTIMPLPEDESSWGELDVMFATTGGNVRR 660

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           NKLSDF+ + RSG IAMKL   + I+ V+ C + +D+LLT   GQC+RFPI+ +RVF GR
Sbjct: 661 NKLSDFVDVRRSGIIAMKLGEGEAIVDVQICKENDDVLLTAAGGQCIRFPITDVRVFQGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
            S+GVRGI+L +GD++IS+ I+ H D   DER  Y++  +A RR   G  +E  +   ++
Sbjct: 721 TSMGVRGITLGEGDRLISLTILRHMDVSADERAAYLRRANAVRR--GGADDEAGTDHEEA 778

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           +    + E+R  E+   EQF+LT+SE G+GKR+SSY++R + R GKGI A  V+  N  G
Sbjct: 779 TGAIELGEQRYVEMSANEQFVLTISENGYGKRSSSYEYRTTGRGGKGIVAMSVNDRN--G 836

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            L+  FPV+D+DQI+LV+DKG LIR PV +IRI  R+T+GV +F+TA DERVVSVER+ +
Sbjct: 837 KLIGSFPVDDSDQIMLVTDKGQLIRCPVEDIRIVGRSTQGVTVFNTADDERVVSVERLTD 896

Query: 900 SEIVDEAES 908
                  E 
Sbjct: 897 EGEHPSDEE 905


>gi|39649518|emb|CAE28040.1| DNA gyrase subunit A [Rhodopseudomonas palustris CGA009]
          Length = 887

 Score =  992 bits (2565), Expect = 0.0,   Method: Composition-based stats.
 Identities = 547/886 (61%), Positives = 678/886 (76%), Gaps = 6/886 (0%)

Query: 25  MQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGK 84
           M+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+GM + G EWNK+Y K AR  G+V+GK
Sbjct: 1   MKRSYLDYAMSVIVARALPDARDGLKPVHRRILYGMYENGFEWNKQYRKSARTVGDVIGK 60

Query: 85  YHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLD 144
           YHPHG+ ++YDAL RMAQD+S+R+ LI+GQGNFGSVDGD PAA RYTE RL K A  LLD
Sbjct: 61  YHPHGDQSVYDALVRMAQDFSMRVPLIDGQGNFGSVDGDMPAAMRYTESRLTKIAQTLLD 120

Query: 145 DLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVA 204
           D+ KDTVDF+PNYD S +EP VL A++PN+LVNG GGIAVGMATNIP HNLGEV+D C+A
Sbjct: 121 DIDKDTVDFQPNYDNSEREPQVLPAKFPNLLVNGAGGIAVGMATNIPPHNLGEVIDACIA 180

Query: 205 VIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDRE 264
           +ID+P + +D L +I+ GPDFPTG +ILGR GI+ AY TGRGSIV+RG   IE    DRE
Sbjct: 181 LIDDPALSIDDLNKIVPGPDFPTGGIILGRAGIRAAYQTGRGSIVMRGKVEIETVRKDRE 240

Query: 265 QIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVIL 324
            I+V+EIPYQVNKA M+E+IAELVREK+I  I DLRDESDR G+RVVIEL+R A  +V+L
Sbjct: 241 AIIVSEIPYQVNKATMVERIAELVREKKIEGIGDLRDESDRDGFRVVIELRRDAVPEVVL 300

Query: 325 NQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRA 384
           NQLY++T LQ+ F  NMVAL G +P+   L  +L  FVAFRE+VV RRTK+LLNKARDRA
Sbjct: 301 NQLYKFTPLQTNFGANMVALEGGRPQLMNLKDLLTVFVAFREQVVTRRTKFLLNKARDRA 360

Query: 385 HVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSD 444
           H+LVGLAIAVAN+DE++R+IR SP+P TAR  LM R W A+D+  +I LIDD  + +  D
Sbjct: 361 HILVGLAIAVANIDEIIRVIRNSPDPNTARETLMSRDWPAADVAAMITLIDDPRHKLNPD 420

Query: 445 GTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQE 504
           GT  LS  Q +AIL+LRL RLT LGR++I  EL+ L +EI + L+IL SR+R+  I+K E
Sbjct: 421 GTARLSFEQAKAILDLRLQRLTALGREEISEELDKLAVEIADYLEILRSRARVQAIVKTE 480

Query: 505 LLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGK 564
           L  VK E  TPRRT I E   ++EDED I REDMVVTVSH GYVKRVPLS YRAQRRGGK
Sbjct: 481 LGEVKAEFATPRRTVIAEQEGEVEDEDLIQREDMVVTVSHAGYVKRVPLSTYRAQRRGGK 540

Query: 565 GRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSL 624
           GRSG+  R+EDFV+ LF+ STHT VLFFSS G VYKEKVWRLP+  P  RGKALINIL L
Sbjct: 541 GRSGMATREEDFVSRLFVASTHTPVLFFSSRGQVYKEKVWRLPLAPPNGRGKALINILPL 600

Query: 625 NQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEI 684
            QGERITTIMP PEDE+SW+ L V+FAT  GNVRRNKLSDF+ + RSG IAMKLD  + I
Sbjct: 601 EQGERITTIMPLPEDEASWSELDVMFATTGGNVRRNKLSDFVDVRRSGIIAMKLDEGEAI 660

Query: 685 LSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHA 744
           + V+ CT+ +D+LLT   GQC+RFP+  +RVF+GR S+GVRGI+L+ GD VIS++I+ H 
Sbjct: 661 VDVQICTERDDVLLTAAGGQCIRFPVPDVRVFSGRTSMGVRGIALSSGDTVISLSILRHF 720

Query: 745 DADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGN----ISEERCQELKLKEQFI 800
           +A   ER  Y+K   A RR  +G+  E        + EG+    +S+ER  E+   EQF+
Sbjct: 721 EATPAERSTYLKQSGAIRRAATGEENEPVETPEAEAEEGDTSAALSQERYAEMSASEQFV 780

Query: 801 LTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKG 860
           LT+SE G+GKRTSS+++R + R GKGI A  V+  N  G LVA FPV D+DQI+LV+D G
Sbjct: 781 LTISENGYGKRTSSFEYRTTGRGGKGIVAMSVNSRN--GKLVASFPVEDSDQIMLVTDNG 838

Query: 861 TLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEA 906
            LIR PV  IR+A R+T+GV++F+TA DE+VVSVERI E++  +  
Sbjct: 839 QLIRCPVEGIRVAGRSTQGVIVFNTADDEKVVSVERIPETDDGENG 884


>gi|17982834|gb|AAL52065.1| DNA gyrase subunit a [Brucella melitensis bv. 1 str. 16M]
          Length = 902

 Score =  992 bits (2564), Expect = 0.0,   Method: Composition-based stats.
 Identities = 589/883 (66%), Positives = 719/883 (81%), Gaps = 2/883 (0%)

Query: 25  MQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGK 84
           MQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M +M + +N+ Y K A + GEVMGK
Sbjct: 1   MQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAMNEMNLAYNRPYRKSAGVVGEVMGK 60

Query: 85  YHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLD 144
           YHPHG+A+IYDAL RMAQD+S+R  LI+GQGNFGS+DGDPPAA RYTECRL+K    LL 
Sbjct: 61  YHPHGDASIYDALVRMAQDFSMRDPLIDGQGNFGSIDGDPPAAMRYTECRLEKVTESLLS 120

Query: 145 DLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVA 204
           D+ KDTV+F+ NYDG  QEPVVL AR+PN+LVNG GGIAVGMATNIP HNLGEV+DGCVA
Sbjct: 121 DIDKDTVNFQDNYDGREQEPVVLPARFPNLLVNGSGGIAVGMATNIPPHNLGEVIDGCVA 180

Query: 205 VIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDRE 264
           +IDNP I+L  LME+I GPDFPTG +ILGR GI +AY TGRGS+++RG + IE   GDRE
Sbjct: 181 LIDNPAIELSELMELIPGPDFPTGGIILGRNGINSAYTTGRGSVIMRGRATIEPMRGDRE 240

Query: 265 QIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVIL 324
            I++TEIPYQVNKA+M+EK+AELVR+KRI  I+DLRDESDR+GYRVV+ELKR A ADV+L
Sbjct: 241 AIIITEIPYQVNKASMIEKMAELVRDKRIDGISDLRDESDREGYRVVVELKRDAVADVVL 300

Query: 325 NQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRA 384
           NQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFVAFREEVV RRTK+LLNKARDRA
Sbjct: 301 NQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRAFVAFREEVVTRRTKFLLNKARDRA 360

Query: 385 HVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSD 444
           HVLVGLAIAVAN+DEV+ +IR +P+P TAR +LM+R W A D+  LI LIDD  +T+  D
Sbjct: 361 HVLVGLAIAVANIDEVIALIRRAPDPATAREQLMERRWPAVDVAPLIRLIDDPRHTLNED 420

Query: 445 GTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQE 504
            T  LSE Q RAIL+LRL RLT LGRD++ +ELN +G EI++ LDIL SR R++ I+K+E
Sbjct: 421 NTYNLSEEQARAILDLRLQRLTALGRDEVADELNKIGEEIRDYLDILGSRLRVMNIVKEE 480

Query: 505 LLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGK 564
           +++V+DE  TPRRT I  G  +M+DED I REDMVVTVSH GY+KRVPL+ YRAQRRGGK
Sbjct: 481 MIAVRDEFATPRRTEIGFGGAEMDDEDLIAREDMVVTVSHAGYIKRVPLTTYRAQRRGGK 540

Query: 565 GRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSL 624
           GRSG+  ++EDFVT LF+ +THT VLFFSS G VYKEK+WRLP+G+PQ+RGKALIN+L L
Sbjct: 541 GRSGMATKEEDFVTRLFVANTHTPVLFFSSRGIVYKEKLWRLPVGTPQSRGKALINMLPL 600

Query: 625 NQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKL-DSRDE 683
            QGERITTIMP PEDE SW NL V+F+T  G VRRNKLSDF+Q+NR+GKIAMKL D  DE
Sbjct: 601 QQGERITTIMPLPEDEDSWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDE 660

Query: 684 ILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLH 743
           ILSV+TCT+ +D+LLT   GQC+RFP++ +RVFAGRNS+GVRGI+LA+GD+VISMAI+ H
Sbjct: 661 ILSVDTCTEFDDVLLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDKVISMAILHH 720

Query: 744 ADADYDERICYMKHMSAQRRLISGDT-EEITSLKNDSSVEGNISEERCQELKLKEQFILT 802
            DA   ER  Y+K   A+RR    D  ++I  +  D   E  +SE+R QELK +E+ +LT
Sbjct: 721 VDATPAERSAYLKRSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQELKAREETVLT 780

Query: 803 VSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTL 862
           VSE G+GKR+SSY+FRIS R GKGIRATD SK +EIG LVA+FPV  +DQI+LVSD G L
Sbjct: 781 VSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDGGQL 840

Query: 863 IRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           IRVPV+ IRIA R+TKGV IF+TA  E+VVSVERI +++  +E
Sbjct: 841 IRVPVDGIRIAGRSTKGVTIFNTADGEKVVSVERISDADSDEE 883



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 778 VLTVSEFGYGKRSSSYEFRISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 837

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 838 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 896

Query: 763 RLISGD 768
              + +
Sbjct: 897 PAATQE 902


>gi|116252153|ref|YP_767991.1| DNA gyrase subunit A [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256801|emb|CAK07891.1| putative DNA gyrase subunit A [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 945

 Score =  991 bits (2563), Expect = 0.0,   Method: Composition-based stats.
 Identities = 627/899 (69%), Positives = 749/899 (83%), Gaps = 1/899 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MTE       +   GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+GM
Sbjct: 1   MTEQTPPGGGKLPPGIEPISIMEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYGM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            ++G++WNKKYVKCAR++G+VMGK+HPHGN+AIYDALARMAQ WSLRL LI+GQGNFGSV
Sbjct: 61  SELGIDWNKKYVKCARVTGDVMGKFHPHGNSAIYDALARMAQPWSLRLPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAAERYTECRL+KAAH LLDDL K+TVDFR NYDG+  EPVV+ A++PN+LVNG G
Sbjct: 121 DGDPPAAERYTECRLEKAAHSLLDDLDKETVDFRDNYDGTLSEPVVVPAKFPNLLVNGAG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNL EV+DGCVA+ID+P I+L  LM+II GPDFPTGA ILGR GI++A
Sbjct: 181 GIAVGMATNIPPHNLSEVIDGCVALIDDPAIELPELMQIIPGPDFPTGAKILGRAGIRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGS+++RGV+ IE   GDREQI++TEIPYQVNKA M+EK+AELVR+KRI  I+DLR
Sbjct: 241 YETGRGSVIMRGVAAIEPMRGDREQIIITEIPYQVNKATMIEKMAELVRDKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVV+ELKR A+A+VILNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRQGYRVVVELKRDANAEVILNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FREEVV RRTK+LL KARDRAHVLVGLAIAVAN+DEV+R+IR +P+P++AR ELM R
Sbjct: 361 FVSFREEVVSRRTKFLLRKARDRAHVLVGLAIAVANIDEVIRVIRQAPDPQSAREELMTR 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D++ LI LIDD  + I  D T  LSE Q RAILELRLARLT LGRD+I +ELN +
Sbjct: 421 RWPAEDVESLIRLIDDPRHRINDDLTYNLSEEQARAILELRLARLTALGRDEIGDELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EIK+ LDILSSR R+  I+K EL++V+DE  TPRRT IV+G L+M+DED I REDMVV
Sbjct: 481 GEEIKDYLDILSSRVRIQTIVKDELIAVRDEFGTPRRTEIVDGGLEMDDEDLIAREDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSHLGY+KRVPL+ YRAQRRGGKGRSG+  RDEDFV+ LF+V+THT VLFFSS G VYK
Sbjct: 541 TVSHLGYIKRVPLTTYRAQRRGGKGRSGMTTRDEDFVSRLFVVNTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+P +RGKALIN+L L  GERITTI+P PEDE+SW+NL V+F+T  G VRRN
Sbjct: 601 EKVWRLPIGTPTSRGKALINMLPLAPGERITTILPLPEDETSWDNLDVMFSTTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDF+Q+NR+GKIAMKL +  DEILSVETCT+++D+LLTT LGQC+RF +  +RVFAGR
Sbjct: 661 KLSDFVQVNRNGKIAMKLEEEGDEILSVETCTEDDDVLLTTALGQCIRFSVDDVRVFAGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NS+GVRGI+L   D++ISM IV H DA+  ER  Y+K  + +RR    D E+I  +  + 
Sbjct: 721 NSIGVRGINLGDSDRIISMTIVGHVDAEPWERAAYLKRSATERRATGVDEEDIALVGEEV 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           + EG +S+ER  EL+ +EQF+LTVS+KGFGKR+SSYDFRIS R GKGIRATD SK  EIG
Sbjct: 781 TEEGQLSDERYDELRAREQFVLTVSQKGFGKRSSSYDFRISGRGGKGIRATDTSKTGEIG 840

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
            LVA FPV+D DQI+LVSD G LIRVPV  IRIASRATKGV IFSTAKDE+VVSVERI 
Sbjct: 841 ELVAAFPVDDGDQIMLVSDGGQLIRVPVGGIRIASRATKGVTIFSTAKDEKVVSVERIS 899



 Score = 49.8 bits (117), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/155 (19%), Positives = 55/155 (35%), Gaps = 6/155 (3%)

Query: 639 DESSWNNLYVVFATKHGNVRRNKLSDFI-----QINRSGKIAMKLDSRDEILSVETCTQE 693
           DE      +V+  ++ G  +R+   DF                K     E+++       
Sbjct: 792 DELRAREQFVLTVSQKGFGKRSSSYDFRISGRGGKGIRATDTSKTGEIGELVAAFPVDDG 851

Query: 694 NDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERIC 753
           + I+L +  GQ +R P+  IR  A R + GV   S AK ++V+S+  +   + D  E   
Sbjct: 852 DQIMLVSDGGQLIRVPVGGIR-IASRATKGVTIFSTAKDEKVVSVERISEPEEDETEEAV 910

Query: 754 YMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEE 788
            +   +      +                   +EE
Sbjct: 911 EVAEGAPATDEGAAGEGGGDEAPIADGDPAGPAEE 945


>gi|319408726|emb|CBI82383.1| DNA gyrase subunit A [Bartonella schoenbuchensis R1]
          Length = 927

 Score =  990 bits (2560), Expect = 0.0,   Method: Composition-based stats.
 Identities = 585/916 (63%), Positives = 717/916 (78%), Gaps = 6/916 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+    ++ +   GI  VSI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M
Sbjct: 1   MTDLTPLTERDVLTGIEPVSIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            +MG+ +NK Y K A + GEVMGK+HPHG+A+IYDAL RMAQD+SLR  LI+GQGNFGS+
Sbjct: 61  NEMGLSFNKSYRKSAGVVGEVMGKFHPHGDASIYDALVRMAQDFSLRNPLIDGQGNFGSI 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTECRL+K +  LL D+ KDTVDF+ NYDG  +EP+VL AR+PN+LVNG G
Sbjct: 121 DGDPPAAMRYTECRLEKISEELLTDIDKDTVDFQDNYDGREREPMVLPARFPNLLVNGSG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEVVDGC+A+ID+P I LD +++II GPDFPTG +ILG +GI++A
Sbjct: 181 GIAVGMATNIPPHNLGEVVDGCIALIDDPSITLDEMIKIIPGPDFPTGGIILGSSGIRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGSI++R    IE+   +R+ I+V+EIPYQ+NKA M+EKIAELVR+KRI  ++DLR
Sbjct: 241 YETGRGSIIMRAKVDIEEIRNNRQAIIVSEIPYQINKATMIEKIAELVRDKRIDGVSDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR GYRVVIELKR A ADV+LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ IL+A
Sbjct: 301 DESDRDGYRVVIELKREAVADVVLNQLYRYTPLQASFGCNMVALNGGKPEQMTLLDILRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FREEVV RRTKYLL +AR+RAHVLVGLAIAVAN+DE++ +IR + +P+ AR +LM+R
Sbjct: 361 FVSFREEVVSRRTKYLLRRARERAHVLVGLAIAVANIDEIIALIRKASDPQIARAQLMER 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A DI  LI LIDD  + I  D T +LSE Q RAILELRL RLT LGRD+I +ELN +
Sbjct: 421 RWLAVDIAPLIKLIDDPRHIIHEDNTYHLSEEQARAILELRLQRLTALGRDEIADELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G++I + LDIL+SRSR++GI+K EL ++++   TPRRT    G  DM+ ED I  E+MVV
Sbjct: 481 GVDITDYLDILASRSRIMGIVKDELNALREVFATPRRTVFGFGSADMDSEDLIAPEEMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSH GY+KRVPL+ YRAQRRGGKGRSG+  +DEDFVT LF+ +THT VLFFSS G VYK
Sbjct: 541 TVSHSGYIKRVPLNTYRAQRRGGKGRSGMATKDEDFVTRLFVANTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+PQ+RG+ALIN+L L QGERITTIMP P+DE  W  L V+FAT  G VRRN
Sbjct: 601 EKVWRLPIGTPQSRGRALINMLPLQQGERITTIMPLPDDEKDWGKLDVMFATMRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDF+Q+NR+GKIAMK  +  DEILSVETCT+ +D++LTT  GQC+RFP+S +RVF GR
Sbjct: 661 KLSDFVQVNRNGKIAMKFGEEGDEILSVETCTEYDDVVLTTANGQCIRFPVSDVRVFVGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           +S+GVRGI++   D+VISM I+ H +A   ER  Y+K + ++RR    D E+I     +S
Sbjct: 721 HSMGVRGINMGDSDKVISMTILKHVEATSTERSAYIKRVISERRAAGADDEDIVIGDEES 780

Query: 780 SV-EGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEI 838
                 +++ER  EL   EQ +LTVSE G+GKR+SSYDFRIS R GKGIRATD SK  EI
Sbjct: 781 EATVTELTDERYMELSAHEQMLLTVSEFGYGKRSSSYDFRISGRGGKGIRATDPSKTAEI 840

Query: 839 GALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
           G LVA FPV   DQI+LVSDKG LIRVPVN IRIA R+TKGV IF+TAK E+VVSVERI 
Sbjct: 841 GKLVAAFPVEAQDQIMLVSDKGQLIRVPVNGIRIAGRSTKGVTIFNTAKGEKVVSVERIS 900

Query: 899 ESE----IVDEAESTE 910
           E E      DE ES +
Sbjct: 901 EPEVNASEPDEEESEQ 916


>gi|319783739|ref|YP_004143215.1| DNA gyrase subunit alpha [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169627|gb|ADV13165.1| DNA gyrase, A subunit [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 933

 Score =  990 bits (2560), Expect = 0.0,   Method: Composition-based stats.
 Identities = 601/914 (65%), Positives = 730/914 (79%), Gaps = 5/914 (0%)

Query: 1   MTEHIIS-SDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFG 59
           MT+       +    GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRILF 
Sbjct: 1   MTDQKTPRGADGGPTGIEPISIVEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILFA 60

Query: 60  MMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS 119
             + G  WN+KYVK AR   +VMGKYHPHG+A+IYDAL RMAQDWSLR+ LI+GQGNFGS
Sbjct: 61  AHESGYHWNRKYVKSARPVADVMGKYHPHGDASIYDALVRMAQDWSLRVPLIDGQGNFGS 120

Query: 120 VDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGG 179
           +DGDPPAA RYTE RL K AH LL+D+ KDTVDF+  YD S  EP VL AR+PN+LVNG 
Sbjct: 121 IDGDPPAAMRYTEARLTKVAHELLEDIDKDTVDFQDTYDASGSEPKVLPARFPNLLVNGS 180

Query: 180 GGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKN 239
           GGIAVGMATNIP HNLGEV +G +A+IDNP IDL ALMEII GPDFPTG ++LGR+GI +
Sbjct: 181 GGIAVGMATNIPPHNLGEVCNGAIAIIDNPAIDLPALMEIIPGPDFPTGGIVLGRSGIYS 240

Query: 240 AYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           AY+TGRGSIV+RG  +IE+   DRE I++TE+PYQVNK++M+EK+AELVR+KRI  I+D+
Sbjct: 241 AYSTGRGSIVMRGRVNIEQRGNDRESIIITEVPYQVNKSSMIEKMAELVRDKRIEGISDI 300

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDESDRQGYRVVIELKR A ADVILNQLYR+T LQ+ F  NMVALNG KPE   L  +LK
Sbjct: 301 RDESDRQGYRVVIELKRDAVADVILNQLYRFTPLQTSFGANMVALNGGKPEVMNLTDMLK 360

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
           AFVAFREEV+ RRTK+LL KARDRAHVLVGLAIAVAN+DEV+++IR +P+P+TAR +LM+
Sbjct: 361 AFVAFREEVITRRTKFLLRKARDRAHVLVGLAIAVANIDEVIKLIRTAPDPQTAREQLME 420

Query: 420 RSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           R W + D++ LI LIDD  + I  DGT  LSE Q RAILELRL RLT LGRD+I +ELN+
Sbjct: 421 RRWPSGDVESLILLIDDPRHRINEDGTYNLSEEQARAILELRLQRLTALGRDEIADELNT 480

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           +G EI + LDILSSR+R+  I+K EL +V+DE  TPRRT + +G  DMEDED I REDMV
Sbjct: 481 IGAEIIDYLDILSSRARVQQIVKDELAAVRDEFGTPRRTELTDGGSDMEDEDLIQREDMV 540

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           VTVSH GY+KRVPLS+YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFFSS G VY
Sbjct: 541 VTVSHSGYIKRVPLSLYRAQRRGGKGRSGMSTKEEDFVTRLFVANTHTPVLFFSSRGIVY 600

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           KEKVWRLPIG+PQ+RGKALIN+L L QGERITTIMP PEDE+SW  LYV+FAT  G VRR
Sbjct: 601 KEKVWRLPIGNPQSRGKALINMLPLEQGERITTIMPLPEDEASWGELYVMFATTRGTVRR 660

Query: 660 NKLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAG 718
           N LSDF+Q+NR+GKIAMKL +  DEIL VETCT ++D+LLT   GQC+RF +  +RVF  
Sbjct: 661 NDLSDFVQVNRNGKIAMKLEEEGDEILGVETCTDKDDVLLTASSGQCIRFSVGDVRVFQS 720

Query: 719 RNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRL---ISGDTEEITSL 775
           RNSVGVRGI++A+ D++ISM+++ H DA   ER  Y+K  +A+RRL    +G+ EEI   
Sbjct: 721 RNSVGVRGITMAETDRIISMSVIEHVDASPAERAAYLKRAAAERRLATETAGEEEEIALT 780

Query: 776 KNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKI 835
             +   E  +S+ R +ELK  EQ++LTV+E G+GKR+SSYDFR++ R GKGIRATDVSK 
Sbjct: 781 NEEIGEETELSDSRYEELKAHEQYVLTVTEFGYGKRSSSYDFRLTGRGGKGIRATDVSKA 840

Query: 836 NEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVE 895
            EIG LVA FPV ++DQI+LVSD GT+IRVPVN IR ASRATKGV IF+TA+ E+VVSVE
Sbjct: 841 AEIGRLVATFPVGNDDQIMLVSDGGTVIRVPVNGIRFASRATKGVTIFNTAEGEKVVSVE 900

Query: 896 RIRESEIVDEAEST 909
           RI E +  +E+E T
Sbjct: 901 RISEPQADEESEET 914



 Score = 54.4 bits (129), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 28/133 (21%), Positives = 52/133 (39%), Gaps = 6/133 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFI-----QINRSGKIAMKLDSRDEILSVETCTQENDILLT 699
             YV+  T+ G  +R+   DF                K      +++      ++ I+L 
Sbjct: 802 EQYVLTVTEFGYGKRSSSYDFRLTGRGGKGIRATDVSKAAEIGRLVATFPVGNDDQIMLV 861

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  G  +R P++ IR FA R + GV   + A+G++V+S+  +    AD +          
Sbjct: 862 SDGGTVIRVPVNGIR-FASRATKGVTIFNTAEGEKVVSVERISEPQADEESEETVEGGAD 920

Query: 760 AQRRLISGDTEEI 772
           A     +G     
Sbjct: 921 AAAASDAGPEGAD 933


>gi|319407150|emb|CBI80788.1| DNA gyrase subunit A [Bartonella sp. 1-1C]
          Length = 922

 Score =  990 bits (2559), Expect = 0.0,   Method: Composition-based stats.
 Identities = 584/911 (64%), Positives = 720/911 (79%), Gaps = 1/911 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+    S+ +   GI  VSI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M
Sbjct: 1   MTDLTTQSEHDVLTGIEPVSIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            +MG+ +NK Y K A + GEVMGK+HPHG+A+IYDAL RMAQD+SLR  LI+GQGNFGSV
Sbjct: 61  NEMGLSFNKSYRKSAGVVGEVMGKFHPHGDASIYDALVRMAQDFSLRNPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTECRL+K A  LL D+ K+TVDF+ NYDG  +EP+VL AR+PN+LVNG G
Sbjct: 121 DGDPPAAMRYTECRLEKVAEELLADIDKETVDFQDNYDGREREPIVLPARFPNLLVNGSG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEV+DGC+A+ID+P+I LD ++EII GPDFPTG +ILGR+G+++A
Sbjct: 181 GIAVGMATNIPPHNLGEVIDGCIALIDSPNITLDEIIEIIPGPDFPTGGIILGRSGVRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGSI++R    IE+   +R+ I+V+EIPYQ+NKA M+EKIAELVR+KRI  I+DLR
Sbjct: 241 YETGRGSIIMRAKVDIEEIRNNRQAIIVSEIPYQINKATMIEKIAELVRDKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR GYRVVIELKR A AD++LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRDGYRVVIELKREAVADIVLNQLYRYTPLQTSFGCNMVALNGGKPEQMTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FREEVV RRTKYLL KAR+RAHVLVGLAIAVAN+DE++ +IR +P+P+TAR +LM+R
Sbjct: 361 FVSFREEVVSRRTKYLLRKARERAHVLVGLAIAVANIDEIIALIRTAPDPQTARVQLMER 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A+D+  LI LIDD  + I  D T  LSE Q RAILELRL RLT LGRD+I +ELN +
Sbjct: 421 RWLAADVAPLIKLIDDPRHIIHEDNTYNLSEEQARAILELRLQRLTALGRDEIADELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G++I E L ILSSR R++GI+K EL ++++E  TPRRT    G  +M +ED IV EDMVV
Sbjct: 481 GVDITEYLHILSSRLRIMGIVKDELSTLREEFVTPRRTVFGFGNAEMNNEDLIVPEDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSH GY+KRVPL+ YRAQRRGGKGRSG+  +DEDFVT LF+ +THT VLFFSS G VYK
Sbjct: 541 TVSHSGYIKRVPLNTYRAQRRGGKGRSGMSTKDEDFVTRLFVSNTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+PQ+RG+AL+N+L L +GERITTIMP PEDE+ W+ L V+FAT  G VRRN
Sbjct: 601 EKVWRLPIGTPQSRGRALVNMLPLQEGERITTIMPLPEDEAGWSELDVMFATTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
           KLSDFIQ+NR+GKIAMKLD  DEILSVETCT+ +D++LTT  GQC+RFP+  +R+F GRN
Sbjct: 661 KLSDFIQVNRNGKIAMKLDDEDEILSVETCTERDDVVLTTANGQCIRFPVIDVRIFVGRN 720

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEE-ITSLKNDS 779
           SVGVRGI++  GD+VISM I+ H +A   ER  Y+K    +RR    DTE+ +   +N+ 
Sbjct: 721 SVGVRGINMVDGDKVISMTILEHVEATSVERSAYIKRAINERRSAGADTEDVVIVDENED 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
             E  +++ER  EL  +EQ +LTVSE G+GKR+SSY+FRIS R GKGIRATD +K  EIG
Sbjct: 781 GDETELTDERYAELAAREQMLLTVSEFGYGKRSSSYEFRISGRGGKGIRATDPNKTVEIG 840

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FPV   DQI+LVSD G LIRVP+  IRIA R+TKGV IF+TAK E+VVSVERI +
Sbjct: 841 KLVAAFPVEAQDQIMLVSDGGQLIRVPIEGIRIAGRSTKGVTIFNTAKGEKVVSVERISD 900

Query: 900 SEIVDEAESTE 910
            E        +
Sbjct: 901 PEDDANQLDDD 911



 Score = 52.9 bits (125), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 91/240 (37%), Gaps = 13/240 (5%)

Query: 528 EDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHT 587
             E C  R+D+V+T +  G   R P+   R            +   +        +  H 
Sbjct: 686 SVETCTERDDVVLT-TANGQCIRFPVIDVRIFVGRNSVGVRGINMVDGDKVISMTILEHV 744

Query: 588 SVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLY 647
                    ++ +    R   G+        + I+  N+    T +      E +     
Sbjct: 745 EATSVERSAYIKRAINERRSAGADTED----VVIVDENEDGDETELTDERYAELAAREQM 800

Query: 648 VVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILS------VETCTQENDILLTTK 701
           ++  ++ G  +R+   +F +I+  G   ++    ++ +             ++ I+L + 
Sbjct: 801 LLTVSEFGYGKRSSSYEF-RISGRGGKGIRATDPNKTVEIGKLVAAFPVEAQDQIMLVSD 859

Query: 702 LGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQ 761
            GQ +R PI  IR  AGR++ GV   + AKG++V+S+  +   + D ++     +  S  
Sbjct: 860 GGQLIRVPIEGIR-IAGRSTKGVTIFNTAKGEKVVSVERISDPEDDANQLDDDSEKHSGM 918


>gi|90419651|ref|ZP_01227561.1| DNA gyrase/topo II, topoisomerase IV, A subunit [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336588|gb|EAS50329.1| DNA gyrase/topo II, topoisomerase IV, A subunit [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 947

 Score =  990 bits (2559), Expect = 0.0,   Method: Composition-based stats.
 Identities = 573/911 (62%), Positives = 709/911 (77%), Gaps = 2/911 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           M E  I++  E   GI S+SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+ M
Sbjct: 1   MAEDDITTPPERPTGIDSISIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYAM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
             MG+ +N+ Y K A + GEVMGKYHPHG+++IYDAL RMAQDWSLR  LIEGQGNFGS+
Sbjct: 61  HGMGLTFNRPYRKSAGVVGEVMGKYHPHGDSSIYDALVRMAQDWSLRAPLIEGQGNFGSI 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTE RL K +  LL D+ K+TV+F+ NYDG  QEPVVL AR+PN+LVNG G
Sbjct: 121 DGDPPAAMRYTETRLYKVSDALLADIDKETVNFQDNYDGREQEPVVLPARFPNLLVNGSG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGE+VDGCVA+IDNP I L+ LM  I GPDFPTGA++LGR GI +A
Sbjct: 181 GIAVGMATNIPPHNLGEIVDGCVAMIDNPAITLEELMGFIPGPDFPTGAIVLGRAGILSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y+TGRGSI++RG +H+E    DRE IV+TE+P+QVNK+ M+EK+A+LVR+KRI  I+D+R
Sbjct: 241 YSTGRGSILMRGKAHVEPMRNDREAIVITEVPFQVNKSTMIEKMADLVRDKRIEGISDIR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR GYRVV+ELKR AS+DVILNQLYR+T LQ+ F  NMVALNG +PE+ TL  +L A
Sbjct: 301 DESDRDGYRVVVELKRDASSDVILNQLYRFTPLQTTFGANMVALNGGRPEQMTLPDMLSA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           F++FREEVV RRTKYLL KAR+RAHVLVGLAIAVAN+DEV+++IR +P+P TAR +LM R
Sbjct: 361 FISFREEVVNRRTKYLLRKARERAHVLVGLAIAVANIDEVIKLIRAAPDPATAREQLMTR 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
           +W A D+  LI LIDD  + I  +GT  LSE Q RAIL+LRL RLT LGRD+I +ELN +
Sbjct: 421 AWEAKDVAPLIRLIDDPRHRITEEGTYRLSEAQARAILDLRLQRLTALGRDEIGDELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EI+E L+ILSSR R+  IIK+EL++V+DE  TPRRT + EG  DM+DED I REDMVV
Sbjct: 481 GEEIREYLEILSSRVRVREIIKEELIAVRDEFATPRRTELSEGAADMDDEDLIPREDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDE-DFVTDLFIVSTHTSVLFFSSLGFVY 599
           TVSH GY+KRVPL+ YR+QRRGGKGR+G+ ++++ D VT LF+ +THT VLFFSS G VY
Sbjct: 541 TVSHGGYIKRVPLATYRSQRRGGKGRAGMSLKNDEDSVTRLFVANTHTPVLFFSSRGIVY 600

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           KEKVWRLP+ SPQ+RGKALIN+L L +GERIT+I+P P D  +   L V+FAT  G VRR
Sbjct: 601 KEKVWRLPLASPQSRGKALINMLPLEKGERITSILPLPSDPDAAAELNVMFATTRGTVRR 660

Query: 660 NKLSDFIQINRSGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAG 718
           NKLSDF Q+NR+GKIAMKLD   DEIL+V TC++++D+LLT   GQC+RF  + +RVFAG
Sbjct: 661 NKLSDFTQVNRNGKIAMKLDEDGDEILAVATCSEDDDVLLTAASGQCIRFQATDVRVFAG 720

Query: 719 RNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKND 778
           RNSVGVRGISL +GD+VISMAI+ H DA   ER  Y+K   A      GD     +++ +
Sbjct: 721 RNSVGVRGISLGEGDRVISMAILRHVDATPAERSSYLKMRRAVEGASDGDLTAEPTVEEE 780

Query: 779 SSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEI 838
            + +  I +ER   L   E+ ILTVSE G+GKR+SSY+FR+  R GKGIRATD S+ +EI
Sbjct: 781 GAGDVAIDQERYAYLSAAEEMILTVSEFGYGKRSSSYEFRVIGRGGKGIRATDTSRASEI 840

Query: 839 GALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
           G L+A FPV   DQI+LV+D+G LIRVPV  IR A RAT+GV IF TA  ERVVSVERI 
Sbjct: 841 GQLMAGFPVESGDQILLVTDRGQLIRVPVEGIRTAGRATRGVTIFKTADGERVVSVERIP 900

Query: 899 ESEIVDEAEST 909
           +    +  E+ 
Sbjct: 901 DQGADEAGEAE 911



 Score = 52.1 bits (123), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 27/147 (18%), Positives = 57/147 (38%), Gaps = 6/147 (4%)

Query: 648 VVFATKHGNVRRNKLSDFIQINR-----SGKIAMKLDSRDEILSVETCTQENDILLTTKL 702
           ++  ++ G  +R+   +F  I R           +     ++++       + ILL T  
Sbjct: 802 ILTVSEFGYGKRSSSYEFRVIGRGGKGIRATDTSRASEIGQLMAGFPVESGDQILLVTDR 861

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR + GV     A G++V+S+  +    AD               
Sbjct: 862 GQLIRVPVEGIRT-AGRATRGVTIFKTADGERVVSVERIPDQGADEAGEAEADTIDGDLE 920

Query: 763 RLISGDTEEITSLKNDSSVEGNISEER 789
                 +    +  + ++ +G++  + 
Sbjct: 921 DGGVDGSTPDETGPDAAAPDGDVPPQE 947


>gi|319404135|emb|CBI77726.1| DNA gyrase subunit A [Bartonella rochalimae ATCC BAA-1498]
          Length = 922

 Score =  990 bits (2558), Expect = 0.0,   Method: Composition-based stats.
 Identities = 584/911 (64%), Positives = 722/911 (79%), Gaps = 1/911 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+    S+ +   GI  VSI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M
Sbjct: 1   MTDLTTQSEHDVLTGIEPVSIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            +MG+ +NK Y K A + GEVMGK+HPHG+A+IYDAL RMAQD+SLR  LI+GQGNFGSV
Sbjct: 61  NEMGLSFNKSYRKSAGVVGEVMGKFHPHGDASIYDALVRMAQDFSLRNPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTECRL+K A  LL D+ K+TVDF+ NYDG  +EP+VL AR+PN+LVNG G
Sbjct: 121 DGDPPAAMRYTECRLEKVAEELLADIDKETVDFQDNYDGREREPIVLPARFPNLLVNGSG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEV+DGC+A+IDNP+I LD ++EII GPDFPTG +ILGR+G+++A
Sbjct: 181 GIAVGMATNIPPHNLGEVIDGCIALIDNPNITLDEIIEIIPGPDFPTGGIILGRSGVRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGSI++R    IE+   +R+ I+V+EIPYQ+NKA M+EKIAELVR+KRI  I+DLR
Sbjct: 241 YETGRGSIIMRAKVDIEEIRNNRQAIIVSEIPYQINKATMIEKIAELVRDKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR GYRVVIELKR A AD++LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRDGYRVVIELKREAVADIVLNQLYRYTPLQTSFGCNMVALNGGKPEQMTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FREEVV RRTKYLL KAR+RAHVLVGLAIAVAN+DE++ +IR +P+P+TAR +LM+R
Sbjct: 361 FVSFREEVVSRRTKYLLRKARERAHVLVGLAIAVANIDEIIALIRTAPDPQTARVQLMER 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A+D+  LI LIDD  + I  D T  LSE Q RAILELRL RLT LGRD+I +ELN +
Sbjct: 421 RWLAADVASLIKLIDDPRHIIHEDNTYNLSEEQARAILELRLQRLTALGRDEIADELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G++I + L ILSSR R++GI+K EL ++++E  TPRRT    G  +M++ED IV EDMVV
Sbjct: 481 GVDITDYLHILSSRLRIMGIVKNELSTLREEFVTPRRTVFGFGNAEMDNEDLIVPEDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSH GY+KRVPL+ YRAQRRGGKGRSG+  +DEDFVT LF+ +THT VLFFSS G VYK
Sbjct: 541 TVSHSGYIKRVPLNTYRAQRRGGKGRSGMSTKDEDFVTRLFVSNTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+PQ+RG+AL+N+L L +GERITTIMP PEDE+SW+ L V+FAT  G VRRN
Sbjct: 601 EKVWRLPIGTPQSRGRALVNMLPLQEGERITTIMPLPEDEASWSELDVMFATTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
           KLSDFIQ+NR+GKIAMKLD  DEILSVETCT+ +D++LTT  GQC+RFP+  +RVF GRN
Sbjct: 661 KLSDFIQVNRNGKIAMKLDDEDEILSVETCTERDDVVLTTANGQCIRFPVIDVRVFVGRN 720

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEE-ITSLKNDS 779
           SVGVRGI++  GD+VISM I+ H +A   ER  Y+K    +RR    DTE+ +   +++ 
Sbjct: 721 SVGVRGINMVDGDKVISMTILEHVEATSVERSAYIKRAINERRSAGADTEDVVIVDEDED 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
             E  +++ER  EL  +EQ +LTVSE G+GKR+SSY+FRIS R GKGIRATD +K  EIG
Sbjct: 781 GDETELTDERYAELAAREQMLLTVSEFGYGKRSSSYEFRISGRGGKGIRATDPNKTVEIG 840

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FPV   DQI+LVS+ G LIRVP+  IRIA R+TKGV IF+TAK E+VVSVERI +
Sbjct: 841 KLVAAFPVEAQDQIMLVSNGGQLIRVPIEGIRIAGRSTKGVTIFNTAKGEKVVSVERISD 900

Query: 900 SEIVDEAESTE 910
            E        +
Sbjct: 901 PEDDANQLDDD 911



 Score = 52.5 bits (124), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 42/240 (17%), Positives = 91/240 (37%), Gaps = 13/240 (5%)

Query: 528 EDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHT 587
             E C  R+D+V+T +  G   R P+   R            +   +        +  H 
Sbjct: 686 SVETCTERDDVVLT-TANGQCIRFPVIDVRVFVGRNSVGVRGINMVDGDKVISMTILEHV 744

Query: 588 SVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLY 647
                    ++ +    R   G+        + I+  ++    T +      E +     
Sbjct: 745 EATSVERSAYIKRAINERRSAGADTED----VVIVDEDEDGDETELTDERYAELAAREQM 800

Query: 648 VVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILS------VETCTQENDILLTTK 701
           ++  ++ G  +R+   +F +I+  G   ++    ++ +             ++ I+L + 
Sbjct: 801 LLTVSEFGYGKRSSSYEF-RISGRGGKGIRATDPNKTVEIGKLVAAFPVEAQDQIMLVSN 859

Query: 702 LGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQ 761
            GQ +R PI  IR  AGR++ GV   + AKG++V+S+  +   + D ++     +  S  
Sbjct: 860 GGQLIRVPIEGIR-IAGRSTKGVTIFNTAKGEKVVSVERISDPEDDANQLDDDSEKHSGM 918


>gi|220924060|ref|YP_002499362.1| DNA gyrase subunit A [Methylobacterium nodulans ORS 2060]
 gi|219948667|gb|ACL59059.1| DNA gyrase, A subunit [Methylobacterium nodulans ORS 2060]
          Length = 911

 Score =  990 bits (2558), Expect = 0.0,   Method: Composition-based stats.
 Identities = 558/899 (62%), Positives = 696/899 (77%), Gaps = 6/899 (0%)

Query: 3   EHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQ 62
           ++  +        I  VSITDEM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+ M +
Sbjct: 6   KNDETGAPPPASDIKPVSITDEMRRSYLDYAMSVIVSRALPDARDGLKPVHRRILYSMYE 65

Query: 63  MGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDG 122
            G   ++KYVK ARI G+VMG+YHPHG+ +IYDAL RMAQD+++R++L++GQGNFGS+DG
Sbjct: 66  NGYLPDRKYVKSARIVGDVMGQYHPHGDQSIYDALVRMAQDFAMRIMLVDGQGNFGSIDG 125

Query: 123 DPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGI 182
           DPPAA RYTE RL K A  LL+D+ K+TVDF PNYD S  EP VL AR+PN+LVNG GGI
Sbjct: 126 DPPAAMRYTESRLAKPAMALLEDIDKNTVDFNPNYDESKDEPAVLPARFPNLLVNGAGGI 185

Query: 183 AVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYA 242
           AVGMATNIP HNLGEV+DGCVA+ID+P + ++AL EII GPDFPTG +ILGR G + AY 
Sbjct: 186 AVGMATNIPPHNLGEVIDGCVALIDDPSLTIEALNEIIPGPDFPTGGLILGRAGTRAAYM 245

Query: 243 TGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDE 302
           TGRGS+V+R  SH+E+   +RE +V TEIPYQVNKA+++EKIA+LVREKRI  +ADLRDE
Sbjct: 246 TGRGSVVMRAKSHVEEIRKEREALVFTEIPYQVNKASLVEKIADLVREKRIEGVADLRDE 305

Query: 303 SDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFV 362
           SDR G R+V+ELKR A ADV+LNQLYRYT LQ+ F  NMVALNG +PE   L  +++AF+
Sbjct: 306 SDRDGMRIVVELKRDAMADVVLNQLYRYTPLQTSFGCNMVALNGGRPELLNLKDLIQAFI 365

Query: 363 AFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSW 422
            FREEVV RRTK+LL KAR+RAHVL GLAIAVAN+DEV+R+IR SP+P +AR  LM R W
Sbjct: 366 DFREEVVSRRTKFLLRKARERAHVLCGLAIAVANIDEVIRLIRTSPDPNSAREALMSRDW 425

Query: 423 NASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGI 482
            A+DI  LI L+DD  + +  DGT  LSE Q RAIL+LRL RLT LGRD++ +EL  L  
Sbjct: 426 PAADIAPLIALVDDPRHRVADDGTYRLSEAQARAILDLRLQRLTALGRDEVGDELKQLAD 485

Query: 483 EIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTV 542
           EI + LDIL SR+R+LGI+K EL  V+ E  TPR+T I +   ++EDED I REDMVVTV
Sbjct: 486 EIADYLDILRSRARILGIVKAELAEVRAEYATPRKTEIQDWDSNVEDEDLIQREDMVVTV 545

Query: 543 SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEK 602
           SH GY+KRVPLS YRAQRRGGKGRSG+  RDEDFVT LF+ +THT VLFFSS G  YKEK
Sbjct: 546 SHAGYIKRVPLSTYRAQRRGGKGRSGMTTRDEDFVTRLFVANTHTPVLFFSSQGQAYKEK 605

Query: 603 VWRLPIGSPQARGKALINILSLNQ-GERITTIMPFPEDESSWNNLYVVFATKHGNVRRNK 661
           VWRLP+ +P ARGKAL+NIL L+Q GERITTIMP PEDE+SW  L V+FAT  GNVRRNK
Sbjct: 606 VWRLPLAAPNARGKALVNILPLDQAGERITTIMPLPEDEASWETLDVMFATASGNVRRNK 665

Query: 662 LSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNS 721
           LSDF+Q+NR+GKIAMKLD  D I+ VE CT+ +D+LLTT  GQC+RFP++ +RVF GR+S
Sbjct: 666 LSDFVQVNRNGKIAMKLDEGDHIVHVEICTEADDVLLTTAAGQCIRFPVTDVRVFKGRDS 725

Query: 722 VGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSV 781
            GVRGI+L K D+VISM I+ H +A  +ER  Y++  +A RR      +  T+ + D   
Sbjct: 726 TGVRGINLGKDDRVISMTILRHFEATPEERQAYLRRANADRRATGEAVDLPTAPEADGEE 785

Query: 782 ---EGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEI 838
                ++ +ER  ++   EQF+LT+SE+GFGKRTSS+++RIS R GKGI+A +V+  N  
Sbjct: 786 TTASIDLGQERYIDMGAAEQFVLTLSERGFGKRTSSFEYRISGRGGKGIKAMEVNARN-- 843

Query: 839 GALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERI 897
           G LVA FPV  +DQI+LV++ G LIRVPV++IRI  RA++GV +F+TAKDERVVSVE I
Sbjct: 844 GHLVASFPVEPSDQIMLVTNGGQLIRVPVDDIRIVGRASQGVTVFNTAKDERVVSVEHI 902



 Score =  109 bits (271), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/222 (20%), Positives = 80/222 (36%), Gaps = 14/222 (6%)

Query: 693 ENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLH-------AD 745
           E+ ++  +  G   R P+S  R    R   G  G++    D V  + +          + 
Sbjct: 539 EDMVVTVSHAGYIKRVPLSTYRA-QRRGGKGRSGMTTRDEDFVTRLFVANTHTPVLFFSS 597

Query: 746 ADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSE 805
                +    +   A           I  L         I      E   +   ++  + 
Sbjct: 598 QGQAYKEKVWRLPLAAPNARGKALVNILPLDQAGERITTIMPLPEDEASWETLDVMFATA 657

Query: 806 KGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRV 865
            G  +R    DF   NR+GK   A  + +      +V V    + D ++L +  G  IR 
Sbjct: 658 SGNVRRNKLSDFVQVNRNGK--IAMKLDEG---DHIVHVEICTEADDVLLTTAAGQCIRF 712

Query: 866 PVNEIRI-ASRATKGVVIFSTAKDERVVSVERIRESEIVDEA 906
           PV ++R+   R + GV   +  KD+RV+S+  +R  E   E 
Sbjct: 713 PVTDVRVFKGRDSTGVRGINLGKDDRVISMTILRHFEATPEE 754


>gi|319898825|ref|YP_004158918.1| DNA gyrase subunit A [Bartonella clarridgeiae 73]
 gi|319402789|emb|CBI76338.1| DNA gyrase subunit A [Bartonella clarridgeiae 73]
          Length = 923

 Score =  988 bits (2555), Expect = 0.0,   Method: Composition-based stats.
 Identities = 576/912 (63%), Positives = 718/912 (78%), Gaps = 2/912 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+    S+ +   GI  VSI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M
Sbjct: 1   MTDLTTQSEHDVLTGIEPVSIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            +MG+ +NK Y K A + GEVMGK+HPHG+A+IYDAL RMAQD+SLR  LI+GQGNFGSV
Sbjct: 61  NEMGLSFNKSYRKSAGVVGEVMGKFHPHGDASIYDALVRMAQDFSLRNPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTECRL+K A  LL D+ K+T+DF+ NYDG  +EPVVL AR+PN+LVNG G
Sbjct: 121 DGDPPAAMRYTECRLEKIAEELLADIDKETIDFQDNYDGREREPVVLPARFPNLLVNGSG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEV+DGC+A+IDNP I LD ++EII GPDFPTG +ILGR+GI++A
Sbjct: 181 GIAVGMATNIPPHNLGEVIDGCIALIDNPTITLDEIIEIIPGPDFPTGGIILGRSGIRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGSI++R    IE+   +R+ I+V+EIPYQ+NKA M+EKIAELVR+KRI  I+DLR
Sbjct: 241 YETGRGSIIMRAKVDIEEVRNNRQAIIVSEIPYQINKATMIEKIAELVRDKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR GYRVVIELKR A AD++LNQLY YT LQ+ F  N+VALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRDGYRVVIELKREAVADIVLNQLYHYTPLQTSFGCNIVALNGGKPEQMTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FREEVV RRTKYLL KAR+RAH+LVGLAIAVAN+DE++ +IR +P+P+TAR +LM+R
Sbjct: 361 FVSFREEVVSRRTKYLLRKARERAHILVGLAIAVANIDEIIALIREAPDPQTARLQLMER 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A+D+  L+ LIDD  + I  + T  LSE Q RAILELRL RLT LGRD+I +ELN +
Sbjct: 421 RWLAADVAFLVKLIDDPRHIIHENNTYNLSEEQARAILELRLQRLTALGRDEIADELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G++I + L IL+SR R++GI+K EL ++++E   PRRT    G ++M++ED IV EDMVV
Sbjct: 481 GVDITDYLHILASRLRIMGIVKDELSTLREEFAAPRRTIFGFGNIEMDNEDLIVPEDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSH GY+KRVPL+ YRAQRRGGKGRSG+  +DEDFVT LF+ +THT VLFFSS G VYK
Sbjct: 541 TVSHSGYIKRVPLNTYRAQRRGGKGRSGMSTKDEDFVTRLFVSNTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+PQ+RG+AL+N+L L +GERITTIMP PEDE+SW+ L V+FAT  G VRRN
Sbjct: 601 EKVWRLPIGTPQSRGRALVNMLPLQEGERITTIMPLPEDEASWSKLDVMFATTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDF+Q+NR+GKIAMKLD   D ILSVETCT+ +D++LTT  GQC+RFP+  +RVFAGR
Sbjct: 661 KLSDFVQVNRNGKIAMKLDEEGDAILSVETCTERDDVVLTTANGQCIRFPVIDVRVFAGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NSVGVRGI++  GD+VISM I+ H +A   ER  Y+K    +RR    D E++  +  + 
Sbjct: 721 NSVGVRGINMVDGDKVISMTILEHVEATSVERSAYIKRAINERRAAGADAEDVVIVDENG 780

Query: 780 S-VEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEI 838
              E  +++ER  EL  +EQ +LTVSE G+GKR+SSY+FRIS R GKGIRATD +K  EI
Sbjct: 781 EGTETELTDERYAELAAREQMLLTVSEFGYGKRSSSYEFRISGRGGKGIRATDPTKTAEI 840

Query: 839 GALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
           G LVA FPV   DQI+LVSD G LIR+P+  IRIA R+TKGV IF+TAK E+VVSVERI 
Sbjct: 841 GKLVAAFPVKAQDQIMLVSDGGQLIRIPIEGIRIAGRSTKGVTIFNTAKGEKVVSVERIS 900

Query: 899 ESEIVDEAESTE 910
           + E        +
Sbjct: 901 DPEDDANQLDDD 912



 Score = 54.4 bits (129), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 46/238 (19%), Positives = 91/238 (38%), Gaps = 11/238 (4%)

Query: 528 EDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHT 587
             E C  R+D+V+T +  G   R P+   R     G+   GV   +      +  ++   
Sbjct: 687 SVETCTERDDVVLT-TANGQCIRFPVIDVRV--FAGRNSVGVRGINMVDGDKVISMTILE 743

Query: 588 SVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLY 647
            V   S     Y ++       +       +I  +  N     T +      E +     
Sbjct: 744 HVEATSVERSAYIKRAINERRAAGADAEDVVI--VDENGEGTETELTDERYAELAAREQM 801

Query: 648 VVFATKHGNVRRNKLSDFI-QINRSGKIAM----KLDSRDEILSVETCTQENDILLTTKL 702
           ++  ++ G  +R+   +F         I      K     ++++      ++ I+L +  
Sbjct: 802 LLTVSEFGYGKRSSSYEFRISGRGGKGIRATDPTKTAEIGKLVAAFPVKAQDQIMLVSDG 861

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSA 760
           GQ +R PI  IR  AGR++ GV   + AKG++V+S+  +   + D ++     +  S 
Sbjct: 862 GQLIRIPIEGIR-IAGRSTKGVTIFNTAKGEKVVSVERISDPEDDANQLDDDSEKHSG 918


>gi|154248237|ref|YP_001419195.1| DNA gyrase, A subunit [Xanthobacter autotrophicus Py2]
 gi|154162322|gb|ABS69538.1| DNA gyrase, A subunit [Xanthobacter autotrophicus Py2]
          Length = 914

 Score =  988 bits (2554), Expect = 0.0,   Method: Composition-based stats.
 Identities = 543/911 (59%), Positives = 679/911 (74%), Gaps = 5/911 (0%)

Query: 1   MTE-HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFG 59
           M +        E    I  VSIT+E+  SYL YA++VI+ RA+PD+RDGLKPVHRRILF 
Sbjct: 1   MADSETPKPGGEPPSDIRPVSITEELSRSYLDYAMSVIVARALPDVRDGLKPVHRRILFS 60

Query: 60  MMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS 119
           M + G EWNK Y K AR+ G+V+GKYHPHG+ ++YDAL RMAQ +++RL L++GQGNFGS
Sbjct: 61  MHENGYEWNKSYRKSARVVGDVIGKYHPHGDQSVYDALVRMAQTFAMRLPLVDGQGNFGS 120

Query: 120 VDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGG 179
           VDGD PAA RYTE RL+K  + LLDDL KDTVDF+ NYD S  EP VL A++PN+LVNG 
Sbjct: 121 VDGDAPAAMRYTEVRLEKVTNALLDDLDKDTVDFQDNYDNSEHEPTVLPAKFPNLLVNGA 180

Query: 180 GGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKN 239
           GGIAVGMATNIP HNLGE+VD  VA++D+P ++ +AL++++ GPDFPTGA+ILGRTGI+ 
Sbjct: 181 GGIAVGMATNIPPHNLGEIVDTTVALLDDPTLEPEALLDLLPGPDFPTGALILGRTGIRQ 240

Query: 240 AYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           AY TGRGSI++R    IE    +RE ++VTEIPYQVNKA M+EK+AELVR+KRI  IA++
Sbjct: 241 AYLTGRGSILMRAKVAIENIRKEREALIVTEIPYQVNKATMIEKMAELVRDKRIEGIAEI 300

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDESDR G RVVIE+KR A ADV+LN LYR T LQ+ F VNMVAL+G KP   TL  +L 
Sbjct: 301 RDESDRDGMRVVIEIKRDAQADVVLNNLYRLTLLQTSFGVNMVALSGGKPGVLTLHDVLT 360

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
           AF+AFREEV+ RRTK+LL KARDRAHVLVGLAIAVAN+DEV+R+IR +P+P +AR  LM 
Sbjct: 361 AFIAFREEVISRRTKFLLRKARDRAHVLVGLAIAVANIDEVIRLIRTAPDPASAREALMA 420

Query: 420 RSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           R W A D+  LI LI D  + +G D T  LS  Q RAIL+LRL RLT LGRD+I  EL+ 
Sbjct: 421 RDWPAKDMAPLIALIADPRHKLGPDDTYRLSFEQARAILDLRLQRLTALGRDEIAEELDK 480

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           L +EI + LDIL+SR R+  I++ EL+++K+E  TPRRT IVEG  D+EDED I RE+MV
Sbjct: 481 LAVEIADYLDILASRPRMRAIVRAELIAIKEEFGTPRRTEIVEGFGDLEDEDLIQREEMV 540

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           VTVSH GY+KRVPLS YRAQRRGGKGRS +  RDEDFVT LF+ STH  VLFFSS G VY
Sbjct: 541 VTVSHAGYIKRVPLSTYRAQRRGGKGRSAMQTRDEDFVTRLFVASTHAPVLFFSSKGQVY 600

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           K KVWRLP+ +PQARGKALINIL L Q ERIT+++  PED      L ++FAT  G VRR
Sbjct: 601 KLKVWRLPLAAPQARGKALINILPLEQDERITSVVLLPEDSDENERLQIMFATTGGTVRR 660

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           N L+DF Q+NR+GKIAMKL+  + I  V  CT+++D+LLTT  G C+RFP++ +RVF GR
Sbjct: 661 NALTDFQQVNRNGKIAMKLNEGEAIADVGLCTEDDDVLLTTAAGACIRFPVTDVRVFKGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           +SVGVRGI L  GD +ISMAI+ H DA  +ER+ Y+K   A               +  +
Sbjct: 721 DSVGVRGIRLEDGDTIISMAIIGHVDASAEERLAYIKRRRAL--AGEATEAGDVEAEEGA 778

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           S  G++ ++R  E+  KEQFILTVSE G+GKRTSSY++R++ R GKGI A  V++ N  G
Sbjct: 779 SGNGHLGQDRYAEMGAKEQFILTVSENGYGKRTSSYEYRVTGRGGKGIVAMAVNERN--G 836

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FPV D DQI+LV+D G LIR PV+ IRI  RA++GV++F TA+ ERVVSVE I +
Sbjct: 837 RLVASFPVEDQDQIMLVTDGGQLIRCPVDGIRIVGRASQGVIVFDTAEGERVVSVEHISD 896

Query: 900 SEIVDEAESTE 910
               + ++  E
Sbjct: 897 DAGAENSDGEE 907


>gi|170742567|ref|YP_001771222.1| DNA gyrase, A subunit [Methylobacterium sp. 4-46]
 gi|168196841|gb|ACA18788.1| DNA gyrase, A subunit [Methylobacterium sp. 4-46]
          Length = 914

 Score =  988 bits (2554), Expect = 0.0,   Method: Composition-based stats.
 Identities = 552/901 (61%), Positives = 687/901 (76%), Gaps = 6/901 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           + E   +        I  VSITDEM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+ M
Sbjct: 3   LAEKDETGAPPPASDIKPVSITDEMRRSYLDYAMSVIVSRALPDARDGLKPVHRRILYSM 62

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            + G    +KYVK ARI G+VMG+YHPHG+ +IYDAL RMAQD+++RL+L++GQGNFGS+
Sbjct: 63  YENGYLPERKYVKSARIVGDVMGQYHPHGDQSIYDALVRMAQDFAMRLMLVDGQGNFGSI 122

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTE RL K A  LL+D+ K+TVDF PNYD S  EP VL AR+PN+LVNG G
Sbjct: 123 DGDPPAAMRYTESRLAKPAMALLEDIDKNTVDFNPNYDESKDEPAVLPARFPNLLVNGAG 182

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEV++GC+A+ID+P + ++ L EII GPDFPTG  ILGR G + A
Sbjct: 183 GIAVGMATNIPPHNLGEVIEGCIALIDDPALTIEGLNEIIPGPDFPTGGQILGRAGTRAA 242

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGS+++R  SH+E+   +RE +V TEIPYQVNKA+++EKIAELVR+KRI  ++DLR
Sbjct: 243 YMTGRGSVIMRAKSHVEEIRKEREALVFTEIPYQVNKASLVEKIAELVRDKRIEGVSDLR 302

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR G R+V+ELKR A ADV+LNQLYRYT LQ+ F  NMVALNG +PE   L  +++A
Sbjct: 303 DESDRDGMRIVVELKRDAMADVVLNQLYRYTPLQTSFGCNMVALNGGRPELLNLKDLIQA 362

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           F+ FREEVV RRTK+LL KAR+RAHVL GLAIAVAN+DEV+R+IR SP+P +AR  LM R
Sbjct: 363 FIDFREEVVSRRTKFLLRKARERAHVLCGLAIAVANIDEVIRLIRTSPDPNSAREALMAR 422

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A DI  LI L+DD  + +  DGT  LS+ Q RAIL+LRL RLT LGRD++ +EL  L
Sbjct: 423 DWPAVDIAPLIALVDDPRHRVADDGTYRLSDAQARAILDLRLQRLTALGRDEVGDELKQL 482

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
             EI + LDIL SR+R+LGI+K EL  V+ E  TPRRT I +    +EDED I REDMVV
Sbjct: 483 ADEIADYLDILRSRARILGIVKAELAEVRAEFATPRRTEIQDWDSTVEDEDLIQREDMVV 542

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSH GY+KRVPLS YRAQRRGGKGRSG+  RDEDFVT LF+ +THT VLFFSS G  YK
Sbjct: 543 TVSHAGYIKRVPLSTYRAQRRGGKGRSGMTTRDEDFVTRLFVANTHTPVLFFSSQGQAYK 602

Query: 601 EKVWRLPIGSPQARGKALINILSLNQG-ERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           EKVWRLP+ +P ARGKAL+NIL L+   ERITTIMP PEDE+SW  L V+FAT  G+VRR
Sbjct: 603 EKVWRLPLAAPNARGKALVNILPLDTSGERITTIMPLPEDEASWETLDVMFATASGHVRR 662

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           NKLSDF+Q+NR+GKIAMKLD  D I+ VE CT+ +D+LLTT  GQC+RFP++ +RVF GR
Sbjct: 663 NKLSDFVQVNRNGKIAMKLDEGDHIVHVEICTEADDVLLTTAAGQCIRFPVTDVRVFKGR 722

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           +S GVRGI+L  GD+VISM I+ H +A  +ER  Y++  +A RR      E   + + D 
Sbjct: 723 DSTGVRGINLGSGDRVISMTILRHFEATPEERQAYLRRANADRRATGEAIELPATPEADG 782

Query: 780 SVEG---NISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKIN 836
                  ++ +ER   +   EQF+LT+SE+GFGKRTSS+++RIS R GKGI+A +V+  N
Sbjct: 783 EETAASIDLDQERYIAMGAAEQFVLTLSERGFGKRTSSFEYRISGRGGKGIKAMEVNTRN 842

Query: 837 EIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVER 896
             G LVA FPV  +DQI+LV++ G LIRVPV++IRI  RA++GV +F+TAKDERVVSVE 
Sbjct: 843 --GHLVASFPVETSDQIMLVTNGGQLIRVPVDDIRIVGRASQGVTVFNTAKDERVVSVEH 900

Query: 897 I 897
           I
Sbjct: 901 I 901


>gi|323136305|ref|ZP_08071387.1| DNA gyrase, A subunit [Methylocystis sp. ATCC 49242]
 gi|322398379|gb|EFY00899.1| DNA gyrase, A subunit [Methylocystis sp. ATCC 49242]
          Length = 912

 Score =  988 bits (2553), Expect = 0.0,   Method: Composition-based stats.
 Identities = 550/901 (61%), Positives = 683/901 (75%), Gaps = 6/901 (0%)

Query: 1   MTEHIISSDEEEE--KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILF 58
           M E     D+ E+    I  VSI DEM+ SYL YA++VI+ RA+PD+RDGLKPVHRRILF
Sbjct: 1   MAEDDTKKDDPEKHGSDIRPVSIADEMKRSYLDYAMSVIVSRALPDVRDGLKPVHRRILF 60

Query: 59  GMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFG 118
            M + G   +K YVK ARI G+VMGKYHPHG+AAIYDAL RMAQ +S+RL+L++GQGNFG
Sbjct: 61  SMNENGHTPDKPYVKSARIVGDVMGKYHPHGDAAIYDALVRMAQPFSMRLMLVDGQGNFG 120

Query: 119 SVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNG 178
           SVD DPPAA RYTE RL K A  LL+D+ + TVDF+PNYDG   EP VL AR+PN+LVNG
Sbjct: 121 SVDNDPPAAMRYTESRLAKPALALLEDIDEGTVDFQPNYDGKESEPTVLPARFPNLLVNG 180

Query: 179 GGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIK 238
            GGIAVGMATNIP HNLGEV+D  +A+ID PD+ +  LMEI+ GPDFPT A ILGR GI+
Sbjct: 181 AGGIAVGMATNIPPHNLGEVIDAAIALIDKPDMTVAELMEIVPGPDFPTAATILGRGGIR 240

Query: 239 NAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIAD 298
           NAYATGRGSI++R  + IE    +RE I+ TEIPYQVNKAA++E+IAELV+EKR+  IAD
Sbjct: 241 NAYATGRGSIIMRAKAEIETLRKEREAIIFTEIPYQVNKAALIERIAELVKEKRVEGIAD 300

Query: 299 LRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGIL 358
           LRDESDR G R+V+ELKR A ADV+LNQL+R+T+LQS F+VNM+ALNG +PE  TL  +L
Sbjct: 301 LRDESDRDGMRIVVELKREAVADVVLNQLWRHTALQSSFAVNMIALNGGRPELMTLHDVL 360

Query: 359 KAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELM 418
           +AFV FRE VV RRTK+ L KARD AH+ VGLAIAVAN+DEV+R+IR SP+   AR  LM
Sbjct: 361 RAFVDFRETVVTRRTKFRLAKARDNAHLQVGLAIAVANIDEVIRLIRNSPDAAAAREALM 420

Query: 419 QRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELN 478
            R W A D+  L++LI D  + +  DGT+ LSE Q RAIL+LRL RLT LGR++I   LN
Sbjct: 421 ARDWPAKDMAPLVELIADPRHKLSHDGTIRLSEAQARAILDLRLQRLTALGREEIAEALN 480

Query: 479 SLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDM 538
            L  EI E L+IL SR +L GIIK E+L+VK+   TPRRT+I +   D+EDED I REDM
Sbjct: 481 KLAAEIAEYLEILRSREKLFGIIKDEMLAVKEAYATPRRTQITDAEGDVEDEDLIAREDM 540

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           VVTVSH GY+KRVPLS YRAQRRGGKGRSG+ M++EDFV  LF+ +THT VLFFSS G  
Sbjct: 541 VVTVSHAGYIKRVPLSTYRAQRRGGKGRSGMQMKEEDFVHRLFVANTHTPVLFFSSRGKA 600

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVR 658
           YKEKVWRLP+ +PQARGKAL+N+L L  GERITTIMP PEDESSW  L V+FAT  G VR
Sbjct: 601 YKEKVWRLPLAAPQARGKALVNMLPLESGERITTIMPLPEDESSWATLDVIFATTGGTVR 660

Query: 659 RNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAG 718
           RNKLSDF+ + R+G IAMKLD  + I+ V T T+ +DILLTT  GQC+RF +  +RVF G
Sbjct: 661 RNKLSDFVDVRRNGLIAMKLDDGEAIVDVATATEHDDILLTTSDGQCIRFAVPEVRVFQG 720

Query: 719 RNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGD--TEEITSLK 776
           R S+GVRG+SL +GD+VIS++I+ H +A  +ER  Y+K  +A RR +  D   +     +
Sbjct: 721 RTSMGVRGVSLGQGDRVISLSILNHFEATGEERTAYLKRANALRRRMGEDVSPDAGAEAE 780

Query: 777 NDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKIN 836
             ++    +++ER   +++ EQ ILTVSE G+GKRTSSY++R + R GKGI A  V+  N
Sbjct: 781 EAATGAVELTDERFAAMQVAEQIILTVSENGYGKRTSSYEYRTTGRGGKGIVAMAVNARN 840

Query: 837 EIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVER 896
             G LVA FPV   D+I+LV++ G LIR PV+ IRIA R+T+GV++F+TA+DERVVSVE 
Sbjct: 841 --GKLVASFPVGQGDEIMLVTNGGQLIRCPVDGIRIAGRSTQGVIVFNTAEDERVVSVEH 898

Query: 897 I 897
           I
Sbjct: 899 I 899


>gi|300023686|ref|YP_003756297.1| DNA gyrase subunit alpha [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525507|gb|ADJ23976.1| DNA gyrase, A subunit [Hyphomicrobium denitrificans ATCC 51888]
          Length = 915

 Score =  988 bits (2553), Expect = 0.0,   Method: Composition-based stats.
 Identities = 546/914 (59%), Positives = 686/914 (75%), Gaps = 8/914 (0%)

Query: 1   MTEHIIS--SDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILF 58
           MT++         E   I  VSI+DEM+ SYL YA++VI+ RA+PD+RDGLKPVHRRILF
Sbjct: 1   MTDNSDDERPAGREPSDIRPVSISDEMKKSYLDYAMSVIISRALPDVRDGLKPVHRRILF 60

Query: 59  GMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFG 118
            M ++G++WNKKYVK ARI GEVMGKYHPHGN AIYDAL R+AQD+S+R+ L++GQGNFG
Sbjct: 61  AMNELGLDWNKKYVKSARIVGEVMGKYHPHGNLAIYDALVRLAQDFSMRVPLVDGQGNFG 120

Query: 119 SVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNG 178
           S+DGDPPAAERYTE RL K A FLLDDL  DTVD+R NYDG+ QEP VL A++PN+LVNG
Sbjct: 121 SIDGDPPAAERYTESRLAKVASFLLDDLDNDTVDYRDNYDGTIQEPSVLPAKFPNLLVNG 180

Query: 179 GGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIK 238
            GGIAVGMATNIP HNLGEV+D C+A +DNP+I +D L +II+GPDFPT  +ILGR GI 
Sbjct: 181 AGGIAVGMATNIPPHNLGEVIDACIADLDNPEIGIDELSQIIQGPDFPTAGLILGRGGIL 240

Query: 239 NAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIAD 298
           +AY  GRGSI++R    +E    DRE +VV+EIPYQVNK  ++EKIA+LVR+K+I  I+D
Sbjct: 241 SAYHKGRGSIIMRARVTVEHIRKDREALVVSEIPYQVNKRTLIEKIADLVRDKKIEGISD 300

Query: 299 LRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGIL 358
           L DES+R+G R+VIELKR A ADV+LN LY+Y+ LQ+ F  NM+A+NG +PE  TL   +
Sbjct: 301 LWDESNREGIRIVIELKRDAVADVVLNNLYKYSDLQTTFGANMLAINGGRPESLTLKDFI 360

Query: 359 KAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELM 418
            AF +FR++VV RR K+LLNKARDRAHVLVGLAIAVAN+DEV+++IRFS +P  A+ +LM
Sbjct: 361 SAFTSFRQDVVTRRIKHLLNKARDRAHVLVGLAIAVANIDEVIKLIRFSASPAEAKEQLM 420

Query: 419 QRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELN 478
            R W A D+  LI+LI D  + + + GT  LSE Q +AILELRLARLT LGRD+I +ELN
Sbjct: 421 ARDWPAKDMVPLIELIADPRHKVSATGTYRLSEEQAKAILELRLARLTALGRDEIADELN 480

Query: 479 SLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDM 538
            +  EI+E L IL+SR+R++ I+K EL ++KDE  TPR+T IV+   ++EDED I RED 
Sbjct: 481 KIANEIREYLAILASRARVVDIVKGELQTIKDEFATPRKTEIVDIEGEVEDEDLIQREDC 540

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           VVTVSH GY+KRVPL+ YRAQRRGGKGRSG+  RDEDFVT LF+ STHT VLFFSS G  
Sbjct: 541 VVTVSHKGYIKRVPLATYRAQRRGGKGRSGMSTRDEDFVTQLFVTSTHTPVLFFSSRGMC 600

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVR 658
           Y+ KVWRLP  SPQ+ GKAL+N+L L Q E IT+I+P PED S+W+ L ++FAT+ GNVR
Sbjct: 601 YRMKVWRLPPASPQSPGKALVNLLPLAQDEVITSILPLPEDSSTWSELELIFATRSGNVR 660

Query: 659 RNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISA-IRVFA 717
           RN L+DF  INR+GKIAMKLD  D I+ V     + D+LLT+  GQCVRF IS  IR+F 
Sbjct: 661 RNALADFESINRNGKIAMKLDEGDSIVQVAIAKPDQDVLLTSGNGQCVRFLISDEIRLFK 720

Query: 718 GRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKN 777
           GR+S GVRGI L  GD+VISMAI+ H +A  +ER  Y+K  SA RR    +  E  +  +
Sbjct: 721 GRDSTGVRGIRLGDGDEVISMAILDHFEASAEERAAYLKQASALRRSEETEDAEPVAEAD 780

Query: 778 DSSVEGN---ISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSK 834
              V      +S ER   ++  EQF+LTVS KGFGKR+SS++FR S R GKGI A  V+ 
Sbjct: 781 AEEVSAEAVTLSPERFAVMQAGEQFVLTVSSKGFGKRSSSFEFRTSGRGGKGIVAMVVND 840

Query: 835 INEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSV 894
            N  G L+A FP+++ DQI+LV+D G LIR PV+ +RIA R T+GV IF T  +E+VVSV
Sbjct: 841 RN--GRLLASFPIDEKDQIMLVTDGGQLIRCPVDGVRIAGRNTQGVRIFKTEAEEKVVSV 898

Query: 895 ERIRESEIVDEAES 908
           ERI E E  + +E 
Sbjct: 899 ERITEDETDEGSEG 912


>gi|241204655|ref|YP_002975751.1| DNA gyrase subunit A [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858545|gb|ACS56212.1| DNA gyrase, A subunit [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 945

 Score =  987 bits (2551), Expect = 0.0,   Method: Composition-based stats.
 Identities = 625/899 (69%), Positives = 746/899 (82%), Gaps = 1/899 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MTE       +   GI  +SI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+GM
Sbjct: 1   MTEQTPPGGGKLPPGIEPISIMEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYGM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            ++G++WNKKYVKCAR++G+VMGK+HPHGN+AIYDALARMAQ WSLRL LI+GQGNFGSV
Sbjct: 61  SELGIDWNKKYVKCARVTGDVMGKFHPHGNSAIYDALARMAQPWSLRLPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAAERYTECRL+KAAH LLDDL K+TVDFR NYDG+  EPVV+ A++PN+LVNG G
Sbjct: 121 DGDPPAAERYTECRLEKAAHSLLDDLDKETVDFRDNYDGTLSEPVVVPAKFPNLLVNGAG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNL EV+DGC+A+ID+P I+L  L++II GPDFPTGA ILGR GI++A
Sbjct: 181 GIAVGMATNIPPHNLSEVIDGCIALIDDPAIELPELIQIIPGPDFPTGAKILGRAGIRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGS+++RGV+ IE   GDREQI++TEIPYQVNKA M+EK+AELVR+KRI  I+DLR
Sbjct: 241 YETGRGSVIMRGVAAIEPMRGDREQIIITEIPYQVNKATMIEKMAELVRDKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVV+ELKR A+ADVILNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRQGYRVVVELKRDANADVILNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FREEVV RRTK+LL KARDRAHVLVGLAIAVAN+DEV+R+IR +P+P++AR ELM R
Sbjct: 361 FVSFREEVVSRRTKFLLRKARDRAHVLVGLAIAVANIDEVIRVIRQAPDPQSAREELMTR 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D++ LI LIDD  + I  D T  LSE Q RAILELRLARLT LGRD+I +ELN +
Sbjct: 421 RWPAEDVESLIRLIDDPRHRINEDLTYNLSEEQARAILELRLARLTALGRDEIGDELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EIK+ LDILSSR R+  I+K ELL+V+DE  TPRRT IV+G L+M+DED I REDMVV
Sbjct: 481 GEEIKDYLDILSSRVRIQTIVKDELLAVRDEFGTPRRTEIVDGGLEMDDEDLIAREDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSHLGY+KRVPL+ YRAQRRGGKGRSG+  RD DFV+ LF+V+THT VLFFSS G VYK
Sbjct: 541 TVSHLGYIKRVPLTTYRAQRRGGKGRSGMTTRDADFVSRLFVVNTHTPVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+P +RGKALIN+L L  GERITTI+P PEDE+SW+NL V+F+T  G VRRN
Sbjct: 601 EKVWRLPIGTPTSRGKALINMLPLAPGERITTILPLPEDETSWDNLDVMFSTTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDF+Q+NR+GKIAMKL +  DEILSVETCT+ +D+LLTT LGQC+RF +  +RVFAGR
Sbjct: 661 KLSDFVQVNRNGKIAMKLEEEGDEILSVETCTENDDVLLTTALGQCIRFSVDDVRVFAGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           NS+GVRGI+L   D++ISM IV H DA+  ER  Y+K  + +RR    D E+I  +  + 
Sbjct: 721 NSIGVRGINLGDSDRIISMTIVGHVDAEPWERAAYLKRSATERRATGVDEEDIALVGEEV 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
             EG +S++R  EL+ +EQF+LTVSEKGFGKR+SSYDFRIS R GKGIRATD SK  EIG
Sbjct: 781 IEEGQLSDDRYDELRAREQFVLTVSEKGFGKRSSSYDFRISGRGGKGIRATDTSKTAEIG 840

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
            LVA FP++D DQI+LVSD G LIRVPV  IRIASRATKGV IFSTAKDE+VVSVERI 
Sbjct: 841 ELVAAFPIDDGDQIMLVSDGGQLIRVPVGGIRIASRATKGVTIFSTAKDEKVVSVERIS 899



 Score = 52.9 bits (125), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 32/155 (20%), Positives = 56/155 (36%), Gaps = 6/155 (3%)

Query: 639 DESSWNNLYVVFATKHGNVRRNKLSDFI-----QINRSGKIAMKLDSRDEILSVETCTQE 693
           DE      +V+  ++ G  +R+   DF                K     E+++       
Sbjct: 792 DELRAREQFVLTVSEKGFGKRSSSYDFRISGRGGKGIRATDTSKTAEIGELVAAFPIDDG 851

Query: 694 NDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERIC 753
           + I+L +  GQ +R P+  IR  A R + GV   S AK ++V+S+  +   + D  E   
Sbjct: 852 DQIMLVSDGGQLIRVPVGGIR-IASRATKGVTIFSTAKDEKVVSVERISEPEEDETEEAV 910

Query: 754 YMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEE 788
            +   S      + D                 +EE
Sbjct: 911 EIAEGSPATEEGAADEGGGDEAPIADGDPAGPAEE 945


>gi|85716508|ref|ZP_01047479.1| DNA gyrase subunit A [Nitrobacter sp. Nb-311A]
 gi|85696697|gb|EAQ34584.1| DNA gyrase subunit A [Nitrobacter sp. Nb-311A]
          Length = 913

 Score =  986 bits (2550), Expect = 0.0,   Method: Composition-based stats.
 Identities = 562/905 (62%), Positives = 689/905 (76%), Gaps = 4/905 (0%)

Query: 2   TEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMM 61
           +E     +     GI  VSI DEM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+ M 
Sbjct: 4   SEDTKPGEPPAPSGIRPVSILDEMKRSYLDYAMSVIVARALPDARDGLKPVHRRILYAMH 63

Query: 62  QMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVD 121
           + G EWNK Y K AR  G+V+GKYHPHG+ ++YDAL RMAQD+S+R+ LI+GQGNFGSVD
Sbjct: 64  ENGFEWNKPYRKSARTVGDVIGKYHPHGDQSVYDALVRMAQDFSMRVPLIDGQGNFGSVD 123

Query: 122 GDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGG 181
           GD  AA RYTE RL K A  LLDD+ KDTVDF+PNYD S +EP VL A++PN+LVNG GG
Sbjct: 124 GDMAAAMRYTESRLTKIAQSLLDDIDKDTVDFQPNYDNSEKEPSVLPAKFPNLLVNGAGG 183

Query: 182 IAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAY 241
           IAVGMATNIP HNLGEV+D CVA+ID+P + +D L+ II GPDFPTG +ILGR GI++AY
Sbjct: 184 IAVGMATNIPPHNLGEVIDACVALIDDPALSIDDLINIIPGPDFPTGGIILGRQGIRSAY 243

Query: 242 ATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRD 301
             GRGSIV+RG   I+    DRE IV++EIPYQVNKA+M+E+IAELVREK+I  I+DLRD
Sbjct: 244 HLGRGSIVMRGKVSIDTIRKDREAIVISEIPYQVNKASMVERIAELVREKKIEGISDLRD 303

Query: 302 ESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAF 361
           ESDR+G+RVV+ELKR A  +V+LNQLYR+T LQ+ F  NMVAL+  +P+   L  +L  F
Sbjct: 304 ESDREGFRVVVELKRDAVPEVVLNQLYRFTPLQTNFGANMVALDAGRPQLMNLKDLLTLF 363

Query: 362 VAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRS 421
           +AFRE+VV RRTK+LLNKARDRAH+LVGLAIAVAN+DE++R+IR SP+P  AR  LM R 
Sbjct: 364 IAFREQVVTRRTKFLLNKARDRAHILVGLAIAVANIDEIIRVIRESPDPNAARETLMSRD 423

Query: 422 WNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLG 481
           W A D+  +I LIDD  + +  DGT  LS  Q +AIL+LRL RLT LGR++I  EL+ L 
Sbjct: 424 WPAKDVAAMITLIDDPRHRVSPDGTARLSMEQAKAILDLRLQRLTALGREEISEELDKLA 483

Query: 482 IEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVT 541
           IEI + LDIL SR+R+  IIK EL +VK E  TPRRT IVE   ++EDED I REDMVVT
Sbjct: 484 IEIADYLDILRSRARVQAIIKTELDAVKSEFATPRRTVIVEQEGEVEDEDLIQREDMVVT 543

Query: 542 VSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKE 601
           VSH GYVKRVPLS YRAQ+RGGKGRSG+  RDEDFV+ LF+ STHT VLFFSS G VYKE
Sbjct: 544 VSHAGYVKRVPLSAYRAQKRGGKGRSGMQTRDEDFVSRLFVASTHTPVLFFSSRGQVYKE 603

Query: 602 KVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNK 661
           KVWRLP+ +P ARGKALINIL L+QGERITTIMP PEDESSW  L V+FAT  G VRRNK
Sbjct: 604 KVWRLPMAAPNARGKALINILPLDQGERITTIMPLPEDESSWAALDVMFATTSGTVRRNK 663

Query: 662 LSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNS 721
           LSDF+ + RSG IAMKL   + I+ V+ CT+ +D+LLT   GQC+RFP++ +RVF+GR S
Sbjct: 664 LSDFVDVRRSGIIAMKLGEGESIVDVQICTERDDVLLTAAGGQCIRFPVTDVRVFSGRTS 723

Query: 722 VGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGD----TEEITSLKN 777
           +GVRGI+LAKGD+VIS++I+ H DA   ER  Y+K   A RR  +G+     E       
Sbjct: 724 MGVRGIALAKGDRVISLSILHHFDATPAERAAYLKQSGAIRRAATGEDIEPEEATPEADE 783

Query: 778 DSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINE 837
            +  + ++ E R  E+   EQF+LTV+ +G+GKR+SS++FR+S R GKGIRATD +K+ E
Sbjct: 784 AAHTDLSLPEGRYVEMGAAEQFVLTVTAQGYGKRSSSFEFRVSGRGGKGIRATDPTKLGE 843

Query: 838 IGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERI 897
           IG LVA FPV  +DQI+LVSD G LIRVPV  IRI SRA+KGV +F+TA DE VVSVE I
Sbjct: 844 IGHLVAGFPVEMSDQIMLVSDGGQLIRVPVEGIRITSRASKGVRVFNTADDEHVVSVEHI 903

Query: 898 RESEI 902
           RE   
Sbjct: 904 REDGE 908



 Score = 65.6 bits (158), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 32/214 (14%), Positives = 66/214 (30%), Gaps = 58/214 (27%)

Query: 746 ADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSE 805
           ADY + +     + A  +      +   +    + +     E   ++L  +E  ++TVS 
Sbjct: 487 ADYLDILRSRARVQAIIKTELDAVKSEFATPRRTVIVEQEGEVEDEDLIQREDMVVTVSH 546

Query: 806 KGFGKRTSSYDFRISNRSGKGIRATDVSKI------------------------------ 835
            G+ KR     +R   R GKG                                       
Sbjct: 547 AGYVKRVPLSAYRAQKRGGKGRSGMQTRDEDFVSRLFVASTHTPVLFFSSRGQVYKEKVW 606

Query: 836 -------NEIGA-LVAVFPVNDND------------------QIILVSDKGTLIRVPVNE 869
                  N  G  L+ + P++  +                   ++  +  GT+ R  +++
Sbjct: 607 RLPMAAPNARGKALINILPLDQGERITTIMPLPEDESSWAALDVMFATTSGTVRRNKLSD 666

Query: 870 IRIASRATKGVVIFSTAKDERVVSVERIRESEIV 903
                R+  G++     + E +V V+   E + V
Sbjct: 667 FVDVRRS--GIIAMKLGEGESIVDVQICTERDDV 698



 Score = 56.7 bits (135), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 46/282 (16%), Positives = 92/282 (32%), Gaps = 28/282 (9%)

Query: 486 ECLDILSSRSRLLGIIKQELLSVK-DELDTPRRTRIVEGL----LDMEDEDCIVREDMVV 540
           E     ++   +       +   K  +    RR+ I+         + D       D V+
Sbjct: 640 EDESSWAALDVMFATTSGTVRRNKLSDFVDVRRSGIIAMKLGEGESIVDVQICTERDDVL 699

Query: 541 TVSHLGYVKRVPLSVYR--AQRRGGKGRSGVVMRDED----FVTDLFIVSTHTSVLFFSS 594
             +  G   R P++  R  + R     R   + + +      +   F  +      +   
Sbjct: 700 LTAAGGQCIRFPVTDVRVFSGRTSMGVRGIALAKGDRVISLSILHHFDATPAERAAYLKQ 759

Query: 595 LGFVYKEKVWR--LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
            G + +        P  +     +A    LSL +G  +                +V+  T
Sbjct: 760 SGAIRRAATGEDIEPEEATPEADEAAHTDLSLPEGRYVE---------MGAAEQFVLTVT 810

Query: 653 KHGNVRRNKLSDF-IQINRSGKIAM----KLDSRDEILSVETCTQENDILLTTKLGQCVR 707
             G  +R+   +F +       I      KL     +++       + I+L +  GQ +R
Sbjct: 811 AQGYGKRSSSFEFRVSGRGGKGIRATDPTKLGEIGHLVAGFPVEMSDQIMLVSDGGQLIR 870

Query: 708 FPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYD 749
            P+  IR    R S GVR  + A  + V+S+  +     + +
Sbjct: 871 VPVEGIR-ITSRASKGVRVFNTADDEHVVSVEHIREDGENGN 911


>gi|161621455|ref|NP_102478.2| DNA gyrase subunit A [Mesorhizobium loti MAFF303099]
          Length = 931

 Score =  986 bits (2549), Expect = 0.0,   Method: Composition-based stats.
 Identities = 598/914 (65%), Positives = 727/914 (79%), Gaps = 5/914 (0%)

Query: 1   MTEHIIS-SDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFG 59
           MT+       +    GI  +SI +EMQ+SYL+YA++VI+ RA+PD+RDGLKPVHRRIL+ 
Sbjct: 1   MTDQKTPRGADGGPTGIEPISIIEEMQSSYLSYAMSVIVSRALPDVRDGLKPVHRRILYA 60

Query: 60  MMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS 119
             + G  WN+KYVK AR   +VMGKYHPHG+A+IYDAL RMAQDWSLR+ LI+GQGNFGS
Sbjct: 61  AHESGYHWNRKYVKSARPVADVMGKYHPHGDASIYDALVRMAQDWSLRVPLIDGQGNFGS 120

Query: 120 VDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGG 179
           +DGDPPAA RYTE RL K AH LL+D+ KDTVDF+  YD S  EP VL AR+PN+LVNG 
Sbjct: 121 IDGDPPAAMRYTESRLTKVAHELLEDIDKDTVDFQETYDASDTEPKVLPARFPNLLVNGS 180

Query: 180 GGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKN 239
           GGIAVGMATNIP HNLGEV +G +A+IDNP IDL ALMEII GPDFPTG ++LGR+GI +
Sbjct: 181 GGIAVGMATNIPPHNLGEVCNGAIAIIDNPAIDLPALMEIIPGPDFPTGGIVLGRSGIYS 240

Query: 240 AYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           AY+TGRGSIV+RG  +IE+   DRE I++TE+PYQVNKA+M+EK+AELVR+KRI  I+D+
Sbjct: 241 AYSTGRGSIVMRGKVNIEQRGNDRESIIITEVPYQVNKASMIEKMAELVRDKRIEGISDI 300

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDESDRQGYRVVIELKR A ADVILNQLYR+T LQ+ F  NMVALNG KPE  TL  +LK
Sbjct: 301 RDESDRQGYRVVIELKRDAVADVILNQLYRFTPLQTSFGANMVALNGGKPELLTLTDMLK 360

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
           AFV+FREEV+ RRTK+LL KARDRAHVLVGLAIAVAN+DEV+++IR +P+P+TAR +LM+
Sbjct: 361 AFVSFREEVITRRTKFLLRKARDRAHVLVGLAIAVANIDEVIKLIRTAPDPQTAREQLME 420

Query: 420 RSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           R W A D++ LI LIDD  + I +DGT  LSE Q RAILELRL RLT LGRD+I +ELNS
Sbjct: 421 RRWPAGDVESLILLIDDPRHRINADGTYNLSEEQARAILELRLQRLTALGRDEIADELNS 480

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           +G EI + LDILSSR+R+  I+K EL +V+DE  TPRRT + +G  DMEDED I REDMV
Sbjct: 481 IGAEIVDYLDILSSRARVQQIVKDELAAVRDEFGTPRRTELTDGGADMEDEDLIQREDMV 540

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           VTVSH GY+KRVPLS+YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFFSS G VY
Sbjct: 541 VTVSHSGYIKRVPLSLYRAQRRGGKGRSGMSTKEEDFVTRLFVANTHTPVLFFSSRGIVY 600

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           KEKVWRLPIG+PQ+RGKALIN+L L QGERITTIMP PEDE+SW  L V+FAT  G VRR
Sbjct: 601 KEKVWRLPIGNPQSRGKALINMLPLEQGERITTIMPLPEDETSWGELDVMFATTRGTVRR 660

Query: 660 NKLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAG 718
           NKLSDF+Q+NR+GKIAMKL +  DEIL VETCT  +D+LLT   GQC+RF +  +RVF  
Sbjct: 661 NKLSDFVQVNRNGKIAMKLEEEGDEILGVETCTDNDDVLLTASSGQCIRFSVGDVRVFQS 720

Query: 719 RNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMK---HMSAQRRLISGDTEEITSL 775
           RNSVGVRGI++A+ D++ISM+++ + DA   ER  Y+K            +G+ EEI   
Sbjct: 721 RNSVGVRGITMAETDRIISMSVIENVDASPAERAAYLKRAAAERRLAAGANGEEEEIALT 780

Query: 776 KNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKI 835
             +   E  +S+ER + LK  EQ++LTV+E G+GKR+SSYDFR++ R GKGIRATDVSK 
Sbjct: 781 NEEIGEEAELSDERYEFLKAHEQYVLTVTEYGYGKRSSSYDFRLTGRGGKGIRATDVSKT 840

Query: 836 NEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVE 895
            EIG LVA FPV ++DQI+LVSD GT+IRVPVN IR ASRATKGV IF+TA+ E+VVSVE
Sbjct: 841 AEIGRLVATFPVGNDDQIMLVSDGGTVIRVPVNGIRFASRATKGVTIFNTAEGEKVVSVE 900

Query: 896 RIRESEIVDEAEST 909
           RI E +  +E+E T
Sbjct: 901 RISEPQSDEESEET 914



 Score = 56.3 bits (134), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 53/131 (40%), Gaps = 6/131 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFI-----QINRSGKIAMKLDSRDEILSVETCTQENDILLT 699
             YV+  T++G  +R+   DF                K      +++      ++ I+L 
Sbjct: 802 EQYVLTVTEYGYGKRSSSYDFRLTGRGGKGIRATDVSKTAEIGRLVATFPVGNDDQIMLV 861

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  G  +R P++ IR FA R + GV   + A+G++V+S+  +    +D +          
Sbjct: 862 SDGGTVIRVPVNGIR-FASRATKGVTIFNTAEGEKVVSVERISEPQSDEESEETVEGGTE 920

Query: 760 AQRRLISGDTE 770
           +       + E
Sbjct: 921 SAPDAGPENAE 931


>gi|159184789|ref|NP_354513.2| DNA gyrase subunit A [Agrobacterium tumefaciens str. C58]
 gi|159140077|gb|AAK87298.2| DNA gyrase subunit A [Agrobacterium tumefaciens str. C58]
          Length = 906

 Score =  986 bits (2548), Expect = 0.0,   Method: Composition-based stats.
 Identities = 624/885 (70%), Positives = 747/885 (84%), Gaps = 1/885 (0%)

Query: 25  MQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGK 84
           MQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+GM ++G++WNKKYVKCAR++G+VMGK
Sbjct: 1   MQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYGMSELGIDWNKKYVKCARVTGDVMGK 60

Query: 85  YHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLD 144
           +HPHGN+AIYDALARMAQDWSLRL LI+GQGNFGS+DGDPPAAERYTECRL+KAAH LLD
Sbjct: 61  FHPHGNSAIYDALARMAQDWSLRLPLIDGQGNFGSIDGDPPAAERYTECRLEKAAHSLLD 120

Query: 145 DLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVA 204
           DL K+TVDFR NYDG+ QEPVV+ A++PN+LVNG GGIAVGMATNIP HNL EV+DGCVA
Sbjct: 121 DLDKETVDFRDNYDGTLQEPVVVPAKFPNLLVNGAGGIAVGMATNIPPHNLSEVIDGCVA 180

Query: 205 VIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDRE 264
           +I+NP I+L  +M+II GPDFPTGA+I+GR+GI++AY TGRGS+++RGV+ IE   GDRE
Sbjct: 181 LIENPAIELPEMMQIIPGPDFPTGALIMGRSGIRSAYETGRGSVIMRGVATIEPMRGDRE 240

Query: 265 QIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVIL 324
           QI++TE+PYQVNKA+M+EK+AELV+EKRI  I+DLRDESDRQGYRVVIELKR A+A+VIL
Sbjct: 241 QIIITEVPYQVNKASMIEKMAELVKEKRIEGISDLRDESDRQGYRVVIELKRDANAEVIL 300

Query: 325 NQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRA 384
           NQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFV+FRE+VV RRTKYLL KARDRA
Sbjct: 301 NQLYRYTPLQTSFGCNMVALNGGKPEQMTLLDMLRAFVSFREDVVSRRTKYLLRKARDRA 360

Query: 385 HVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSD 444
           HVLVGLAI+VAN+DEV+R+IR +P+P +AR +LM R W A D++ LI LIDD  + I  D
Sbjct: 361 HVLVGLAISVANIDEVIRVIRHAPDPASAREQLMTRRWPAQDVESLIRLIDDPRHRINED 420

Query: 445 GTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQE 504
           GT  LSE Q RAILELRLARLT LGRD+I +ELN +G EI E LDILSSR R+  I+K E
Sbjct: 421 GTYNLSEEQARAILELRLARLTALGRDEIGDELNKIGAEISEYLDILSSRVRIQQIVKDE 480

Query: 505 LLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGK 564
           L+S++DE  TPRR++IVEG  DM+DED I REDMVVTVSHLGY+KRVPL+ YRAQRRGGK
Sbjct: 481 LVSIRDEFGTPRRSQIVEGGPDMDDEDLIAREDMVVTVSHLGYIKRVPLTTYRAQRRGGK 540

Query: 565 GRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSL 624
           GRSG+  RDEDFV  LF+ +THT VLFFSS G VYKEKVWRLPIG+PQ++GKALIN+L L
Sbjct: 541 GRSGMATRDEDFVNRLFVANTHTPVLFFSSRGIVYKEKVWRLPIGTPQSKGKALINMLPL 600

Query: 625 NQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLD-SRDE 683
             GERITTIMP PEDE++W  L V+F+T  G VRRNKL DF+Q+NR+GKIAMKLD   DE
Sbjct: 601 EPGERITTIMPLPEDETAWETLDVMFSTTRGTVRRNKLGDFVQVNRNGKIAMKLDEEGDE 660

Query: 684 ILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLH 743
           ILSVETCT  +D+LLTT LGQC+RFP+  +RVFAGRNSVGVRGI++A+GD++ISM IV H
Sbjct: 661 ILSVETCTDRDDVLLTTALGQCIRFPVDDVRVFAGRNSVGVRGINMAEGDRIISMTIVGH 720

Query: 744 ADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTV 803
            +A+  ER  Y+K  + +RR    D E+I  +  + + EG +SEER QELK +E+F+LTV
Sbjct: 721 VEAEPWERAAYLKRSATERRAAGVDEEDIALVGEEVTEEGELSEERYQELKAREEFVLTV 780

Query: 804 SEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLI 863
           S KGFGKR+SSYDFR S R GKGIRATD +K NEIG LVA FPV + DQI+LVSD G LI
Sbjct: 781 SVKGFGKRSSSYDFRTSGRGGKGIRATDTAKTNEIGELVAAFPVEEGDQIMLVSDGGQLI 840

Query: 864 RVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAES 908
           RVPVN IRIASRATKGV IFSTAKDE+VVSVERI E E  DEAE+
Sbjct: 841 RVPVNGIRIASRATKGVTIFSTAKDEKVVSVERINEPEGDDEAEN 885



 Score = 53.3 bits (126), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 45/299 (15%), Positives = 89/299 (29%), Gaps = 57/299 (19%)

Query: 530 EDCIVREDMVVTV-----SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVS 584
                 E    T+     +  G V+R  L  +    R GK    +    ++    +   +
Sbjct: 610 MPLPEDETAWETLDVMFSTTRGTVRRNKLGDFVQVNRNGKIAMKLDEEGDEI-LSVETCT 668

Query: 585 THTSVLFFSSLGFVYKEKVWRLP-IGSPQARGKALINILSLNQGERITTIMPFPEDESSW 643
               VL  ++LG   +  V  +       + G   IN+   ++   +T +     +    
Sbjct: 669 DRDDVLLTTALGQCIRFPVDDVRVFAGRNSVGVRGINMAEGDRIISMTIVGHVEAEPWER 728

Query: 644 --------------------------------------------NNLYVVFATKHGNVRR 659
                                                          +V+  +  G  +R
Sbjct: 729 AAYLKRSATERRAAGVDEEDIALVGEEVTEEGELSEERYQELKAREEFVLTVSVKGFGKR 788

Query: 660 NKLSDFIQINR-----SGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIR 714
           +   DF    R           K +   E+++     + + I+L +  GQ +R P++ IR
Sbjct: 789 SSSYDFRTSGRGGKGIRATDTAKTNEIGELVAAFPVEEGDQIMLVSDGGQLIRVPVNGIR 848

Query: 715 VFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEIT 773
             A R + GV   S AK ++V+S+  +   + D +                    E   
Sbjct: 849 -IASRATKGVTIFSTAKDEKVVSVERINEPEGDDEAENGNDDEADDNLPDAPEAPESEA 906


>gi|319405587|emb|CBI79207.1| DNA gyrase subunit A [Bartonella sp. AR 15-3]
          Length = 922

 Score =  986 bits (2548), Expect = 0.0,   Method: Composition-based stats.
 Identities = 583/911 (63%), Positives = 722/911 (79%), Gaps = 1/911 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+    S+ +   GI  VSI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+ M
Sbjct: 1   MTDLTTQSEYDVLTGIEPVSIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYAM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            +MG+ +NK Y K A + GEVMGK+HPHG+A+IYDAL RMAQD+SLR  LI+GQGNFGSV
Sbjct: 61  NEMGLSFNKSYRKSAGVVGEVMGKFHPHGDASIYDALVRMAQDFSLRNPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTECRL+K A  LL D+ K+TVDF+ NYDG  +EP+VL AR+PN+LVNG G
Sbjct: 121 DGDPPAAMRYTECRLEKVAEELLADIDKETVDFQDNYDGREREPMVLPARFPNLLVNGSG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEV+DGC+A+IDNP I LD ++EII GPDFPTG +ILGR+GI++A
Sbjct: 181 GIAVGMATNIPPHNLGEVIDGCIALIDNPTITLDEIIEIIPGPDFPTGGIILGRSGIRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGSI++R    IE+   +R+ I+V+EIPYQ+NKA M+EKIAELVR+KRI  I+DLR
Sbjct: 241 YETGRGSIIMRAKVDIEEIRNNRQAIIVSEIPYQINKATMIEKIAELVRDKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR GYRVVIELKR A AD++LNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+A
Sbjct: 301 DESDRDGYRVVIELKREAVADIVLNQLYRYTPLQTSFGCNMVALNGGKPEQMTLLDMLRA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FREEVV RRTKYLL KAR+RAHVLVGLAIAVAN+DE++ +IR +P+P+TAR +LM+R
Sbjct: 361 FVSFREEVVSRRTKYLLRKARERAHVLVGLAIAVANIDEIIALIRTAPDPQTARIQLMER 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A+D+  LI LIDD  + I  D T  LSE Q RAILELRL RLT LGRD+I +ELN +
Sbjct: 421 RWLAADVASLIKLIDDPRHIIHEDNTYNLSEEQARAILELRLQRLTALGRDEIADELNKI 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G++I + LD+L+SR R++GI+K EL +++ E  TPRRT    G  +M++ED IV EDMVV
Sbjct: 481 GVDITDYLDVLASRLRIMGIVKDELSTLRKEFVTPRRTIFGFGNAEMDNEDLIVPEDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSH GY+KRVPLS YRAQRRGGKGRSG+  +DEDFVT LF+ +THTSVLFFSS G VYK
Sbjct: 541 TVSHSGYIKRVPLSTYRAQRRGGKGRSGMSTKDEDFVTRLFVSNTHTSVLFFSSRGIVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+PQ+RG+AL+N+L L + ER+TTIMP PEDE+SW+ L V+FAT  G VRRN
Sbjct: 601 EKVWRLPIGTPQSRGRALVNMLPLQEKERVTTIMPLPEDEASWSKLDVMFATTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
           KLSDFIQ+NR+GKIAMKLD  DEILSVETCT+ +D++LTT  GQC+RFP+  +RVF GRN
Sbjct: 661 KLSDFIQVNRNGKIAMKLDDEDEILSVETCTERDDVVLTTANGQCIRFPVIDVRVFMGRN 720

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT-EEITSLKNDS 779
           SVGVRGI++  GD+VISM I+ H +A   ER  Y+K    +RR+   D  + +   +++ 
Sbjct: 721 SVGVRGINMVDGDKVISMTILEHVEATSVERSAYIKRAINERRVAGADAEDVVIVDEDEE 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
            +E  +++ER  EL  +EQ +LTVSE G+GKR+SSY+FRIS R GKGIRATD +K  EIG
Sbjct: 781 EIETELTDERYAELASREQMLLTVSEFGYGKRSSSYEFRISGRGGKGIRATDPTKATEIG 840

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FPV   DQI+LVSD G LIRVP+  IRIA R+TKGV IF+TAK E+VVSVERI +
Sbjct: 841 KLVAAFPVKAQDQIMLVSDGGQLIRVPIEGIRIAGRSTKGVTIFNTAKGEKVVSVERISD 900

Query: 900 SEIVDEAESTE 910
            E        +
Sbjct: 901 PEDDANKLDDD 911



 Score = 52.1 bits (123), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 41/239 (17%), Positives = 84/239 (35%), Gaps = 11/239 (4%)

Query: 528 EDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHT 587
             E C  R+D+V+T +  G   R P+   R            +   +        +  H 
Sbjct: 686 SVETCTERDDVVLT-TANGQCIRFPVIDVRVFMGRNSVGVRGINMVDGDKVISMTILEHV 744

Query: 588 SVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLY 647
                    ++ +    R   G+       +       + E           E +     
Sbjct: 745 EATSVERSAYIKRAINERRVAGADAEDVVIVDEDEEEIETELTDERYA----ELASREQM 800

Query: 648 VVFATKHGNVRRNKLSDFI-QINRSGKIAM----KLDSRDEILSVETCTQENDILLTTKL 702
           ++  ++ G  +R+   +F         I      K     ++++      ++ I+L +  
Sbjct: 801 LLTVSEFGYGKRSSSYEFRISGRGGKGIRATDPTKATEIGKLVAAFPVKAQDQIMLVSDG 860

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQ 761
           GQ +R PI  IR  AGR++ GV   + AKG++V+S+  +   + D ++     +  S  
Sbjct: 861 GQLIRVPIEGIR-IAGRSTKGVTIFNTAKGEKVVSVERISDPEDDANKLDDDSEKHSGM 918


>gi|190891755|ref|YP_001978297.1| DNA gyrase protein, A subunit [Rhizobium etli CIAT 652]
 gi|190697034|gb|ACE91119.1| DNA gyrase protein, A subunit [Rhizobium etli CIAT 652]
          Length = 919

 Score =  985 bits (2546), Expect = 0.0,   Method: Composition-based stats.
 Identities = 624/877 (71%), Positives = 741/877 (84%), Gaps = 1/877 (0%)

Query: 23  DEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVM 82
           +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+GM ++G++WNKKYVKCAR++G+VM
Sbjct: 2   EEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYGMSELGIDWNKKYVKCARVTGDVM 61

Query: 83  GKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFL 142
           GKYHPHGNAAIYDALARMAQ WSLRL LI+GQGNFGSVDGDPPAAERYTECRL+KAAH L
Sbjct: 62  GKYHPHGNAAIYDALARMAQPWSLRLPLIDGQGNFGSVDGDPPAAERYTECRLEKAAHSL 121

Query: 143 LDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGC 202
           LDDL K+TVDFR NYDG+  EPVV+ A++PN+LVNG GGIAVGMATNIP HNL EV+DGC
Sbjct: 122 LDDLDKETVDFRDNYDGTLSEPVVVPAKFPNLLVNGAGGIAVGMATNIPPHNLSEVIDGC 181

Query: 203 VAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGD 262
           +A+I++P I+L  LM+II GPDFPTGA ILGR GI++AY TGRGS+++RGV+ IE   GD
Sbjct: 182 IALINDPAIELPELMQIIPGPDFPTGAKILGRAGIRSAYETGRGSVIMRGVAAIEPMRGD 241

Query: 263 REQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADV 322
           REQI++TEIPYQVNKA M+EK+AELVREKRI  I+DLRDESDRQGYRVVIELKR A+A+V
Sbjct: 242 REQIIITEIPYQVNKATMIEKMAELVREKRIEGISDLRDESDRQGYRVVIELKRDANAEV 301

Query: 323 ILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARD 382
           ILNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFV+FREEVV RRTK+LL KAR+
Sbjct: 302 ILNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRAFVSFREEVVSRRTKFLLRKARE 361

Query: 383 RAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIG 442
           RAHVLVGLAIAVAN+DEV+R+IR +P+P++AR ELM R W A D++ LI LIDD  + I 
Sbjct: 362 RAHVLVGLAIAVANIDEVIRVIRQAPDPQSAREELMTRRWPAEDVESLIRLIDDPRHRIN 421

Query: 443 SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIK 502
            D T  LSE Q RAILELRLARLT LGRD+I +ELN +G EI++ LDILSSR R+  I+K
Sbjct: 422 EDMTYNLSEEQARAILELRLARLTALGRDEIGDELNKIGEEIRDYLDILSSRVRIQTIVK 481

Query: 503 QELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRG 562
            EL +V+DE  TPRRT IV+G L+M+DED I REDMVVTVSHLGY+KRVPL+ YRAQRRG
Sbjct: 482 DELTAVRDEFGTPRRTEIVDGGLEMDDEDLIAREDMVVTVSHLGYIKRVPLTTYRAQRRG 541

Query: 563 GKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINIL 622
           GKGRSG+  RDEDFV+ LF+V+THT VLFFSS G VYKEKVWRLPIG+P +RGKALIN+L
Sbjct: 542 GKGRSGMTTRDEDFVSRLFVVNTHTPVLFFSSRGIVYKEKVWRLPIGTPTSRGKALINML 601

Query: 623 SLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKL-DSR 681
            L  GERITTI+P PEDE SW+NL V+F+T  G VRRNKLSDF+Q+NR+GKIAMKL +  
Sbjct: 602 PLAPGERITTILPLPEDEESWDNLDVMFSTTRGTVRRNKLSDFVQVNRNGKIAMKLEEEG 661

Query: 682 DEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIV 741
           DEILSVETCT+ +D+LLTT LGQC+RF +  +RVFAGRNS+GVRGI+L +GD++ISM IV
Sbjct: 662 DEILSVETCTEHDDVLLTTALGQCIRFSVDDVRVFAGRNSIGVRGINLGEGDRIISMTIV 721

Query: 742 LHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFIL 801
            H DA+  ER  Y+K  +A+RR    D E+I  +  + + EG +S+ER +ELK +EQF+L
Sbjct: 722 GHVDAEPWERAAYLKRSAAERRATGVDEEDIALVGEEVTEEGQLSDERYEELKAREQFVL 781

Query: 802 TVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGT 861
           TVSEKGFGKR+SSYDFRIS R GKGIRATD SK  EIG LVA FPV+D DQI+LVSD G 
Sbjct: 782 TVSEKGFGKRSSSYDFRISGRGGKGIRATDTSKTGEIGELVAAFPVDDGDQIMLVSDGGQ 841

Query: 862 LIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
           LIRVPV  IRIASRATKGV IFSTAKDE+VVSVERI 
Sbjct: 842 LIRVPVGGIRIASRATKGVTIFSTAKDEKVVSVERIS 878



 Score = 50.2 bits (118), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 51/144 (35%), Gaps = 6/144 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFI-----QINRSGKIAMKLDSRDEILSVETCTQENDILLT 699
             +V+  ++ G  +R+   DF                K     E+++       + I+L 
Sbjct: 777 EQFVLTVSEKGFGKRSSSYDFRISGRGGKGIRATDTSKTGEIGELVAAFPVDDGDQIMLV 836

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  GQ +R P+  IR  A R + GV   S AK ++V+S+  +   + +  E        +
Sbjct: 837 SDGGQLIRVPVGGIR-IASRATKGVTIFSTAKDEKVVSVERISEPEEEETEEAVETAEGA 895

Query: 760 AQRRLISGDTEEITSLKNDSSVEG 783
                 S     +         + 
Sbjct: 896 PAAEEGSAGETPVVDGDPAGPAKE 919


>gi|327193329|gb|EGE60233.1| DNA gyrase protein, A subunit [Rhizobium etli CNPAF512]
          Length = 919

 Score =  985 bits (2546), Expect = 0.0,   Method: Composition-based stats.
 Identities = 623/877 (71%), Positives = 742/877 (84%), Gaps = 1/877 (0%)

Query: 23  DEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVM 82
           +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+GM ++G++WNKKYVKCAR++G+VM
Sbjct: 2   EEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYGMSELGIDWNKKYVKCARVTGDVM 61

Query: 83  GKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFL 142
           GKYHPHGNAAIYDALARMAQ WSLRL LI+GQGNFGSVDGDPPAAERYTECRL+KAAH L
Sbjct: 62  GKYHPHGNAAIYDALARMAQPWSLRLPLIDGQGNFGSVDGDPPAAERYTECRLEKAAHSL 121

Query: 143 LDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGC 202
           LDDL K+TVDFR NYDG+  EPVV+ A++PN+LVNG GGIAVGMATNIP HNL EV+DGC
Sbjct: 122 LDDLDKETVDFRDNYDGTLSEPVVVPAKFPNLLVNGAGGIAVGMATNIPPHNLSEVIDGC 181

Query: 203 VAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGD 262
           +A+I++P I+L  LM+II GPDFPTGA ILGR GI++AY TGRGS+++RGV+ IE   GD
Sbjct: 182 IALINDPAIELPELMQIIPGPDFPTGAKILGRAGIRSAYETGRGSVIMRGVAAIEPMRGD 241

Query: 263 REQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADV 322
           REQI++TEIPYQVNKA M+EK+AELVREKRI  I+DLRDESDRQGYRVVIELKR A+A+V
Sbjct: 242 REQIIITEIPYQVNKATMIEKMAELVREKRIEGISDLRDESDRQGYRVVIELKRDANAEV 301

Query: 323 ILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARD 382
           ILNQLYRYT LQ+ F  NMVALNG KPE+ TL+ +L+AFV+FREEVV RRTK+LL KAR+
Sbjct: 302 ILNQLYRYTPLQTSFGCNMVALNGGKPEQLTLLDMLRAFVSFREEVVSRRTKFLLRKARE 361

Query: 383 RAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIG 442
           RAHVLVGLAIAVAN+DEV+R+IR +P+P++AR ELM R W A D++ LI LIDD  + I 
Sbjct: 362 RAHVLVGLAIAVANIDEVIRVIRQAPDPQSAREELMSRRWPAEDVESLIRLIDDPRHRIN 421

Query: 443 SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIK 502
            D T  LSE Q RAILELRLARLT LGRD+I +ELN +G EI++ LDILSSR R+  I+K
Sbjct: 422 EDMTYNLSEEQARAILELRLARLTALGRDEIGDELNKIGEEIRDYLDILSSRVRIQTIVK 481

Query: 503 QELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRG 562
            EL +V+DE  TPRRT IV+G L+M+DED I REDMVVTVSHLGY+KRVPL+ YRAQRRG
Sbjct: 482 DELTAVRDEFGTPRRTEIVDGGLEMDDEDLIAREDMVVTVSHLGYIKRVPLTTYRAQRRG 541

Query: 563 GKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINIL 622
           GKGRSG+  RDEDFV+ LF+V+THT VLFFSS G VYKEKVWRLPIG+P +RGKALIN+L
Sbjct: 542 GKGRSGMTTRDEDFVSRLFVVNTHTPVLFFSSRGIVYKEKVWRLPIGTPTSRGKALINML 601

Query: 623 SLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKL-DSR 681
            L  GERITTI+P PEDE+SW+NL V+F+T  G VRRNKLSDF+Q+NR+GKIAMKL +  
Sbjct: 602 PLEPGERITTILPLPEDEASWDNLDVMFSTTRGTVRRNKLSDFVQVNRNGKIAMKLEEEG 661

Query: 682 DEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIV 741
           DEILSVETCT+ +D+LLTT LGQC+RF +  +RVFAGRNS+GVRGI+L +GD++ISM IV
Sbjct: 662 DEILSVETCTEHDDVLLTTALGQCIRFSVDDVRVFAGRNSIGVRGINLGEGDRIISMTIV 721

Query: 742 LHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFIL 801
            H DA+  +R  Y+K  +A+RR    D E+I  +  + + EG +S+ER +ELK +EQF+L
Sbjct: 722 GHVDAEPWQRAAYLKRSAAERRATGVDEEDIALVGEEVTEEGQLSDERYEELKAREQFVL 781

Query: 802 TVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGT 861
           TVSEKGFGKR+SSYDFRIS R GKGIRATD SK  EIG LVA FPV+D DQI+LVSD G 
Sbjct: 782 TVSEKGFGKRSSSYDFRISGRGGKGIRATDTSKTGEIGELVAAFPVDDGDQIMLVSDGGQ 841

Query: 862 LIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
           LIRVPV  IRIASRATKGV IFSTAKDE+VVSVERI 
Sbjct: 842 LIRVPVGGIRIASRATKGVTIFSTAKDEKVVSVERIS 878



 Score = 50.9 bits (120), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/144 (18%), Positives = 51/144 (35%), Gaps = 6/144 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFI-----QINRSGKIAMKLDSRDEILSVETCTQENDILLT 699
             +V+  ++ G  +R+   DF                K     E+++       + I+L 
Sbjct: 777 EQFVLTVSEKGFGKRSSSYDFRISGRGGKGIRATDTSKTGEIGELVAAFPVDDGDQIMLV 836

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  GQ +R P+  IR  A R + GV   S AK ++V+S+  +   + +  E        +
Sbjct: 837 SDGGQLIRVPVGGIR-IASRATKGVTIFSTAKDEKVVSVERISEPEEEETEEAVETAEGA 895

Query: 760 AQRRLISGDTEEITSLKNDSSVEG 783
                 S     +         E 
Sbjct: 896 PAADESSAGETPVADGDPAGPAEE 919


>gi|254780182|ref|YP_003064595.1| DNA gyrase subunit A [Candidatus Liberibacter asiaticus str. psy62]
 gi|254039859|gb|ACT56655.1| DNA gyrase subunit A [Candidatus Liberibacter asiaticus str. psy62]
          Length = 910

 Score =  984 bits (2544), Expect = 0.0,   Method: Composition-based stats.
 Identities = 910/910 (100%), Positives = 910/910 (100%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM
Sbjct: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
           MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV
Sbjct: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG
Sbjct: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA
Sbjct: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR
Sbjct: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA
Sbjct: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR
Sbjct: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
           SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL
Sbjct: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV
Sbjct: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK
Sbjct: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN
Sbjct: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
           KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN
Sbjct: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSS 780
           SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSS
Sbjct: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSS 780

Query: 781 VEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGA 840
           VEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGA
Sbjct: 781 VEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGA 840

Query: 841 LVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900
           LVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES
Sbjct: 841 LVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900

Query: 901 EIVDEAESTE 910
           EIVDEAESTE
Sbjct: 901 EIVDEAESTE 910


>gi|209964380|ref|YP_002297295.1| DNA gyrase, A subunit [Rhodospirillum centenum SW]
 gi|209957846|gb|ACI98482.1| DNA gyrase, A subunit [Rhodospirillum centenum SW]
          Length = 922

 Score =  984 bits (2543), Expect = 0.0,   Method: Composition-based stats.
 Identities = 500/909 (55%), Positives = 663/909 (72%), Gaps = 12/909 (1%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT  I +        I+ ++I +EM+ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+ M
Sbjct: 1   MTSTIPTP-----SDISPITIEEEMRRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYAM 55

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
              G +  K Y K ARI G+VMGKYHPHG+ AIYDA+ RMAQD+S+RL LI+GQGN+GS+
Sbjct: 56  KDGGYDSTKPYKKSARIVGDVMGKYHPHGDGAIYDAMVRMAQDFSMRLPLIDGQGNYGSM 115

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTE RL KAA FLLDD+ K+TVDF+PNYD S  EP VL A++PN+LVNG G
Sbjct: 116 DGDPPAAMRYTEARLAKAAEFLLDDIDKETVDFQPNYDESSLEPTVLPAKFPNLLVNGAG 175

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIPTHNLGEV+D C A IDNP+I +D L++I+ GPDFPTGA+ILGR+GI++A
Sbjct: 176 GIAVGMATNIPTHNLGEVIDACCAYIDNPEITIDELIDIVPGPDFPTGALILGRSGIRSA 235

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGSIV+R  + IE+   DR  IVVTEIPYQVNKA + E+IAE+V EK +  I+D+R
Sbjct: 236 YHTGRGSIVMRAKTDIEEIRKDRWAIVVTEIPYQVNKAKLQERIAEVVHEKLVEGISDVR 295

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR G RVVIELKR A ADV+LNQL+R+T LQ+ F VNM+ALNG +PE   L  I+ A
Sbjct: 296 DESDRDGVRVVIELKRDAVADVVLNQLFRFTPLQTSFGVNMLALNGGRPELLDLKSIIAA 355

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV FRE+V+ RRT++ L KAR+RAH LVGLA+AVAN+DE++ +IR +P+P TAR ++M R
Sbjct: 356 FVRFREQVITRRTEFELGKARERAHTLVGLAVAVANIDEMIALIRNAPDPGTAREQMMAR 415

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D+  LI LID+    +   GT  LSE Q +AIL+LRL RLTGL RD I  ELN +
Sbjct: 416 EWPALDVAPLIQLIDEPGRGLSEAGTYRLSEGQAKAILDLRLHRLTGLERDKISEELNQV 475

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
             +I+  L IL+ R  LL I++ EL+ +K     PRRT I E   + + ED I REDMVV
Sbjct: 476 VDQIRHLLAILADRGLLLDILRGELVDMKARFGNPRRTTIEELEFEADVEDLIQREDMVV 535

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
            V+  GY+KRVP+S YRAQ RGGKGRSG+ ++ ED V+DLF+ +THT +LFF++ G VY 
Sbjct: 536 IVTQGGYIKRVPVSTYRAQARGGKGRSGMSLKAEDTVSDLFVANTHTPMLFFTNRGMVYT 595

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
            KVWRLP G+PQ RGKAL+N+L L +G+ ITT+MP PED++SW +L+V+FAT  G VRRN
Sbjct: 596 LKVWRLPQGTPQTRGKALVNLLPLEEGDFITTVMPMPEDQASWGDLHVLFATSRGGVRRN 655

Query: 661 KLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           +LSDF  I  +G IAMKL +  + +++   C++ +D+LL+T+LG+C+RFP+  IRVF+GR
Sbjct: 656 RLSDFANIRSNGLIAMKLEEEGERLIAARPCSEADDVLLSTRLGRCIRFPVGEIRVFSGR 715

Query: 720 NSVGVRGISL-AKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLK-- 776
            S GVRGI L   GD+VI M+I+ H D   ++R  Y+K     R+ +   T+   +    
Sbjct: 716 TSTGVRGIKLVEDGDEVIGMSILRHTDYSAEQRAAYLKQARQLRQAMGEPTDADEAPDVE 775

Query: 777 -NDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKI 835
                    + +E   E++  E+ ILTVSE+GFGKRTS+Y++R++ R G+GI   D+ + 
Sbjct: 776 AEPVETSLVLPQELFIEMQAAEEIILTVSEQGFGKRTSAYEYRLTGRGGQGIWNMDMGER 835

Query: 836 NEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVE 895
           N+  A+ AVFP+++ DQ++++SD G +IR+PV++IR+  R +KGV +F    DERVVSV 
Sbjct: 836 NK--AIAAVFPISETDQVMMISDNGQVIRMPVHDIRLTGRKSKGVTLFRLGPDERVVSVA 893

Query: 896 RIRESEIVD 904
           R+ E    D
Sbjct: 894 RLAEEAAGD 902



 Score =  104 bits (260), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/221 (20%), Positives = 84/221 (38%), Gaps = 13/221 (5%)

Query: 693 ENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERI 752
           E+ +++ T+ G   R P+S  R    R   G  G+SL   D V  + +            
Sbjct: 531 EDMVVIVTQGGYIKRVPVSTYRA-QARGGKGRSGMSLKAEDTVSDLFVANTHTPMLFFTN 589

Query: 753 CYMKHMSAQRRLISGDTEEITS------LKNDSSVEGNISEERCQELKLKEQFILTVSEK 806
             M +     RL  G  +             +      +      +    +  +L  + +
Sbjct: 590 RGMVYTLKVWRLPQGTPQTRGKALVNLLPLEEGDFITTVMPMPEDQASWGDLHVLFATSR 649

Query: 807 GFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVP 866
           G  +R    DF  +N    G+ A  + +  E   L+A  P ++ D ++L +  G  IR P
Sbjct: 650 GGVRRNRLSDF--ANIRSNGLIAMKLEEEGE--RLIAARPCSEADDVLLSTRLGRCIRFP 705

Query: 867 VNEIRI-ASRATKGVVIFST-AKDERVVSVERIRESEIVDE 905
           V EIR+ + R + GV         + V+ +  +R ++   E
Sbjct: 706 VGEIRVFSGRTSTGVRGIKLVEDGDEVIGMSILRHTDYSAE 746



 Score = 61.0 bits (146), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 39/237 (16%), Positives = 84/237 (35%), Gaps = 5/237 (2%)

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
              D V+  + LG   R P+   R    G        ++  +   ++  +S      + +
Sbjct: 687 SEADDVLLSTRLGRCIRFPVGEIR-VFSGRTSTGVRGIKLVEDGDEVIGMSILRHTDYSA 745

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
                Y ++  +L     +         +     E    +      E       ++  ++
Sbjct: 746 EQRAAYLKQARQLRQAMGEPTDADEAPDVEAEPVETSLVLPQELFIEMQAAEEIILTVSE 805

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLDSRDE---ILSVETCTQENDILLTTKLGQCVRFPI 710
            G  +R    ++    R G+    +D  +    I +V   ++ + +++ +  GQ +R P+
Sbjct: 806 QGFGKRTSAYEYRLTGRGGQGIWNMDMGERNKAIAAVFPISETDQVMMISDNGQVIRMPV 865

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISG 767
             IR   GR S GV    L   ++V+S+A +    A   + I    + +A      G
Sbjct: 866 HDIR-LTGRKSKGVTLFRLGPDERVVSVARLAEEAAGDGQGIEGNGNGAADAPGPDG 921


>gi|260459145|ref|ZP_05807400.1| DNA gyrase, A subunit [Mesorhizobium opportunistum WSM2075]
 gi|259034699|gb|EEW35955.1| DNA gyrase, A subunit [Mesorhizobium opportunistum WSM2075]
          Length = 933

 Score =  983 bits (2541), Expect = 0.0,   Method: Composition-based stats.
 Identities = 593/914 (64%), Positives = 723/914 (79%), Gaps = 5/914 (0%)

Query: 1   MTEHIIS-SDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFG 59
           MT+       +    GI  +SI +EMQ+SYL+YA++VI+ RA+PD+RDGLKPVHRRIL+ 
Sbjct: 1   MTDQKTPRGADGGPTGIEPISIIEEMQSSYLSYAMSVIVSRALPDVRDGLKPVHRRILYA 60

Query: 60  MMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS 119
             + G  WN+KYVK AR   +VMGKYHPHG+A+IYDAL RMAQDWSLR+ LI+GQGNFGS
Sbjct: 61  AHESGYHWNRKYVKSARPVADVMGKYHPHGDASIYDALVRMAQDWSLRVPLIDGQGNFGS 120

Query: 120 VDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGG 179
           +DGDPPAA RYTE RL K AH LL+D+ K+TVDF+  YD S  EP VL AR+PN+LVNG 
Sbjct: 121 IDGDPPAAMRYTESRLTKVAHELLEDIDKETVDFQDTYDASDTEPKVLPARFPNLLVNGS 180

Query: 180 GGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKN 239
           GGIAVGMATNIP HNL EV +G +A+IDNP IDL ALMEII GPDFPTG ++LGR+GI +
Sbjct: 181 GGIAVGMATNIPPHNLSEVCNGAIAIIDNPAIDLPALMEIIPGPDFPTGGIVLGRSGIYS 240

Query: 240 AYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           AYATGRGSIV+RG  +IE+   DRE I++TE+PYQVNKA+M+EK+AELVR+KRI  I+D+
Sbjct: 241 AYATGRGSIVMRGKVNIEQRGNDRESIIITEVPYQVNKASMIEKMAELVRDKRIEGISDI 300

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDESDRQGYRVVIELKR A ADVILNQLYR+T LQ+ F  NMVALNG KPE   L  +L+
Sbjct: 301 RDESDRQGYRVVIELKRDAVADVILNQLYRFTPLQTSFGANMVALNGGKPEVMNLTDMLR 360

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
           AFV+FREEV+ RRTK+LL KARDRAHVLVGLAIAVAN+DEV+++IR +P+P+TAR +LM+
Sbjct: 361 AFVSFREEVITRRTKFLLRKARDRAHVLVGLAIAVANIDEVIKLIRTAPDPQTAREQLME 420

Query: 420 RSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           R W + D++ LI LIDD  + I  DGT  LSE Q RAILELRL RLT LGRD+I +ELN+
Sbjct: 421 RRWPSGDVESLILLIDDPRHRINEDGTYNLSEEQARAILELRLQRLTALGRDEIADELNT 480

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           +G EI + LDILSSR+R+  I+K EL +V+DE  TPRRT + +G  DMEDED I REDMV
Sbjct: 481 IGAEIIDYLDILSSRARVQQIVKDELAAVRDEFGTPRRTELTDGGADMEDEDLIQREDMV 540

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           VTVSH GY+KRVPLS+YRAQRRGGKGRSG+  ++EDFVT LF+ +THT VLFFSS G VY
Sbjct: 541 VTVSHSGYIKRVPLSLYRAQRRGGKGRSGMSTKEEDFVTRLFVANTHTPVLFFSSRGIVY 600

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           KEKVWRLPIG+PQ+RGKALIN+L L QGERITTIMP PEDE+SW  L V+FAT  G VRR
Sbjct: 601 KEKVWRLPIGNPQSRGKALINMLPLEQGERITTIMPLPEDETSWGELDVMFATTRGTVRR 660

Query: 660 NKLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAG 718
           NKLSDF+Q+NR+GKIAMKL +  DEIL VETCT  +D+LLT   GQC+RF +  +RVF  
Sbjct: 661 NKLSDFVQVNRNGKIAMKLEEEGDEILGVETCTDNDDVLLTANSGQCIRFSVGDVRVFQS 720

Query: 719 RNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITS---L 775
           RNSVGVRGI++A  D++ISM+++ H DA   ER  Y+K  +++RRL +    E       
Sbjct: 721 RNSVGVRGITMAATDRIISMSVIEHVDASPAERAAYLKRAASERRLAAETAGEEEEIALT 780

Query: 776 KNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKI 835
             +   E  +S+ R +ELK  EQ++LTV+E G+GKR+SSYDFR++ R GKGIRATDVSK 
Sbjct: 781 NEEIGEETELSDSRYEELKAHEQYVLTVTEYGYGKRSSSYDFRLTGRGGKGIRATDVSKT 840

Query: 836 NEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVE 895
            EIG LVA FPV ++DQI+LVSD GT+IRVPVN IR ASRATKGV IF+TA+ E+VVSVE
Sbjct: 841 AEIGQLVATFPVGNDDQIMLVSDGGTVIRVPVNGIRFASRATKGVTIFNTAEGEKVVSVE 900

Query: 896 RIRESEIVDEAEST 909
           RI E +  +E E  
Sbjct: 901 RISEPQSDEEIEEA 914



 Score = 55.6 bits (132), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 54/128 (42%), Gaps = 6/128 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFI-----QINRSGKIAMKLDSRDEILSVETCTQENDILLT 699
             YV+  T++G  +R+   DF                K     ++++      ++ I+L 
Sbjct: 802 EQYVLTVTEYGYGKRSSSYDFRLTGRGGKGIRATDVSKTAEIGQLVATFPVGNDDQIMLV 861

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  G  +R P++ IR FA R + GV   + A+G++V+S+  +    +D +          
Sbjct: 862 SDGGTVIRVPVNGIR-FASRATKGVTIFNTAEGEKVVSVERISEPQSDEEIEEAVQGGSE 920

Query: 760 AQRRLISG 767
           A     +G
Sbjct: 921 ANPTPDAG 928


>gi|161511097|ref|NP_771336.2| DNA gyrase subunit A [Bradyrhizobium japonicum USDA 110]
          Length = 909

 Score =  983 bits (2540), Expect = 0.0,   Method: Composition-based stats.
 Identities = 561/911 (61%), Positives = 684/911 (75%), Gaps = 3/911 (0%)

Query: 1   MTEHIISSDEE-EEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFG 59
           M +     D+  +   I  VSI +EM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+ 
Sbjct: 1   MADDDKPGDQPAQPSDIRPVSIFEEMKKSYLDYAMSVIVARALPDARDGLKPVHRRILYS 60

Query: 60  MMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS 119
           M + G   +KKYVK AR+ G+V+GKYHPHG+ +IYDA+ RMAQD+S+R+ LI+GQGNFGS
Sbjct: 61  MNEQGHTPDKKYVKSARVVGDVIGKYHPHGDQSIYDAMVRMAQDFSMRVPLIDGQGNFGS 120

Query: 120 VDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGG 179
           VDGDPPAA RYTE RL KAA  LL D+ KDTVDF+PNYD +  EP VL A++PN+LVNG 
Sbjct: 121 VDGDPPAAYRYTEARLTKAALALLADIDKDTVDFQPNYDNNETEPSVLPAKFPNLLVNGA 180

Query: 180 GGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKN 239
           GGIAVGMATNIP HNLGEV+D CVA+IDNP + +D L+ I+ GPDFPTG VILGR GI+ 
Sbjct: 181 GGIAVGMATNIPPHNLGEVIDACVALIDNPALTIDELINIVPGPDFPTGGVILGRAGIRA 240

Query: 240 AYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           AY  GRGSIV+RG   IE    +RE +++TEIPYQVNKA M+E+IAELV+EK+I  I DL
Sbjct: 241 AYHLGRGSIVMRGKVAIETIRKEREALIITEIPYQVNKATMVERIAELVKEKKIEGIGDL 300

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDESDR GYRVVIELKR A ADV+LNQLYR+T LQ+ F VNMVAL+  +P    L  +L 
Sbjct: 301 RDESDRDGYRVVIELKRDAVADVVLNQLYRFTPLQTSFGVNMVALDSGRPRIMHLKDLLA 360

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
            FV FRE VV RRTK+LL KARDRAH+LVGLAIAVAN+DE++R+IR SP+P TAR  LM 
Sbjct: 361 IFVDFRERVVTRRTKFLLAKARDRAHILVGLAIAVANIDEMIRVIRTSPDPTTARDTLMS 420

Query: 420 RSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           R W A D++D++ LIDD  + I  DGT+ LS  Q RAIL+LRL RLT LGRD+IR+EL+ 
Sbjct: 421 RDWPARDVEDMLTLIDDPRHRISPDGTIRLSMEQARAILDLRLQRLTALGRDEIRDELDK 480

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           L  EI + LDIL SR R+LGIIK EL  VK E  TPRRT I+E   ++EDED I REDMV
Sbjct: 481 LAGEIADYLDILRSRERVLGIIKTELAEVKAEFATPRRTVIMEQEGEVEDEDLIQREDMV 540

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           VTVSH GYVKRVPLS YRAQRRGGKGR+G+  RDEDFV+ LF+ STHT VLFFSS G VY
Sbjct: 541 VTVSHAGYVKRVPLSAYRAQRRGGKGRAGMQTRDEDFVSRLFVASTHTPVLFFSSRGQVY 600

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           KEKVWRLP+ +P ARGKALINIL L QGERITTIMP PEDES+W NL V+FAT  GNVRR
Sbjct: 601 KEKVWRLPMAAPNARGKALINILPLEQGERITTIMPLPEDESTWGNLDVMFATTGGNVRR 660

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           NKLSDF+ + RSG IAMKLD  + I+ V+ CT+ +D+LLT   GQC+RFP++ +RVF GR
Sbjct: 661 NKLSDFVDVRRSGIIAMKLDENEAIVDVQICTERDDVLLTGAGGQCIRFPVTDVRVFTGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
            S+GVRGI+L +GD+VIS+AI+ H +   DER  Y+K   A     + +     +   ++
Sbjct: 721 TSMGVRGIALGEGDKVISLAILRHVETTSDERSAYLKMRRAVAGEATAEEPAADAEAEET 780

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           S    +++ER  E+   EQ +LTVS  G+GKRTSSY++R + R GKGI A  V+  N  G
Sbjct: 781 SGSFQLAQERYVEMSAAEQVVLTVSVNGYGKRTSSYEYRTTGRGGKGIVAMSVNNRN--G 838

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FPV D DQI+LV+DKG LIR PV  IRIA R+T+GV++F TA+DE VVSVE I E
Sbjct: 839 NLVASFPVEDADQIMLVTDKGQLIRCPVEGIRIAGRSTQGVIVFDTAEDEHVVSVEHITE 898

Query: 900 SEIVDEAESTE 910
                   + E
Sbjct: 899 EAESGNGANGE 909


>gi|75675993|ref|YP_318414.1| DNA gyrase subunit A [Nitrobacter winogradskyi Nb-255]
 gi|74420863|gb|ABA05062.1| DNA gyrase subunit A [Nitrobacter winogradskyi Nb-255]
          Length = 913

 Score =  983 bits (2540), Expect = 0.0,   Method: Composition-based stats.
 Identities = 560/908 (61%), Positives = 690/908 (75%), Gaps = 6/908 (0%)

Query: 1   MTE--HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILF 58
           M++       +     GI  VSI +EM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+
Sbjct: 1   MSDIEDTKPEEPPAPSGIRPVSILEEMKRSYLDYAMSVIVARALPDARDGLKPVHRRILY 60

Query: 59  GMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFG 118
            M + G EWNK Y K AR  G+V+GKYHPHG+ ++YDAL RMAQD+S+R+ LI+GQGNFG
Sbjct: 61  AMYENGFEWNKPYRKSARTVGDVIGKYHPHGDQSVYDALVRMAQDFSMRVPLIDGQGNFG 120

Query: 119 SVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNG 178
           SVDGD  AA RYTE RL K A  LLDD+ KDTVDF+PNYD S +EP VL A++PN+LVNG
Sbjct: 121 SVDGDMAAAMRYTESRLTKIAQSLLDDIDKDTVDFQPNYDNSEREPSVLPAKFPNLLVNG 180

Query: 179 GGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIK 238
            GGIAVGMATNIP HNLGEV+D CVA+ID+P + +D L++II GPDFPTG +ILGR GI+
Sbjct: 181 AGGIAVGMATNIPPHNLGEVIDACVALIDDPALGIDDLIKIIPGPDFPTGGIILGRQGIR 240

Query: 239 NAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIAD 298
           +AY  GRGSIV+RG   I+    DRE IVV+EIPYQVNKA+M+E+IAELVREK+I  I+D
Sbjct: 241 SAYHLGRGSIVMRGKVSIDTIRKDREAIVVSEIPYQVNKASMVERIAELVREKKIDGISD 300

Query: 299 LRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGIL 358
           LRDESDR+G+RVV+ELKR A  +++LNQLY+YT LQ+ F  NMVAL+  +P+   L  +L
Sbjct: 301 LRDESDREGFRVVVELKRDAVPEIVLNQLYKYTPLQTNFGANMVALDAGRPQVMNLKDLL 360

Query: 359 KAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELM 418
             F+AFRE+VV RRTK+LLNKARDRAH+LVGLAIAVAN+DE++R+IR SP+P  AR  LM
Sbjct: 361 TLFIAFREQVVTRRTKFLLNKARDRAHILVGLAIAVANIDEIIRVIRESPDPNAARETLM 420

Query: 419 QRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELN 478
            R W A D+  +I LIDD  + +  DGT  LS  Q +AIL+LRL RLT LGR++I  EL+
Sbjct: 421 SRDWPAKDVAAMITLIDDPRHRVSPDGTARLSMEQAKAILDLRLQRLTALGREEISEELD 480

Query: 479 SLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDM 538
            L IEI + LDIL SR+R+  IIK EL +VK E  TPRRT IVE   ++EDED I REDM
Sbjct: 481 KLAIEIADYLDILRSRARVQAIIKTELGAVKSEFATPRRTVIVEQEGEVEDEDLIQREDM 540

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           VVTVSH GYVKRVPLS YRAQ+RGGKGRSG+  RDEDFV+ LF+ STHT VLFFSS G V
Sbjct: 541 VVTVSHAGYVKRVPLSTYRAQKRGGKGRSGMQTRDEDFVSRLFVASTHTPVLFFSSRGQV 600

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVR 658
           YKEKVWRLP+ +P ARGKALINIL L+QGERITTIMP PEDESSW +L V+FAT  G VR
Sbjct: 601 YKEKVWRLPMAAPNARGKALINILPLDQGERITTIMPLPEDESSWADLDVMFATTSGTVR 660

Query: 659 RNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAG 718
           RNKLSDF+ + RSG IAMKL   + I+ V+ CT+ +D+LLT   GQC+RFP++ +RVF+G
Sbjct: 661 RNKLSDFVDVRRSGIIAMKLGEGESIVDVQICTERDDVLLTAAGGQCIRFPVTDVRVFSG 720

Query: 719 RNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGD----TEEITS 774
           R S+GVRGI+LAKGD+VIS++I+ H DA   ER  Y+K   A RR  +G+     E    
Sbjct: 721 RTSMGVRGIALAKGDRVISLSILHHFDATPAERAAYLKQSGAIRRAATGEDIEPEEATPE 780

Query: 775 LKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSK 834
               +  + ++ E R  E+   EQF+LTV+  G+GKR+SS++FR+S R GKGIRATD +K
Sbjct: 781 ADEAAHTDLSLPEGRYVEMGAAEQFVLTVTTYGYGKRSSSFEFRVSGRGGKGIRATDPTK 840

Query: 835 INEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSV 894
           + EIG LVA FPV  +DQI+LVSD G LIRVPV  IRI SRA+KGV +F+TA  E VVSV
Sbjct: 841 LGEIGHLVAGFPVEMSDQIMLVSDGGQLIRVPVEGIRITSRASKGVRVFNTADGEHVVSV 900

Query: 895 ERIRESEI 902
           E IRE   
Sbjct: 901 EHIREDGE 908



 Score = 64.8 bits (156), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 33/214 (15%), Positives = 67/214 (31%), Gaps = 58/214 (27%)

Query: 746 ADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSE 805
           ADY + +     + A  +   G  +   +    + +     E   ++L  +E  ++TVS 
Sbjct: 487 ADYLDILRSRARVQAIIKTELGAVKSEFATPRRTVIVEQEGEVEDEDLIQREDMVVTVSH 546

Query: 806 KGFGKRTSSYDFRISNRSGKGIRATDVSKI------------------------------ 835
            G+ KR     +R   R GKG                                       
Sbjct: 547 AGYVKRVPLSTYRAQKRGGKGRSGMQTRDEDFVSRLFVASTHTPVLFFSSRGQVYKEKVW 606

Query: 836 -------NEIGA-LVAVFPVNDND------------------QIILVSDKGTLIRVPVNE 869
                  N  G  L+ + P++  +                   ++  +  GT+ R  +++
Sbjct: 607 RLPMAAPNARGKALINILPLDQGERITTIMPLPEDESSWADLDVMFATTSGTVRRNKLSD 666

Query: 870 IRIASRATKGVVIFSTAKDERVVSVERIRESEIV 903
                R+  G++     + E +V V+   E + V
Sbjct: 667 FVDVRRS--GIIAMKLGEGESIVDVQICTERDDV 698



 Score = 57.5 bits (137), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 47/282 (16%), Positives = 93/282 (32%), Gaps = 28/282 (9%)

Query: 486 ECLDILSSRSRLLGIIKQELLSVK-DELDTPRRTRIVEGL----LDMEDEDCIVREDMVV 540
           E     +    +       +   K  +    RR+ I+         + D       D V+
Sbjct: 640 EDESSWADLDVMFATTSGTVRRNKLSDFVDVRRSGIIAMKLGEGESIVDVQICTERDDVL 699

Query: 541 TVSHLGYVKRVPLSVYR--AQRRGGKGRSGVVMRDED----FVTDLFIVSTHTSVLFFSS 594
             +  G   R P++  R  + R     R   + + +      +   F  +      +   
Sbjct: 700 LTAAGGQCIRFPVTDVRVFSGRTSMGVRGIALAKGDRVISLSILHHFDATPAERAAYLKQ 759

Query: 595 LGFVYKEKVWR--LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
            G + +        P  +     +A    LSL +G  +                +V+  T
Sbjct: 760 SGAIRRAATGEDIEPEEATPEADEAAHTDLSLPEGRYVE---------MGAAEQFVLTVT 810

Query: 653 KHGNVRRNKLSDF-IQINRSGKIAM----KLDSRDEILSVETCTQENDILLTTKLGQCVR 707
            +G  +R+   +F +       I      KL     +++       + I+L +  GQ +R
Sbjct: 811 TYGYGKRSSSFEFRVSGRGGKGIRATDPTKLGEIGHLVAGFPVEMSDQIMLVSDGGQLIR 870

Query: 708 FPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYD 749
            P+  IR    R S GVR  + A G+ V+S+  +     + +
Sbjct: 871 VPVEGIR-ITSRASKGVRVFNTADGEHVVSVEHIREDGENGN 911


>gi|288958233|ref|YP_003448574.1| DNA gyrase subunit A [Azospirillum sp. B510]
 gi|288910541|dbj|BAI72030.1| DNA gyrase subunit A [Azospirillum sp. B510]
          Length = 927

 Score =  981 bits (2537), Expect = 0.0,   Method: Composition-based stats.
 Identities = 500/909 (55%), Positives = 665/909 (73%), Gaps = 9/909 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           M+   +         I  ++I DEM+ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+ M
Sbjct: 1   MSNTPLPP----ASDIAPINIEDEMRKSYLDYAMSVIVSRALPDVRDGLKPVHRRILYAM 56

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            + G +  K Y K ARI G+VMGKYHPHG++AIYDA+ RMAQD+S+RL LI+GQGNFGS+
Sbjct: 57  KEGGYDSTKPYKKSARIVGDVMGKYHPHGDSAIYDAMVRMAQDFSMRLPLIDGQGNFGSM 116

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTE RL KAA  LLDD+ KDT+DF+ +YD S +EP V+ AR+PN+LVNG G
Sbjct: 117 DGDPPAAMRYTEARLAKAAEALLDDIDKDTIDFQASYDDSGREPTVVPARFPNLLVNGAG 176

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIPTHNLGEV+D C A IDNPD+ LD LME + GPDFPTG +ILGR+G + A
Sbjct: 177 GIAVGMATNIPTHNLGEVIDACCAYIDNPDVTLDELMEHVPGPDFPTGGLILGRSGSRAA 236

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
             TGRGSI++R  +H E+   DR  I+ TEIPYQVNKA ++E+I E+V +K I  IADLR
Sbjct: 237 LQTGRGSIILRAKTHFEEVRKDRTAIIATEIPYQVNKAKLMERIGEVVNDKTIEGIADLR 296

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR G RVVIELKR A  DV+L QL+R+T LQ+ F VNM+ALNG +PE   L+ ++ A
Sbjct: 297 DESDRDGVRVVIELKRDAVPDVVLAQLFRHTQLQTSFGVNMLALNGGRPELMNLLDVITA 356

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV FRE+V+ RRT++LL KAR+RAH LVGLA+AVANLD ++ +IR +P+P  AR E+M R
Sbjct: 357 FVRFREQVITRRTEFLLGKARERAHTLVGLAVAVANLDAMIGLIRSAPDPVWAREEMMNR 416

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W   D+  LI+LID+    +   GT  LSEVQ RAIL+LRL RLTGL RD I  EL  +
Sbjct: 417 EWPVHDVGPLIELIDEPGRGVSDQGTYRLSEVQARAILDLRLHRLTGLERDKIGAELKDV 476

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
             +I + L  L++R +L+GI++ EL+ +K+   TPRRT I +   + + ED I REDMVV
Sbjct: 477 TDQIADFLATLANRPKLMGILRDELVEMKERFGTPRRTEIQDLEFEADIEDLIQREDMVV 536

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVS  GYVKRVPLS YRAQ+RGGKGR+G+ M+ ED V+DLF+ +THT +L FS+ G VYK
Sbjct: 537 TVSQSGYVKRVPLSTYRAQKRGGKGRAGMSMKAEDAVSDLFVANTHTPLLLFSNRGMVYK 596

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
            KV+RLP+G+PQARGKA +N+L L  GE ITT++P PEDE++W +L+VVFAT  GNVRRN
Sbjct: 597 LKVYRLPLGNPQARGKAFVNLLPLIDGETITTVLPLPEDEAAWADLHVVFATSKGNVRRN 656

Query: 661 KLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           ++SDF  I  +G IAMKL +  + ++ V TC++ +DILL T+ G+C+RFP+  +RVFAGR
Sbjct: 657 RMSDFANIRSNGLIAMKLEEEGERLIGVHTCSETDDILLATRGGKCIRFPVDDVRVFAGR 716

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
            S GVRGI LA GD+V+S++I+ H DA  +ER  + K    +   + G  E         
Sbjct: 717 TSTGVRGIKLADGDEVVSLSILAHVDATPEERAAFFKMKRDEGLEMEG--EAAPEADEVP 774

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           +    +++ER +ELK KEQ+ILTVS++G+GKR+SSY++R + R G+GI   ++ + N  G
Sbjct: 775 TDSVTLTQERYEELKQKEQYILTVSDRGYGKRSSSYEYRTAGRGGQGIWNMEMGERN--G 832

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
           ++VA FPV  N Q+++V++ G +IR+P++++R+A R T GV +F    DERVVSV  I E
Sbjct: 833 SIVAAFPVESNHQVMMVTNGGQVIRMPLHDVRVAGRKTLGVTLFRVGADERVVSVATIAE 892

Query: 900 SEIVDEAES 908
            +    A++
Sbjct: 893 EDGETGADA 901



 Score = 59.0 bits (141), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 27/139 (19%), Positives = 57/139 (41%), Gaps = 4/139 (2%)

Query: 643 WNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDE---ILSVETCTQENDILLT 699
               Y++  +  G  +R+   ++    R G+    ++  +    I++       + +++ 
Sbjct: 790 QKEQYILTVSDRGYGKRSSSYEYRTAGRGGQGIWNMEMGERNGSIVAAFPVESNHQVMMV 849

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           T  GQ +R P+  +RV AGR ++GV    +   ++V+S+A +   D +            
Sbjct: 850 TNGGQVIRMPLHDVRV-AGRKTLGVTLFRVGADERVVSVATIAEEDGETGADAGAESGGD 908

Query: 760 AQRRLISGDTEEITSLKND 778
           A     S      T+  ND
Sbjct: 909 ANGSDGSIGDAGGTAAPND 927


>gi|154253489|ref|YP_001414313.1| DNA gyrase subunit A [Parvibaculum lavamentivorans DS-1]
 gi|154157439|gb|ABS64656.1| DNA gyrase, A subunit [Parvibaculum lavamentivorans DS-1]
          Length = 965

 Score =  981 bits (2536), Expect = 0.0,   Method: Composition-based stats.
 Identities = 548/903 (60%), Positives = 688/903 (76%), Gaps = 12/903 (1%)

Query: 13  EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYV 72
           E+ +  ++I DEM++SYL YA++VI+ RA+PD RDGLKPVHRRILF M + G +WNK Y 
Sbjct: 65  ERDVAPIAIEDEMRSSYLDYAMSVIVSRALPDARDGLKPVHRRILFSMNENGYDWNKPYR 124

Query: 73  KCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTE 132
           K AR+ G+V+GKYHPHG+ +IYDAL RMAQD+S+RL L++GQGNFGSVDGDPPAA RYTE
Sbjct: 125 KSARVVGDVIGKYHPHGDQSIYDALVRMAQDFSMRLPLLDGQGNFGSVDGDPPAAMRYTE 184

Query: 133 CRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPT 192
            R+ K AH LL+D+ K+T+DF+ NYDG+ +EPVVL A  PN+LVNG  GIAVGMATNIP 
Sbjct: 185 VRMAKTAHALLNDIDKNTIDFKDNYDGTEREPVVLPAELPNLLVNGANGIAVGMATNIPP 244

Query: 193 HNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRG 252
           HNLGEV+D C+A+IDNPDI +D L+E +  PDFPTG ++LGR G + AY TG+GS+V+RG
Sbjct: 245 HNLGEVIDACIALIDNPDITIDELIEHVPAPDFPTGGIMLGRQGARLAYHTGKGSVVVRG 304

Query: 253 VSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVI 312
               E+   DR+ I+++EIPYQVNKA+M+EKIA+LVREKRI  IADLRDESDR G RVV+
Sbjct: 305 RVEFEEVRKDRQAIIISEIPYQVNKASMVEKIADLVREKRIEGIADLRDESDRNGMRVVV 364

Query: 313 ELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRR 372
           EL+R A  DV+LNQLYR++ LQ  F  NM+AL+  +PE   L   L+ FVAFREEV+ RR
Sbjct: 365 ELRRDAVPDVVLNQLYRFSPLQQSFGCNMLALDHGRPELMNLKQFLEIFVAFREEVISRR 424

Query: 373 TKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLID 432
           TK+ LNKARDRAHVLVGLAIAVAN+DEV+++IR +P+P +AR  LM R W A DI  LI 
Sbjct: 425 TKFELNKARDRAHVLVGLAIAVANIDEVIKLIRTAPDPASARESLMARDWPARDIAPLIA 484

Query: 433 LIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILS 492
           LIDD  + +  DGT+ +SE Q RAILELRL RLT LGRD+I +EL  LG  I++ L IL 
Sbjct: 485 LIDDPRHQLREDGTIRMSEEQARAILELRLQRLTALGRDEIGDELKGLGERIEDYLSILR 544

Query: 493 SRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVP 552
           SR+R+L I++ EL ++K E  TPRRT I E   D EDED I REDMVVTVSH GY+KRVP
Sbjct: 545 SRARVLDIMRTELTAIKAEFATPRRTEIAESESDFEDEDLIQREDMVVTVSHQGYIKRVP 604

Query: 553 LSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQ 612
           LS YRAQRRGGKGRSG+  +DEDFVT LF+ +THT +LFFSS G VYK KVWRLP  +PQ
Sbjct: 605 LSTYRAQRRGGKGRSGMSTKDEDFVTRLFVANTHTPMLFFSSTGMVYKLKVWRLPQSTPQ 664

Query: 613 ARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSG 672
           ARGKA+INIL L+ GE ITT+MP PEDE+SW++L+V+FAT+ G+VRRNKLSDF+QINR+G
Sbjct: 665 ARGKAMINILPLDHGEYITTVMPMPEDEASWDSLHVMFATRKGSVRRNKLSDFVQINRNG 724

Query: 673 KIAMKL---DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISL 729
           KIAMK    D+ D I+ V+ CT+E+D+LLT   G+CVRFP++ +RVF+ R S GVRGI L
Sbjct: 725 KIAMKFEGDDADDAIVGVQICTEEDDVLLTAANGRCVRFPVTEVRVFSSRKSTGVRGIRL 784

Query: 730 AKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEG------ 783
              D++I+M+I+ H D    E   Y+K  +A RR +SG+ EE  +   ++          
Sbjct: 785 GDDDKLIAMSIMRHVDVTPAEARAYLKQAAAMRRAVSGEGEEPEAEIVEAEEGEEEAAEE 844

Query: 784 -NISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALV 842
             +S ER  EL  +EQF+LTVSEKGFGKR+SSYD+R S R GKGI A  V+  N  G LV
Sbjct: 845 MTLSTERYSELGAREQFVLTVSEKGFGKRSSSYDYRTSGRGGKGIIAMAVTPRN--GNLV 902

Query: 843 AVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEI 902
           A FPV+  DQI+LV+D G LIR PV+++R A RAT+GV IF TA DERVVSVER+ E+  
Sbjct: 903 ASFPVDVQDQIMLVTDAGQLIRCPVDDVRAAGRATQGVTIFRTAPDERVVSVERVEETGS 962

Query: 903 VDE 905
            +E
Sbjct: 963 DEE 965


>gi|163793160|ref|ZP_02187136.1| Type IIA topoisomerase , A subunit [alpha proteobacterium BAL199]
 gi|159181806|gb|EDP66318.1| Type IIA topoisomerase , A subunit [alpha proteobacterium BAL199]
          Length = 927

 Score =  981 bits (2536), Expect = 0.0,   Method: Composition-based stats.
 Identities = 479/905 (52%), Positives = 660/905 (72%), Gaps = 3/905 (0%)

Query: 6   ISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGV 65
           +S        I  VSI DEM+ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+ M   G 
Sbjct: 1   MSDISSTHHDIAPVSIEDEMRRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYAMKVGGY 60

Query: 66  EWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPP 125
           +W + Y K ARI G+VMG+YHPHG++AIYDA+ RMAQD+S+RL L++GQGNFGS+DGDPP
Sbjct: 61  DWTRPYRKSARIVGDVMGQYHPHGDSAIYDAMVRMAQDFSMRLPLVDGQGNFGSMDGDPP 120

Query: 126 AAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVG 185
           AA RYTE RL KAA  LL D+ K+TVD+ PNYD + +EP VL A YPN+LVNG GGIAVG
Sbjct: 121 AAMRYTEARLAKAAEGLLRDIDKETVDYIPNYDETTEEPSVLPAEYPNLLVNGAGGIAVG 180

Query: 186 MATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGR 245
           MATNIP HNLGEVVD C+A++DNP I +D L+ ++ GPDFPTG +ILGR+GI+ AY TGR
Sbjct: 181 MATNIPPHNLGEVVDACLAMLDNPGITIDELIALVPGPDFPTGGLILGRSGIREAYHTGR 240

Query: 246 GSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDR 305
           GS+V+RG + IE+   DR  IVVTEIPYQVNK+ ++E+I E+VR+K +  I+DLRDESDR
Sbjct: 241 GSVVMRGRAEIEEIRKDRFAIVVTEIPYQVNKSKLMERIGEVVRDKTVEGISDLRDESDR 300

Query: 306 QGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFR 365
            G RVV+ELKR A  +V+LNQLYRYT LQ+ F VNM+ALN  +P +  L  ++ AFV FR
Sbjct: 301 DGVRVVVELKRDAIGEVVLNQLYRYTQLQTSFGVNMLALNRGRPVQMNLRDVIFAFVEFR 360

Query: 366 EEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNAS 425
           EEV+ RRT++LL+KAR+RAHVL GL +A+ NLD V+ +IR +P+   ARR+L   +W A+
Sbjct: 361 EEVITRRTRFLLHKARERAHVLAGLMVAINNLDAVIAMIRSAPDAGEARRKLCAAAWPAT 420

Query: 426 DIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
           D+ D I +IDD  + +  +GT  LS+ Q RAIL+LRL RLTG+ R  + +E   +   IK
Sbjct: 421 DVIDFIAIIDDPGHRVTDEGTYQLSDAQARAILDLRLQRLTGMERSKLVDEATDIAARIK 480

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           + LDIL+SR RL+G+++ ELL  ++     RRT I+E   + + ED I REDMVVTVS+ 
Sbjct: 481 DYLDILTSRPRLMGVLRDELLQTREAWANDRRTEIMESEFEHDIEDLIAREDMVVTVSYS 540

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GY+KRVPL+ YRAQ+RGGKGR+G+  RDED+V  L++ ++H+ +LFF+S G VY+ K +R
Sbjct: 541 GYIKRVPLATYRAQKRGGKGRAGMATRDEDWVHRLYVANSHSPILFFTSRGQVYQLKTYR 600

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP G+PQ+RG+ ++N+L L +GE I T+MP P DESSW+ L+V+FAT  G +RRN LSDF
Sbjct: 601 LPEGTPQSRGRPMVNLLPLEEGEWIQTVMPMPADESSWDGLHVMFATAAGTIRRNALSDF 660

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
             INR+GK AMKLD  D +++V  C + +D+LL  + G+ +RF ++ +R+F GR+S+GVR
Sbjct: 661 TNINRAGKRAMKLDEGDRLIAVMPCNEGDDVLLAARSGKAIRFQVADVRLFRGRDSLGVR 720

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI LAKGD+V+SM+I+ H D +  +     + +   R+            ++ S+ +  +
Sbjct: 721 GIRLAKGDEVVSMSILHHVDYESVDGEQNERDVY-LRQAAWIRRGSGEGDEDASAPDVML 779

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
            E+R   L   E+F+L+V+EKG+GKRTS++++R++ R G+GI + DV+  N  G +V  F
Sbjct: 780 REDRFIALGAAEEFVLSVTEKGYGKRTSAHEYRVTGRGGQGIASMDVTAKN--GPVVTAF 837

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           PV   DQI+LV+D G +IR PV++IR+A+R T+GVV+F   +DE+VVSV  + E+   D 
Sbjct: 838 PVTPTDQIMLVTDGGQIIRCPVDDIRVAARKTQGVVLFRVGEDEKVVSVSLVGENGDDDN 897

Query: 906 AESTE 910
            E  +
Sbjct: 898 VEVAD 902



 Score = 64.0 bits (154), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 43/289 (14%), Positives = 92/289 (31%), Gaps = 52/289 (17%)

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           V+  +  G ++R  LS +    R GK    + + + D +  +   +    VL  +  G  
Sbjct: 643 VMFATAAGTIRRNALSDFTNINRAGKR--AMKLDEGDRLIAVMPCNEGDDVLLAARSGKA 700

Query: 599 YKEKVWRLP-----------------------------------IGSPQARGKALINILS 623
            + +V  +                                     G    R   L     
Sbjct: 701 IRFQVADVRLFRGRDSLGVRGIRLAKGDEVVSMSILHHVDYESVDGEQNERDVYLRQAAW 760

Query: 624 LNQGERITTIMPFPEDESSWNNLYV---------VFATKHGNVRRNKLSDF-IQINRSGK 673
           + +G           D     + ++         +  T+ G  +R    ++ +       
Sbjct: 761 IRRGSGEGDEDASAPDVMLREDRFIALGAAEEFVLSVTEKGYGKRTSAHEYRVTGRGGQG 820

Query: 674 IA---MKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLA 730
           IA   +   +   +++    T  + I+L T  GQ +R P+  IRV A R + GV    + 
Sbjct: 821 IASMDVTAKNG-PVVTAFPVTPTDQIMLVTDGGQIIRCPVDDIRV-AARKTQGVVLFRVG 878

Query: 731 KGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           + ++V+S+++V     D +  +      +A     +    +        
Sbjct: 879 EDEKVVSVSLVGENGDDDNVEVADEATDAATGDGPTEAGPDEEQGDATE 927


>gi|148255734|ref|YP_001240319.1| DNA gyrase subunit A [Bradyrhizobium sp. BTAi1]
 gi|146407907|gb|ABQ36413.1| DNA gyrase subunit A [Bradyrhizobium sp. BTAi1]
          Length = 915

 Score =  981 bits (2535), Expect = 0.0,   Method: Composition-based stats.
 Identities = 556/902 (61%), Positives = 691/902 (76%), Gaps = 5/902 (0%)

Query: 1   MTE--HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILF 58
           M++       +      I  VSI DEM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+
Sbjct: 1   MSDQEDEKPGEPGGPSDIRPVSILDEMKRSYLDYAMSVIVSRALPDARDGLKPVHRRILY 60

Query: 59  GMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFG 118
            M + G   +KKYVK AR+ G+V+GKYHPHG+ +IYDA+ RMAQD+S+R+ LI+GQGNFG
Sbjct: 61  SMYEQGHTPDKKYVKSARVVGDVIGKYHPHGDQSIYDAMVRMAQDFSMRVPLIDGQGNFG 120

Query: 119 SVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNG 178
           SVDGDPPAA RYTE +L K+A  LLDD+ KDTVDF+ NYD S +EP VL A++PN+LVNG
Sbjct: 121 SVDGDPPAAYRYTEAKLAKSAIPLLDDIDKDTVDFQANYDNSDKEPSVLPAKFPNLLVNG 180

Query: 179 GGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIK 238
            GGIAVGMATNIP HNL EV+D CVA+IDNP I +D L +II GPDFPTG +ILGR GI+
Sbjct: 181 AGGIAVGMATNIPPHNLSEVIDACVALIDNPAISIDELTQIIPGPDFPTGGIILGRAGIR 240

Query: 239 NAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIAD 298
           +AY  GRGSI++RG   I+    DRE I+V+EIPYQVNKA M+E+IAELVREK+I  I+D
Sbjct: 241 SAYHLGRGSIMMRGKVTIDTIRKDREAIIVSEIPYQVNKATMVERIAELVREKKIEGISD 300

Query: 299 LRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGIL 358
           LRDESDR GYRVVIELKR A ADV+LNQLY++T LQ+ F+ NM+AL+G +P+  TL  +L
Sbjct: 301 LRDESDRDGYRVVIELKRDAVADVVLNQLYKFTPLQTSFAANMLALDGGRPQTMTLKDLL 360

Query: 359 KAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELM 418
             FVAFRE VV RRTK+LLNKARDRAH+LVGLA+AVAN+DE++R+IR SPNP +AR  LM
Sbjct: 361 TIFVAFRERVVTRRTKFLLNKARDRAHILVGLAVAVANIDEIIRVIRTSPNPTSARDALM 420

Query: 419 QRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELN 478
            R W A D++ +I LIDD  + +  DGT+ LS  Q +AIL+LRL RLT LGR++I +EL+
Sbjct: 421 SRDWPARDVEAIITLIDDPRHRLAEDGTIRLSFEQAKAILDLRLQRLTALGREEISDELD 480

Query: 479 SLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDM 538
            L IEI + L+IL SR+R+  IIK EL +VK E  TPRRT I+E   ++EDED I REDM
Sbjct: 481 KLKIEIADYLEILRSRARVQDIIKTELAAVKAEFGTPRRTAIIEQEGEVEDEDLIQREDM 540

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           VVTVSH GY KRVPLS YRAQRRGGKGRSG+  R+EDFV+ LF+ STHT VLFFSS G V
Sbjct: 541 VVTVSHAGYTKRVPLSAYRAQRRGGKGRSGMQTREEDFVSRLFVASTHTPVLFFSSRGQV 600

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVR 658
           YKEKVWRLPI +P +RGKALINIL L QGERITTIMP PEDESSW NL V+FAT  GNVR
Sbjct: 601 YKEKVWRLPIAAPNSRGKALINILPLEQGERITTIMPLPEDESSWANLDVMFATTGGNVR 660

Query: 659 RNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAG 718
           RNKLSDF+ + RSG IAMKLD  +EI++V+ CT+ +D+LLT   GQC+RFP++ +RVF G
Sbjct: 661 RNKLSDFVDVRRSGIIAMKLDDGEEIVNVQICTERDDVLLTAAGGQCIRFPVTDVRVFTG 720

Query: 719 RNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKND 778
           R S+GVRGI+LA+GD+VIS++I+ H +   DER  Y+K   A     + +    T  +  
Sbjct: 721 RTSMGVRGIALAEGDKVISLSILRHVETTSDERTAYLKMRRAMSGETTTEEPVETEGEEA 780

Query: 779 SSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEI 838
           +     +S+ER  E+  +EQ +LTVS  G+GKRTSSY++R + R GKGI A  V+  N  
Sbjct: 781 AGA-IQLSQERYVEMSAQEQVVLTVSVNGYGKRTSSYEYRTTGRGGKGIVAMSVNNRN-- 837

Query: 839 GALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
           G LVA FPV D+DQI+LV+DKG LIR PV+ IRIA R+T+GV++F+TA DE VVSVE I 
Sbjct: 838 GKLVASFPVEDSDQIMLVTDKGQLIRCPVDGIRIAGRSTQGVIVFNTADDEHVVSVEHIG 897

Query: 899 ES 900
           E 
Sbjct: 898 EE 899



 Score =  100 bits (249), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 43/221 (19%), Positives = 77/221 (34%), Gaps = 13/221 (5%)

Query: 693 ENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAI------VLHADA 746
           E+ ++  +  G   R P+SA R    R   G  G+   + D V  + +      VL   +
Sbjct: 538 EDMVVTVSHAGYTKRVPLSAYRA-QRRGGKGRSGMQTREEDFVSRLFVASTHTPVLFFSS 596

Query: 747 DYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEK 806
                   +  +        G                 I      E       ++  +  
Sbjct: 597 RGQVYKEKVWRLPIAAPNSRGKALINILPLEQGERITTIMPLPEDESSWANLDVMFATTG 656

Query: 807 GFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVP 866
           G  +R    DF    R   GI A  +        +V V    + D ++L +  G  IR P
Sbjct: 657 GNVRRNKLSDFVDVRR--SGIIAMKLDDGE---EIVNVQICTERDDVLLTAAGGQCIRFP 711

Query: 867 VNEIRI-ASRATKGVVIFSTAKDERVVSVERIRESEIVDEA 906
           V ++R+   R + GV   + A+ ++V+S+  +R  E   + 
Sbjct: 712 VTDVRVFTGRTSMGVRGIALAEGDKVISLSILRHVETTSDE 752


>gi|217978381|ref|YP_002362528.1| DNA gyrase, A subunit [Methylocella silvestris BL2]
 gi|217503757|gb|ACK51166.1| DNA gyrase, A subunit [Methylocella silvestris BL2]
          Length = 927

 Score =  981 bits (2535), Expect = 0.0,   Method: Composition-based stats.
 Identities = 540/917 (58%), Positives = 676/917 (73%), Gaps = 9/917 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           M ++  +        I  VSI+DEM+ SYL YA++VI+ RA+PD+RDGLKPVHRRILF M
Sbjct: 1   MADNDDTGPGAPGSDIRPVSISDEMRRSYLDYAMSVIVSRALPDVRDGLKPVHRRILFSM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            +     ++ YVKCARI G+VMGKYHPHG++AIYDAL RMAQ +S+RL LI+GQGNFGSV
Sbjct: 61  HEQNHTPDRPYVKCARIVGDVMGKYHPHGDSAIYDALVRMAQGFSMRLPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTE RL + A  LL+D+  DTVDF+ NYDG  +EPVVL AR+PN+LVNG G
Sbjct: 121 DGDPPAAMRYTESRLARPAMALLEDIDSDTVDFQDNYDGKEREPVVLPARFPNLLVNGAG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEV+D  +A+IDNP++ ++ LM  + GPDFPTG  ILGRTGI++A
Sbjct: 181 GIAVGMATNIPPHNLGEVIDAVIALIDNPELTIEELMAYVPGPDFPTGGAILGRTGIQSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGS++ R    +E    +RE ++VTEIPYQ+NK++++EKIA+LVREKR+  I+DLR
Sbjct: 241 YLTGRGSVLTRAKVEVETLRKEREALIVTEIPYQINKSSLVEKIADLVREKRVEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR G R+VIELKR A A+V+LNQL+RYT+LQS F+ NM+ALNG +PE  TL   L A
Sbjct: 301 DESDRDGMRIVIELKRDAVAEVVLNQLWRYTALQSSFACNMIALNGGRPEMLTLKDFLTA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV FREEVV RRTKYLL KARD AH+ VGLAIAVAN+DEV+R+IR S +   AR  LM R
Sbjct: 361 FVDFREEVVTRRTKYLLGKARDAAHLQVGLAIAVANIDEVIRLIRSSADAAAAREALMAR 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
           SW A D+  L+ LI D  + +  +G   LSE Q RAILELRL RLT LGR++I   LN L
Sbjct: 421 SWPAHDMAPLVLLIADPRHILSENGECRLSEAQARAILELRLQRLTALGREEIAEALNKL 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
            +EI + L+IL SR RL  I+K+E+L+VK    TPRRT I++    ++DED I REDMVV
Sbjct: 481 AVEIADYLEILHSRERLFSIVKEEMLAVKAAHATPRRTIILDSATGVDDEDLIQREDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSH GYVKRVPL+ YRAQRRGGKGRS +  RDEDFV  LF+ STH  VLFFSS G VYK
Sbjct: 541 TVSHHGYVKRVPLATYRAQRRGGKGRSAMQTRDEDFVARLFVASTHAPVLFFSSAGQVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLP+ +PQARGKAL+N+L L QGERITTIMP PE+E +W  L V+FAT  G VRRN
Sbjct: 601 EKVWRLPLAAPQARGKALVNMLPLEQGERITTIMPLPEEEDAWATLDVMFATTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
           KLSDF Q+NR+GKIAM++D  +EI+ V+ C ++ D+LLTT  GQC+RFP++ +RVF GR+
Sbjct: 661 KLSDFAQVNRAGKIAMRIDEGEEIVDVQICGEDADVLLTTAKGQCIRFPVTDVRVFKGRD 720

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSS 780
           S+GVRGISL++GD+VIS+AI+ H +AD  ERI Y+K   A     S +    +       
Sbjct: 721 SMGVRGISLSEGDRVISLAILRHTEADSGERIAYLKMRRAVAGEASAEAGAESPADAQGE 780

Query: 781 VEGN------ISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSK 834
                     +S +R   +   EQ ILT+S  G+GKRTSSY++RI+ R GKGI A  V+ 
Sbjct: 781 DGAEDAGPQSLSPDRYARMSADEQIILTLSSNGYGKRTSSYEYRITGRGGKGIVAMVVNP 840

Query: 835 INEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSV 894
            N  G LVA  PV D D+I+LV++ G LIR PV  IR+A R T+GV++F+T  DE+VVSV
Sbjct: 841 RN--GLLVASMPVEDGDEIMLVTNGGQLIRCPVEGIRVAGRGTQGVIVFNTGADEQVVSV 898

Query: 895 ERIRESEIV-DEAESTE 910
           ERI E +    E E  E
Sbjct: 899 ERITEEDAARGETEEGE 915



 Score = 55.2 bits (131), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 53/131 (40%), Gaps = 4/131 (3%)

Query: 640 ESSWNNLYVVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEILSVETC-TQENDI 696
             S +   ++  + +G  +R    ++        G +AM ++ R+ +L         ++I
Sbjct: 798 RMSADEQIILTLSSNGYGKRTSSYEYRITGRGGKGIVAMVVNPRNGLLVASMPVEDGDEI 857

Query: 697 LLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMK 756
           +L T  GQ +R P+  IRV AGR + GV   +    +QV+S+  +   DA   E      
Sbjct: 858 MLVTNGGQLIRCPVEGIRV-AGRGTQGVIVFNTGADEQVVSVERITEEDAARGETEEGEP 916

Query: 757 HMSAQRRLISG 767
                      
Sbjct: 917 SSDPSTEPGEA 927


>gi|92117309|ref|YP_577038.1| DNA gyrase subunit A [Nitrobacter hamburgensis X14]
 gi|91800203|gb|ABE62578.1| DNA gyrase subunit A [Nitrobacter hamburgensis X14]
          Length = 913

 Score =  979 bits (2530), Expect = 0.0,   Method: Composition-based stats.
 Identities = 558/905 (61%), Positives = 685/905 (75%), Gaps = 4/905 (0%)

Query: 2   TEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMM 61
           TE   S +     GI  VSI +EM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+ M 
Sbjct: 4   TEDTKSGEPPAPSGIRPVSILEEMKRSYLDYAMSVIVARALPDARDGLKPVHRRILYAMY 63

Query: 62  QMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVD 121
           + G EWNK Y K AR  G+V+GKYHPHG+ ++YDAL RMAQ +S+R+ LI+GQGNFGSVD
Sbjct: 64  ENGFEWNKPYRKSARTVGDVIGKYHPHGDQSVYDALVRMAQGFSMRVPLIDGQGNFGSVD 123

Query: 122 GDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGG 181
           GD  AA RYTE RL K A  LLDD+ KDTVDF+PNYD S +EP VL A++PN+LVNG GG
Sbjct: 124 GDMAAAMRYTESRLTKIAQSLLDDIDKDTVDFQPNYDNSEKEPSVLPAKFPNLLVNGAGG 183

Query: 182 IAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAY 241
           IAVGMATNIP HNLGEV+D CVA+ID+P + +D L+ I+ GPDFPTG +ILGR GI++AY
Sbjct: 184 IAVGMATNIPPHNLGEVIDACVALIDDPALGIDDLINIVPGPDFPTGGIILGRQGIRSAY 243

Query: 242 ATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRD 301
             GRGSIV+RG   IE    DRE I+++EIPYQVNKA M+E+IAELVR+KRI  I+DLRD
Sbjct: 244 HLGRGSIVMRGKVAIEPARKDREAIIISEIPYQVNKATMVERIAELVRDKRIEGISDLRD 303

Query: 302 ESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAF 361
           ESDR G+RVV+ELKR A  +V+LNQLYRYT LQ+ F  NMVAL+  +P+   L  +L  F
Sbjct: 304 ESDRDGFRVVVELKRDAVPEVVLNQLYRYTPLQTNFGANMVALDAGRPQLMNLKDLLTLF 363

Query: 362 VAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRS 421
           +AFRE VV RRTK+LLNKARDRAH+LVGLAIAVAN+DE++R+IR SP+P TAR  LM R 
Sbjct: 364 IAFRERVVTRRTKFLLNKARDRAHILVGLAIAVANIDEIIRVIRESPDPATARDTLMSRD 423

Query: 422 WNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLG 481
           W A D+  +I LIDD  +    DGT  LS  Q +AIL+LRL RLT LGR++I  EL+ L 
Sbjct: 424 WPARDVAAMITLIDDPRHRTSPDGTARLSMEQAKAILDLRLQRLTALGREEISEELDKLA 483

Query: 482 IEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVT 541
           IEI + LDIL SR+R+  IIK EL +VK E  TPR+T I+E   ++EDED I REDMVVT
Sbjct: 484 IEIADYLDILRSRARVQAIIKTELGAVKAEFATPRKTVILEQEGEVEDEDLIQREDMVVT 543

Query: 542 VSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKE 601
           VSH GYVKRVPLS YRAQ+RGGKGRSG+  R+EDFV+ LF+ STHT VLFFSS G VYKE
Sbjct: 544 VSHAGYVKRVPLSTYRAQKRGGKGRSGMQTREEDFVSRLFVASTHTPVLFFSSRGQVYKE 603

Query: 602 KVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNK 661
           KVWRLP+ +P ARGKA+INIL L QGERITTIMP PEDESSW NL V+FAT  G VRRNK
Sbjct: 604 KVWRLPMAAPNARGKAMINILPLEQGERITTIMPLPEDESSWANLDVMFATTSGTVRRNK 663

Query: 662 LSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNS 721
           LSDF+ + RSG IAMKL   + I+ V+ CT+ +D+LLT   GQC+RFP S +RVF+GR S
Sbjct: 664 LSDFVDVRRSGIIAMKLGEGEAIVDVQICTERDDVLLTAGGGQCIRFPASDVRVFSGRTS 723

Query: 722 VGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGD----TEEITSLKN 777
           +GVRGI+LA+GD+VIS++I+ H DA   ER  Y+K   A RR  +G+     E       
Sbjct: 724 MGVRGIALAEGDRVISLSILHHFDATPAERAAYLKQSGAIRRAATGEDIEPEEATPEADE 783

Query: 778 DSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINE 837
            +  + ++ E R  E+   EQF+LTV+ +G+GKR+SS++FR+S R GKGIRA+D +K+ E
Sbjct: 784 AAHTDLSLPEGRYVEMGAAEQFVLTVTTQGYGKRSSSFEFRVSGRGGKGIRASDPTKLGE 843

Query: 838 IGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERI 897
           IG LVA FPV  +DQI+LVSD G LIRVPV  IRI SRA+KGV +F+TA+ E VVSVE I
Sbjct: 844 IGHLVAGFPVEMSDQIMLVSDGGQLIRVPVEGIRITSRASKGVRVFTTAEGEHVVSVEHI 903

Query: 898 RESEI 902
           RE   
Sbjct: 904 REENE 908



 Score = 64.0 bits (154), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/214 (14%), Positives = 67/214 (31%), Gaps = 58/214 (27%)

Query: 746 ADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSE 805
           ADY + +     + A  +   G  +   +    + +     E   ++L  +E  ++TVS 
Sbjct: 487 ADYLDILRSRARVQAIIKTELGAVKAEFATPRKTVILEQEGEVEDEDLIQREDMVVTVSH 546

Query: 806 KGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGAL------------------------ 841
            G+ KR     +R   R GKG       + + +  L                        
Sbjct: 547 AGYVKRVPLSTYRAQKRGGKGRSGMQTREEDFVSRLFVASTHTPVLFFSSRGQVYKEKVW 606

Query: 842 --------------VAVFPVNDND------------------QIILVSDKGTLIRVPVNE 869
                         + + P+   +                   ++  +  GT+ R  +++
Sbjct: 607 RLPMAAPNARGKAMINILPLEQGERITTIMPLPEDESSWANLDVMFATTSGTVRRNKLSD 666

Query: 870 IRIASRATKGVVIFSTAKDERVVSVERIRESEIV 903
                R+  G++     + E +V V+   E + V
Sbjct: 667 FVDVRRS--GIIAMKLGEGEAIVDVQICTERDDV 698



 Score = 54.4 bits (129), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 47/282 (16%), Positives = 91/282 (32%), Gaps = 28/282 (9%)

Query: 486 ECLDILSSRSRLLGIIKQELLSVK-DELDTPRRTRIVEGLLDMEDEDCI----VREDMVV 540
           E     ++   +       +   K  +    RR+ I+   L   +           D V+
Sbjct: 640 EDESSWANLDVMFATTSGTVRRNKLSDFVDVRRSGIIAMKLGEGEAIVDVQICTERDDVL 699

Query: 541 TVSHLGYVKRVPLSVYR------AQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSS 594
             +  G   R P S  R      +    G   +         +   F  +      +   
Sbjct: 700 LTAGGGQCIRFPASDVRVFSGRTSMGVRGIALAEGDRVISLSILHHFDATPAERAAYLKQ 759

Query: 595 LGFVYKEKVWR--LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
            G + +        P  +     +A    LSL +G  +                +V+  T
Sbjct: 760 SGAIRRAATGEDIEPEEATPEADEAAHTDLSLPEGRYVE---------MGAAEQFVLTVT 810

Query: 653 KHGNVRRNKLSDF-IQINRSGKIAM----KLDSRDEILSVETCTQENDILLTTKLGQCVR 707
             G  +R+   +F +       I      KL     +++       + I+L +  GQ +R
Sbjct: 811 TQGYGKRSSSFEFRVSGRGGKGIRASDPTKLGEIGHLVAGFPVEMSDQIMLVSDGGQLIR 870

Query: 708 FPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYD 749
            P+  IR    R S GVR  + A+G+ V+S+  +   + + +
Sbjct: 871 VPVEGIR-ITSRASKGVRVFTTAEGEHVVSVEHIREENENGN 911


>gi|170748569|ref|YP_001754829.1| DNA gyrase, A subunit [Methylobacterium radiotolerans JCM 2831]
 gi|170655091|gb|ACB24146.1| DNA gyrase, A subunit [Methylobacterium radiotolerans JCM 2831]
          Length = 910

 Score =  977 bits (2525), Expect = 0.0,   Method: Composition-based stats.
 Identities = 555/913 (60%), Positives = 683/913 (74%), Gaps = 8/913 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           M E+  +        I  VSITDEM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+  
Sbjct: 1   MAENDPTGAAPPASDIRPVSITDEMRRSYLDYAMSVIVSRALPDARDGLKPVHRRILYSA 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            + G    +KYVK ARI G+V+G YHPHG+ +IYDAL RMAQD+S+RL+LI+GQGNFGSV
Sbjct: 61  FESGHLPERKYVKSARIVGDVIGLYHPHGDQSIYDALVRMAQDFSMRLMLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTE RL K A  LL D+ K+TVDF PNYD S +EP VL AR+PN+LVNG G
Sbjct: 121 DGDPPAAMRYTESRLAKPATALLTDIDKNTVDFGPNYDESREEPTVLPARFPNLLVNGAG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGE++D CVA+ID+P + ++ L EI+ GPDFPTG +ILGR G + A
Sbjct: 181 GIAVGMATNIPPHNLGELIDACVALIDDPGLTIEQLTEIVPGPDFPTGGMILGRAGTRQA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           YATGRGS+++R  SH+E+   +RE ++ TEIPYQVNKA ++EKIAELV+EKR+  I+DLR
Sbjct: 241 YATGRGSVIMRAKSHVEELRKEREALIFTEIPYQVNKATLVEKIAELVKEKRVEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR G R+V+E+KR A ADV+LNQLYR+T LQS F  NMVALNG +PE   L  +L+A
Sbjct: 301 DESDRSGMRIVVEIKRDAMADVVLNQLYRFTPLQSSFGCNMVALNGGRPELMNLKDLLQA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV FREEVV RRTK+LL KAR+RAHVL GLAIAVAN+DEV+R+IR SP+P  AR  LM R
Sbjct: 361 FVDFREEVVSRRTKFLLGKARERAHVLCGLAIAVANIDEVIRLIRTSPDPNAAREALMGR 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A DI  LI L+DD  + +  DGT  LSE Q RAIL+LRL RLT LGRD++ +EL +L
Sbjct: 421 DWPAHDIAPLIALVDDPRHRVAEDGTYRLSETQARAILDLRLQRLTALGRDEVGDELKTL 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
             EI + LDIL SR+R+ GI+K EL  V+++  TPR+T IV+    +EDED I REDMVV
Sbjct: 481 ADEIADYLDILRSRARIQGIVKGELAEVREQFATPRKTEIVDFDGSVEDEDLIAREDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSH GYVKRVPLS YRAQRRGGKGRSG+  RDEDFVT LF+ +THT VLFFSS G  YK
Sbjct: 541 TVSHAGYVKRVPLSTYRAQRRGGKGRSGMATRDEDFVTRLFVANTHTPVLFFSSQGQAYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSL-NQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           EKVWRLP+ +P ARGKAL+NIL L +  ERITTIMP PEDE+SW  L V+FAT  GNVRR
Sbjct: 601 EKVWRLPMAAPNARGKALVNILQLQDTSERITTIMPLPEDEASWETLDVMFATARGNVRR 660

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           NKLSDF  +NR+GKIAMKLD  D I+ VE C  + ++LLTT LGQC+RFP+  +RVF GR
Sbjct: 661 NKLSDFTTVNRNGKIAMKLDPGDHIVHVEICRPDQNVLLTTALGQCIRFPVEDVRVFKGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           +S GVRGI L K D+VISM I+   DA  +ER  Y+K    +R +     E   +   D 
Sbjct: 721 DSTGVRGILLGKDDKVISMTILNAFDATAEERAGYLK---MRRAVTGESEENGDAEAEDG 777

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           +    IS +R  E+   EQ++LT+SE+GFGKR+SS+++R S R GKGI A  V+  N  G
Sbjct: 778 AEAAAISLDRYNEMGAAEQYVLTLSERGFGKRSSSFEYRTSGRGGKGITAMRVNARN--G 835

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
           +LVA FPV  +DQI+LV+D G LIRVPV++IRI  RA++GV +F+TAKDE+VVSVE I  
Sbjct: 836 SLVASFPVEASDQIMLVTDGGQLIRVPVDDIRIVGRASQGVTVFNTAKDEKVVSVEHIEG 895

Query: 900 SEIVDEA--ESTE 910
            +   EA  E  E
Sbjct: 896 EDEGAEAGPEGGE 908


>gi|163760265|ref|ZP_02167348.1| DNA gyrase subunit A [Hoeflea phototrophica DFL-43]
 gi|162282664|gb|EDQ32952.1| DNA gyrase subunit A [Hoeflea phototrophica DFL-43]
          Length = 945

 Score =  976 bits (2523), Expect = 0.0,   Method: Composition-based stats.
 Identities = 595/901 (66%), Positives = 717/901 (79%), Gaps = 5/901 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+    S      GI  VSI +EMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL  M
Sbjct: 1   MTDQKTPS-GPITPGIEPVSIIEEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILHAM 59

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            + G  WN+KYVK +RI G+VMGKYHPHG+ +IYDA+ RMAQ WS+  +LI+GQGNFGS+
Sbjct: 60  HEGGYHWNRKYVKSSRIVGDVMGKYHPHGDQSIYDAMVRMAQHWSMGAMLIDGQGNFGSI 119

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTE RL K AH +++D+ KDTVDF+  YD S +EP VL AR+PN+LVNG G
Sbjct: 120 DGDPPAAMRYTESRLAKLAHEMIEDIDKDTVDFQETYDSSGREPKVLPARFPNLLVNGAG 179

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNL EVV+GC+A++DNP IDL  LM+II GPDFPT  +ILG+ GI+ A
Sbjct: 180 GIAVGMATNIPPHNLVEVVNGCMAIMDNPSIDLLELMQIIPGPDFPTSGIILGQAGIRQA 239

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           + TGRGS+++RG  H+E    DRE I++TE+PYQVNK++M+EK+AELVR+KRI  I+DLR
Sbjct: 240 FETGRGSVIMRGKVHVEPMRNDREAIIITEVPYQVNKSSMIEKMAELVRDKRIEGISDLR 299

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVVIELKR A+ADVI+NQLYRYT LQS F VNMVALNG KPE   LI +LKA
Sbjct: 300 DESDRQGYRVVIELKRDANADVIINQLYRYTPLQSSFGVNMVALNGGKPELMNLIDMLKA 359

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FRE+V+ RRTKYLL KAR+RAHVLVGLAIAVAN+DEV+ +IR +P+P TAR +LM R
Sbjct: 360 FVSFREDVITRRTKYLLRKARERAHVLVGLAIAVANIDEVIALIRKAPDPATAREQLMTR 419

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D++ LI LIDD  + I  DGT  LSE Q RAILELRLARLT LGRD+I +EL  +
Sbjct: 420 RWPAMDVEVLIRLIDDPRHRINEDGTYNLSEEQARAILELRLARLTALGRDEIGDELGKI 479

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EIK+ L+IL SR R+  I+K EL++V+DE   PRRT I EG  DM+DED I REDMVV
Sbjct: 480 GEEIKDFLEILGSRIRVQQIVKDELIAVRDEFGVPRRTVIAEGGPDMDDEDLIAREDMVV 539

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSH GY+KRVPL+ YRAQRRGGKGRSG+  +DEDFVT LF+ +THT VLFFSS G VYK
Sbjct: 540 TVSHAGYIKRVPLATYRAQRRGGKGRSGMATKDEDFVTRLFVANTHTPVLFFSSRGIVYK 599

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIG+P +RGKALIN+L L +GERIT+IMP PEDE+S   L V+F+TK G VRRN
Sbjct: 600 EKVWRLPIGTPTSRGKALINMLPLEKGERITSIMPLPEDETSCGELDVMFSTKRGTVRRN 659

Query: 661 KLSDFIQINRSGKIAMKLD-SRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDF+Q+NR+GKIAMKLD   DEIL+VETC + +D+LLTT LGQC+RF +  +RVFAGR
Sbjct: 660 KLSDFVQVNRNGKIAMKLDSDGDEILNVETCNELDDVLLTTALGQCIRFSVDDVRVFAGR 719

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRL---ISGDTEEITSLK 776
           NSVGVRGI+L +GD +ISM IV H DA+  ER  Y+K   A+RR      GD EE+  + 
Sbjct: 720 NSVGVRGINLGQGDTIISMTIVHHVDAEASERAAYLKRAMAERRAAIGEEGDVEEVALVG 779

Query: 777 NDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKIN 836
            D+  +G +S+ER  ELK +EQFILTVSEKG+GKR+SSY+FRIS R GKGIRATD SK  
Sbjct: 780 EDAVEDGELSDERYAELKAREQFILTVSEKGYGKRSSSYEFRISGRGGKGIRATDTSKTG 839

Query: 837 EIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVER 896
           EIG L+A FPV   DQI++VSD G +IRVPV  IR+ASRATKGV IF+TAKDERVVSV+R
Sbjct: 840 EIGPLIAAFPVEPGDQIMMVSDGGQVIRVPVGGIRMASRATKGVTIFNTAKDERVVSVDR 899

Query: 897 I 897
           I
Sbjct: 900 I 900



 Score = 54.8 bits (130), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 40/256 (15%), Positives = 87/256 (33%), Gaps = 10/256 (3%)

Query: 537 DMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLG 596
           D V+  + LG   R  +   R     G+   GV   +      +  ++    V   +S  
Sbjct: 694 DDVLLTTALGQCIRFSVDDVRV--FAGRNSVGVRGINLGQGDTIISMTIVHHVDAEASER 751

Query: 597 FVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGN 656
             Y ++       +    G      L          +      E      +++  ++ G 
Sbjct: 752 AAYLKRAMAERRAAIGEEGDVEEVALVGEDAVEDGELSDERYAELKAREQFILTVSEKGY 811

Query: 657 VRRNKLSDFIQINRSGKIAMKLDSRDEI------LSVETCTQENDILLTTKLGQCVRFPI 710
            +R+   +F +I+  G   ++     +       ++       + I++ +  GQ +R P+
Sbjct: 812 GKRSSSYEF-RISGRGGKGIRATDTSKTGEIGPLIAAFPVEPGDQIMMVSDGGQVIRVPV 870

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTE 770
             IR  A R + GV   + AK ++V+S+  +   ++D +                + D  
Sbjct: 871 GGIR-MASRATKGVTIFNTAKDERVVSVDRINEPESDEELEEGVEGETVEGVADAAPDAN 929

Query: 771 EITSLKNDSSVEGNIS 786
              +    S+ E   S
Sbjct: 930 GTPAPDASSAGEEPQS 945


>gi|91977067|ref|YP_569726.1| DNA gyrase subunit A [Rhodopseudomonas palustris BisB5]
 gi|91683523|gb|ABE39825.1| DNA gyrase subunit A [Rhodopseudomonas palustris BisB5]
          Length = 917

 Score =  976 bits (2522), Expect = 0.0,   Method: Composition-based stats.
 Identities = 553/916 (60%), Positives = 685/916 (74%), Gaps = 12/916 (1%)

Query: 1   MTE--HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILF 58
           M++       + +    I  +SI DEM+ SYL YA++VI+ RA+PD RDGLKPVHRRILF
Sbjct: 1   MSDKDDEKPGEPKAPSDIRPISILDEMKRSYLDYAMSVIVARALPDARDGLKPVHRRILF 60

Query: 59  GMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFG 118
           GM + G EWNK Y K AR  G+V+GKYHPHG+ ++YDA+ RMAQD+S+R+ LI+GQGNFG
Sbjct: 61  GMYENGFEWNKPYRKSARTVGDVIGKYHPHGDQSVYDAMVRMAQDFSMRVPLIDGQGNFG 120

Query: 119 SVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNG 178
           SVDGD PAA RYTE RL K A  LLDDL KDTVD++ NYDGSF+EP VL A++PN+LVNG
Sbjct: 121 SVDGDAPAAMRYTESRLTKIAQLLLDDLDKDTVDYQDNYDGSFREPRVLPAKFPNLLVNG 180

Query: 179 GGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIK 238
            GGIAVGMATNIP HNLGEV+D C+A+I++P + +D L+ II GPDFPTG +ILGR GI+
Sbjct: 181 AGGIAVGMATNIPPHNLGEVIDACIALIEDPALGIDDLINIIPGPDFPTGGIILGRAGIR 240

Query: 239 NAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIAD 298
            AY TGRGSIV+RG   IE    DRE I+V+EIPYQVNKA M+E+IAELVREK+I  I+D
Sbjct: 241 LAYHTGRGSIVMRGKVEIETVRKDREAIIVSEIPYQVNKATMVERIAELVREKKIEGISD 300

Query: 299 LRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGIL 358
           LRDESDR G+RVVIEL+R A  DV+LNQLYR+T LQ+ F  NMVAL+  +P    L  +L
Sbjct: 301 LRDESDRDGFRVVIELRRDAVPDVVLNQLYRFTPLQTNFGANMVALDAGRPHLMNLRDLL 360

Query: 359 KAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELM 418
             FVAFRE+VV RRTKYLL KARDRAH+LVGLAIAVAN+DE++R+IR SP+P TAR  LM
Sbjct: 361 TLFVAFREQVVTRRTKYLLGKARDRAHILVGLAIAVANIDEMIRVIRNSPDPNTARETLM 420

Query: 419 QRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELN 478
            R W A+D+  +I LIDD  + +  DGT  LS  Q +AIL+LRL RLT LGR++I  EL+
Sbjct: 421 SRDWPAADVAAMITLIDDPRHKLNEDGTARLSFEQAKAILDLRLQRLTALGREEISEELD 480

Query: 479 SLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDM 538
            L +EI + LDIL SR+R+  I+K EL++VK E  TPR+T I+E   ++EDED I REDM
Sbjct: 481 KLALEIADYLDILRSRARVQTIVKDELIAVKTEFATPRKTMIIEQEGEVEDEDLIQREDM 540

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           VVTVSH GYVKRVPLS YRAQRRGGKGRSG+  R+EDFV+ LF+ STHT VLFFSS G V
Sbjct: 541 VVTVSHAGYVKRVPLSTYRAQRRGGKGRSGMATREEDFVSRLFVASTHTPVLFFSSRGQV 600

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVR 658
           YKEKVWRLPI  P  RGKALINIL L QGERITTIMP PEDE SW  L V+FAT  GNVR
Sbjct: 601 YKEKVWRLPIAPPNGRGKALINILPLEQGERITTIMPLPEDEQSWAALDVMFATTGGNVR 660

Query: 659 RNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAG 718
           RNKLSDF+ + RSG IAMKLD  + I+ V+ CT+ +D+LLT   GQC+RFP+  +RVF G
Sbjct: 661 RNKLSDFVDVRRSGIIAMKLDDGEAIVDVQICTERDDVLLTAAGGQCIRFPVPDVRVFTG 720

Query: 719 RNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKND 778
           R S+GVRGI+LA GD+VIS+ I+ H +A   ER  Y+K   A RR   G+  +++ +   
Sbjct: 721 RTSMGVRGIALASGDKVISLCILRHFEATPAERTTYLKQSGAFRRAAIGEDTDVSEVSEV 780

Query: 779 SSVEG--------NISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
           ++            +S +R  E+   EQF+LT+SE G+GKRTSS+++R + R GKGI A 
Sbjct: 781 TAEAESEEAEGLTALSSDRYAEMSASEQFVLTISENGYGKRTSSFEYRTTGRGGKGIGAM 840

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
            V+  N  G LVA FPV D+DQI+LV+D G LIR PV  IR+A R+T+GV++F TA DE+
Sbjct: 841 SVNNRN--GKLVASFPVEDSDQIMLVTDNGQLIRCPVEGIRVAGRSTQGVIVFDTADDEK 898

Query: 891 VVSVERIRESEIVDEA 906
           VVSVE I E+E  +  
Sbjct: 899 VVSVEHIPEAEEAENG 914


>gi|86749993|ref|YP_486489.1| DNA gyrase subunit A [Rhodopseudomonas palustris HaA2]
 gi|86573021|gb|ABD07578.1| DNA gyrase subunit A [Rhodopseudomonas palustris HaA2]
          Length = 925

 Score =  974 bits (2518), Expect = 0.0,   Method: Composition-based stats.
 Identities = 556/922 (60%), Positives = 686/922 (74%), Gaps = 18/922 (1%)

Query: 1   MTE--HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILF 58
           M++       + +    I  VSI DEM+ SYL YA++VI+ RA+PD RDGLKPVHRRILF
Sbjct: 1   MSDKDDEKPGEPQAPSDIRPVSILDEMKRSYLDYAMSVIVARALPDARDGLKPVHRRILF 60

Query: 59  GMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFG 118
           GM + G EWNK Y K AR  G+V+GKYHPHG+ ++YDA+ RMAQD+S+R+ LI+GQGNFG
Sbjct: 61  GMYENGFEWNKPYRKSARTVGDVIGKYHPHGDQSVYDAMVRMAQDFSMRVPLIDGQGNFG 120

Query: 119 SVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNG 178
           SVDGD PAA RYTE RL K A  LLDDL KDTVD++ NYDGSF EP VL A++PN+LVNG
Sbjct: 121 SVDGDAPAAMRYTESRLTKIAQLLLDDLDKDTVDYQDNYDGSFNEPQVLPAKFPNLLVNG 180

Query: 179 GGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIK 238
            GGIAVGMATNIP HNLGEV+D C+A+ID+P + +D L  II GPDFPTG +ILGR GI+
Sbjct: 181 AGGIAVGMATNIPPHNLGEVIDACIALIDDPALSIDDLNVIIPGPDFPTGGIILGRAGIR 240

Query: 239 NAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIAD 298
            AY TGRGSIV+RG   IE    DRE I+++EIPYQVNKA M+E+IA+LVREK+I  I+D
Sbjct: 241 LAYHTGRGSIVMRGKVEIETVRKDREAIIISEIPYQVNKATMVERIADLVREKKIEGISD 300

Query: 299 LRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGIL 358
           LRDESDR G+RVVIEL+R A  DV+LNQLYR+T LQ+ F  NMVAL+  +P+   L  +L
Sbjct: 301 LRDESDRDGFRVVIELRRDAVPDVVLNQLYRFTPLQTNFGANMVALDAGRPQLMNLKDLL 360

Query: 359 KAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELM 418
             FVAFRE+VV RRTKYLLNKARDRAH+LVGLAIAVAN+DE++R+IR SP+P TAR  LM
Sbjct: 361 TLFVAFREQVVTRRTKYLLNKARDRAHILVGLAIAVANIDEIIRVIRNSPDPNTARETLM 420

Query: 419 QRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELN 478
            R W A+D+  +I LIDD  + +  DGT  LS  Q +AIL+LRL RLT LGR++I  EL+
Sbjct: 421 SRDWPAADVAAMITLIDDPRHKLNEDGTARLSFEQAKAILDLRLQRLTALGREEIAEELD 480

Query: 479 SLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDM 538
            L +EI + LDIL SR+R+  I+K EL++VK E  TPR+T I+E   ++EDED I REDM
Sbjct: 481 KLALEIADYLDILRSRARVQTIVKDELIAVKTEFATPRKTVIIEQEGEVEDEDLIQREDM 540

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           VVTVSH GYVKRVPLS YRAQRRGGKGRSG+  R+EDFV+ LF+ STHT VLFFSS G V
Sbjct: 541 VVTVSHAGYVKRVPLSTYRAQRRGGKGRSGMATREEDFVSRLFVASTHTPVLFFSSRGQV 600

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVR 658
           YKEKVWRLPI  P  RGKALINIL L QGERITTIMP PEDE SW  L V+FAT  GNVR
Sbjct: 601 YKEKVWRLPIAPPNGRGKALINILPLEQGERITTIMPLPEDEQSWAALDVMFATTGGNVR 660

Query: 659 RNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISA------ 712
           RNKLSDF+ + RSG IAMKLD  + I+ V+ CT+ +D+LLTT  GQC+RFP+S       
Sbjct: 661 RNKLSDFVDVRRSGIIAMKLDDGEAIVDVQICTERDDVLLTTANGQCIRFPVSDQRDGKE 720

Query: 713 --IRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTE 770
             +RVF GR+S+GVRGI+LA  D+VIS++I+ H DA  +ER  Y++  +A RR    +  
Sbjct: 721 FGVRVFQGRSSMGVRGIALAPEDKVISLSILRHLDAGSEERAAYLRRANAVRRGGVEERA 780

Query: 771 EITSLKNDSSVEG------NISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSG 824
            +         E        + E+R  E+   EQF+LT+SE G+GKRTSS+++R +NR G
Sbjct: 781 AVEDEAAGVEGEDASVGAIELGEQRYVEMSASEQFVLTISENGYGKRTSSFEYRTTNRGG 840

Query: 825 KGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFS 884
           KGI A  V+  N  G LVA FPV D+DQI+LV+D G LIR PV  IR+A R+T+GV++F 
Sbjct: 841 KGIVAMSVNNRN--GKLVASFPVEDSDQIMLVTDNGQLIRCPVEGIRVAGRSTQGVIVFD 898

Query: 885 TAKDERVVSVERIRESEIVDEA 906
           TA DE+VVSVE I E+E  +  
Sbjct: 899 TADDEKVVSVEHIPEAEETENG 920


>gi|90424083|ref|YP_532453.1| DNA gyrase subunit A [Rhodopseudomonas palustris BisB18]
 gi|90106097|gb|ABD88134.1| DNA gyrase subunit A [Rhodopseudomonas palustris BisB18]
          Length = 927

 Score =  973 bits (2515), Expect = 0.0,   Method: Composition-based stats.
 Identities = 556/910 (61%), Positives = 681/910 (74%), Gaps = 13/910 (1%)

Query: 2   TEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMM 61
           T+     +      I  VSI DEM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+ M 
Sbjct: 4   TDDNKPGEPPAPSDIRPVSILDEMKRSYLDYAMSVIVARALPDARDGLKPVHRRILYAMY 63

Query: 62  QMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVD 121
           + G EWNK Y K AR  G+V+GKYHPHG+ ++YDA+ RMAQD+S+R+ LI+GQGNFGSVD
Sbjct: 64  ENGFEWNKPYRKSARTVGDVIGKYHPHGDQSVYDAMVRMAQDFSMRVPLIDGQGNFGSVD 123

Query: 122 GDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGG 181
           GD  AA RYTE RL K A  LLDDL KDTVD++ NYDGSF+EP VL A++PN+LVNG GG
Sbjct: 124 GDSAAAMRYTESRLTKIAQLLLDDLDKDTVDYQDNYDGSFREPRVLPAKFPNLLVNGAGG 183

Query: 182 IAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAY 241
           IAVGMATNIP HNLGEV+D CVA+ID+P + +D L +I+ GPDFPTG +ILGR GI+ AY
Sbjct: 184 IAVGMATNIPPHNLGEVIDACVALIDDPALSIDDLTKIVPGPDFPTGGIILGRAGIRLAY 243

Query: 242 ATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRD 301
            TGRGSIV+RG   IE T  DRE I+++EIPYQVNKA M+E+IAELVREK+I  I+DLRD
Sbjct: 244 HTGRGSIVMRGKVAIEPTRKDREAIIISEIPYQVNKATMVERIAELVREKKIEGISDLRD 303

Query: 302 ESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAF 361
           ESDR G+RVVIEL+R A  DV+LNQLYR+T LQ+ F  NMVAL+  +P+   L  +L+ F
Sbjct: 304 ESDRDGFRVVIELRRDAVPDVVLNQLYRFTPLQTNFGANMVALDAGRPQLMNLKDLLRLF 363

Query: 362 VAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRS 421
           VAFRE+VV RRTK+LLNKARDRAHVLVGLAIAVAN+DE++R+IR SP+P TAR  LM R 
Sbjct: 364 VAFREQVVTRRTKFLLNKARDRAHVLVGLAIAVANIDEIIRVIRTSPDPATARDTLMARD 423

Query: 422 WNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLG 481
           W A D+  +I LIDD  + + +DGT  LS  Q +AIL+LRLARLT LGR++I  EL+ L 
Sbjct: 424 WEAKDVAAMITLIDDPRHRLNADGTARLSFEQAKAILDLRLARLTALGREEISEELDKLA 483

Query: 482 IEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVT 541
           IEI + L+IL SR+R+  IIK+EL +VK E  TPR+T I+E   ++EDED I REDMVVT
Sbjct: 484 IEIADYLEILRSRARVQTIIKEELAAVKAEFATPRKTTIIEQEGEVEDEDLIQREDMVVT 543

Query: 542 VSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKE 601
           VSH GYVKRVPLS YRAQRRGGKGRSG+  R+EDFV+ LF+ STHT VLFFSS G VYKE
Sbjct: 544 VSHAGYVKRVPLSTYRAQRRGGKGRSGMQTREEDFVSRLFVASTHTPVLFFSSRGQVYKE 603

Query: 602 KVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNK 661
           KVWRLPI  P  RGKALINIL L QGERITTIMP PEDESSW  L V+FAT  G VRRNK
Sbjct: 604 KVWRLPIAPPNGRGKALINILPLEQGERITTIMPLPEDESSWAELDVMFATTRGTVRRNK 663

Query: 662 LSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNS 721
           LSDF+ + RSG IAMKLD  + I+ V+ CT  +D+LLT   GQC+RF ++ +RVF  R S
Sbjct: 664 LSDFVDVRRSGIIAMKLDEGEAIVDVQICTDRDDVLLTAAGGQCIRFAVTDVRVFQSRAS 723

Query: 722 VGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEE---------- 771
           +GVRG++LA GDQVIS+ I+ H DA+  ER  Y+K   A RR  +G+  E          
Sbjct: 724 MGVRGMALANGDQVISLTILRHFDANPAERSTYLKQSGAIRRAATGEEAEAVEGSELAAE 783

Query: 772 -ITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
              +   +     ++S +R  E+   EQF+LT+SE GFGKRTSS+++R + R GKGI A 
Sbjct: 784 VADAEPEEVDAIASLSPDRYAEMSANEQFVLTLSENGFGKRTSSFEYRTTGRGGKGIVAM 843

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
            V+  N  G LVA FPV + DQI+LV+DKG LIR PV  IRI  R+T+GV +F+TA+DE 
Sbjct: 844 AVNARN--GKLVASFPVEEEDQIMLVTDKGQLIRCPVGGIRIVGRSTQGVTVFNTAEDEH 901

Query: 891 VVSVERIRES 900
           VVSVERI E 
Sbjct: 902 VVSVERIGED 911



 Score = 97.2 bits (240), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 45/216 (20%), Positives = 79/216 (36%), Gaps = 13/216 (6%)

Query: 693 ENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAI------VLHADA 746
           E+ ++  +  G   R P+S  R    R   G  G+   + D V  + +      VL   +
Sbjct: 538 EDMVVTVSHAGYVKRVPLSTYRA-QRRGGKGRSGMQTREEDFVSRLFVASTHTPVLFFSS 596

Query: 747 DYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEK 806
                   +  +        G                 I      E    E  ++  + +
Sbjct: 597 RGQVYKEKVWRLPIAPPNGRGKALINILPLEQGERITTIMPLPEDESSWAELDVMFATTR 656

Query: 807 GFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVP 866
           G  +R    DF    R   GI A  + +     A+V V    D D ++L +  G  IR  
Sbjct: 657 GTVRRNKLSDFVDVRR--SGIIAMKLDEGE---AIVDVQICTDRDDVLLTAAGGQCIRFA 711

Query: 867 VNEIRI-ASRATKGVVIFSTAKDERVVSVERIRESE 901
           V ++R+  SRA+ GV   + A  ++V+S+  +R  +
Sbjct: 712 VTDVRVFQSRASMGVRGMALANGDQVISLTILRHFD 747



 Score = 64.4 bits (155), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 31/214 (14%), Positives = 67/214 (31%), Gaps = 58/214 (27%)

Query: 746 ADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSE 805
           ADY E +     +    +      +   +    +++     E   ++L  +E  ++TVS 
Sbjct: 487 ADYLEILRSRARVQTIIKEELAAVKAEFATPRKTTIIEQEGEVEDEDLIQREDMVVTVSH 546

Query: 806 KGFGKRTSSYDFRISNRSGKGIRATDVSKI------------------------------ 835
            G+ KR     +R   R GKG       +                               
Sbjct: 547 AGYVKRVPLSTYRAQRRGGKGRSGMQTREEDFVSRLFVASTHTPVLFFSSRGQVYKEKVW 606

Query: 836 -------NEIGA-LVAVFPVNDND------------------QIILVSDKGTLIRVPVNE 869
                  N  G  L+ + P+   +                   ++  + +GT+ R  +++
Sbjct: 607 RLPIAPPNGRGKALINILPLEQGERITTIMPLPEDESSWAELDVMFATTRGTVRRNKLSD 666

Query: 870 IRIASRATKGVVIFSTAKDERVVSVERIRESEIV 903
                R+  G++     + E +V V+   + + V
Sbjct: 667 FVDVRRS--GIIAMKLDEGEAIVDVQICTDRDDV 698


>gi|315122780|ref|YP_004063269.1| DNA gyrase subunit A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496182|gb|ADR52781.1| DNA gyrase subunit A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 909

 Score =  973 bits (2515), Expect = 0.0,   Method: Composition-based stats.
 Identities = 793/909 (87%), Positives = 857/909 (94%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MTEHI+ +DEE EKGITSVSI +EMQNSYLTYAINVILGRAIPDLRDGLK VHRRILFGM
Sbjct: 1   MTEHIVPNDEEGEKGITSVSIVEEMQNSYLTYAINVILGRAIPDLRDGLKSVHRRILFGM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
           MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS+
Sbjct: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSI 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCA++PN+LVNG G
Sbjct: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCAKFPNLLVNGAG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIPTHNLGEV++GC+A+IDNPDIDLD +M+II GPDFPTGA+ILGR+GI++A
Sbjct: 181 GIAVGMATNIPTHNLGEVIEGCIALIDNPDIDLDDMMKIILGPDFPTGAIILGRSGIRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           YATGRGSIVIRGV+HIEKT GDRE+I+VTEIPYQVNK+AMLEKIAELVREKRIVDI+DLR
Sbjct: 241 YATGRGSIVIRGVTHIEKTEGDREKIIVTEIPYQVNKSAMLEKIAELVREKRIVDISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLI ILK 
Sbjct: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIEILKN 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           F+AFREEVV RRTKYLLNKARDRAHVLVGLAIAV+NLDEVVRIIRFSPNPE+ARRELMQR
Sbjct: 361 FIAFREEVVGRRTKYLLNKARDRAHVLVGLAIAVSNLDEVVRIIRFSPNPESARRELMQR 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
           +WNA DIKDLIDLIDDSSYTI SDG MYLSEVQTRAILELRLARLTGLGRDDIR+ELNSL
Sbjct: 421 NWNAVDIKDLIDLIDDSSYTINSDGKMYLSEVQTRAILELRLARLTGLGRDDIRDELNSL 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G EIK+CL+ILSSRSRLL IIKQEL  +KDELDTPRRT IV+GLLDMEDEDCIVREDMVV
Sbjct: 481 GTEIKDCLEILSSRSRLLNIIKQELKFIKDELDTPRRTEIVDGLLDMEDEDCIVREDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSH GYVKRVPLS+YRAQRRGGKGRSGVV R+EDFVTDLFIV+THT VLFFSSLGFVYK
Sbjct: 541 TVSHFGYVKRVPLSLYRAQRRGGKGRSGVVTRNEDFVTDLFIVNTHTPVLFFSSLGFVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLPIGSPQ+RGKALINILSL QGERITTIMP PEDESS ++LYVVFATK GNVRRN
Sbjct: 601 EKVWRLPIGSPQSRGKALINILSLQQGERITTIMPLPEDESSCSDLYVVFATKLGNVRRN 660

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
           KLSDF+Q+NRSGKIAMKLD  DEILSVETC + ND+LLTTKLGQC+RF I+ +RVF+GRN
Sbjct: 661 KLSDFVQVNRSGKIAMKLDEGDEILSVETCMEGNDVLLTTKLGQCIRFAITDVRVFSGRN 720

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSS 780
           SVGVRGI LA+ DQVISMAIVLHADADYDER+CYMK+M++ RRLI+ D +E   LKNDSS
Sbjct: 721 SVGVRGIVLAEDDQVISMAIVLHADADYDERVCYMKYMASHRRLIASDIDEGGVLKNDSS 780

Query: 781 VEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGA 840
           +EG ISEERC+ELK KEQFILTVSEKGFGKRTSSYDFRIS+R GKGI ATD SK++EIG 
Sbjct: 781 IEGKISEERCKELKSKEQFILTVSEKGFGKRTSSYDFRISSRGGKGILATDTSKMDEIGP 840

Query: 841 LVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900
           L++ FPVND DQIILVSDKGTLIRVPVN+IRIASR+TKGVVIFSTAKDERVVSVERI ES
Sbjct: 841 LISAFPVNDKDQIILVSDKGTLIRVPVNDIRIASRSTKGVVIFSTAKDERVVSVERISES 900

Query: 901 EIVDEAEST 909
           +I+D +E  
Sbjct: 901 DIIDVSEEE 909


>gi|163853963|ref|YP_001642006.1| DNA gyrase, A subunit [Methylobacterium extorquens PA1]
 gi|218532904|ref|YP_002423720.1| DNA gyrase subunit alpha [Methylobacterium chloromethanicum CM4]
 gi|240141417|ref|YP_002965897.1| DNA gyrase, subunit A (type II topoisomerase) [Methylobacterium
           extorquens AM1]
 gi|254563932|ref|YP_003071027.1| DNA gyrase subunit A [Methylobacterium extorquens DM4]
 gi|163665568|gb|ABY32935.1| DNA gyrase, A subunit [Methylobacterium extorquens PA1]
 gi|218525207|gb|ACK85792.1| DNA gyrase, A subunit [Methylobacterium chloromethanicum CM4]
 gi|240011394|gb|ACS42620.1| DNA gyrase, subunit A (type II topoisomerase) [Methylobacterium
           extorquens AM1]
 gi|254271210|emb|CAX27222.1| DNA gyrase, subunit A (type II topoisomerase) [Methylobacterium
           extorquens DM4]
          Length = 911

 Score =  972 bits (2513), Expect = 0.0,   Method: Composition-based stats.
 Identities = 553/901 (61%), Positives = 674/901 (74%), Gaps = 7/901 (0%)

Query: 1   MTEHIISS---DEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRIL 57
           M +               I  VSITDEM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL
Sbjct: 1   MADDNDQPGAGTPPPATDIKPVSITDEMRRSYLDYAMSVIVSRALPDARDGLKPVHRRIL 60

Query: 58  FGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNF 117
           F   + G    ++YVK ARI G+V+GKYHPHG+ +IYDAL RMAQD+S+RL+LI+GQGNF
Sbjct: 61  FAAHESGHLPERRYVKSARIVGDVIGKYHPHGDQSIYDALVRMAQDFSMRLMLIDGQGNF 120

Query: 118 GSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVN 177
           GSVDGDP AA RYTE RL K A  LL D+ K+TVDF+ NYDG  +EP VL AR+PN+LVN
Sbjct: 121 GSVDGDPAAAMRYTESRLAKPASALLSDIDKNTVDFQANYDGEHEEPTVLPARFPNLLVN 180

Query: 178 GGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGI 237
           G GGIAVGMATNIP HNLGE++D C+A+ID+P + ++AL EI+ GPDFPTG +ILGR G 
Sbjct: 181 GAGGIAVGMATNIPPHNLGELIDACIALIDDPSLTIEALNEIVPGPDFPTGGLILGRAGT 240

Query: 238 KNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIA 297
           + AYATGRGSI++R  SHIE+   +RE ++ TEIPYQVNKA ++EKIAELV+EKR+  I+
Sbjct: 241 RQAYATGRGSIIMRAKSHIEELRKEREALIFTEIPYQVNKATLVEKIAELVKEKRVEGIS 300

Query: 298 DLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGI 357
           DLRDESDR G R+V+E+KR A A+V+LNQLYRYT LQS F  NMVALNG +PE   L  +
Sbjct: 301 DLRDESDRDGMRIVVEIKRDAMAEVVLNQLYRYTPLQSSFGCNMVALNGGRPELMNLKDL 360

Query: 358 LKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARREL 417
           L AF  FREEVV RRTK+LLNKAR+RAHVL GLAIAVAN+DEV+R+IR SP+P TAR  L
Sbjct: 361 LLAFNDFREEVVSRRTKFLLNKARERAHVLCGLAIAVANIDEVIRLIRTSPDPNTAREAL 420

Query: 418 MQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNEL 477
           M R W A DI  LI L+DD  Y +  DGT  LSE+Q RAIL+LRL RLT LGRD++ +EL
Sbjct: 421 MARDWPAHDIAPLIALVDDPRYRVAEDGTYRLSEIQARAILDLRLQRLTALGRDEVGDEL 480

Query: 478 NSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVRED 537
             L  EI + LDIL SR R+  I+K EL  V+    TPR+T I++    +EDED I RED
Sbjct: 481 KKLADEIADYLDILRSRVRIQAIVKTELAEVRALFATPRKTEIIDSDFSVEDEDLIARED 540

Query: 538 MVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGF 597
           MVVTVSH GYVKRVPLS YRAQRRGGKGRSG+  RDEDFVT LF+ STHT VLFFS  G 
Sbjct: 541 MVVTVSHAGYVKRVPLSTYRAQRRGGKGRSGMATRDEDFVTRLFVASTHTPVLFFSDQGQ 600

Query: 598 VYKEKVWRLPIGSPQARGKALINILSLNQG-ERITTIMPFPEDESSWNNLYVVFATKHGN 656
            YKEKVWRLP+ +P ARGKAL+NIL L    ERI+TIMP PEDE+SW+ L V+FAT  GN
Sbjct: 601 AYKEKVWRLPMAAPNARGKALVNILHLQNEGERISTIMPLPEDETSWDTLDVMFATASGN 660

Query: 657 VRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVF 716
           VRRNKLSDF  +NR+GKIAMKLD  D I+ VE C  E ++LLTT LGQC+RFP+  +RVF
Sbjct: 661 VRRNKLSDFTTVNRNGKIAMKLDPGDHIVHVEICRPEQNVLLTTALGQCIRFPVEDVRVF 720

Query: 717 AGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLK 776
            GR+S GVRGI+LA+ D+VISMAI+   DA  +ER  Y+K   A     +G+ E   +  
Sbjct: 721 KGRDSTGVRGINLAQDDKVISMAILNAFDASPEERAGYLKMRRAVIGD-AGEAEAEPAEA 779

Query: 777 NDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKIN 836
            ++S    IS ER  E+   EQF+LT+S++GFGKR+SSY++R S R GKGI A  V+  N
Sbjct: 780 EEASEASAISLERYNEMGAAEQFVLTLSDRGFGKRSSSYEYRTSGRGGKGITAMRVNARN 839

Query: 837 EIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVER 896
             G LVA FPV  +DQI+LV++ G LIRVPV++IRI  RA++GV +F+T K ERVVSVE 
Sbjct: 840 --GNLVASFPVEASDQIMLVTNAGQLIRVPVDDIRIVGRASQGVTVFNTDKAERVVSVEH 897

Query: 897 I 897
           I
Sbjct: 898 I 898


>gi|14021652|dbj|BAB48264.1| DNA gyrase subunit A [Mesorhizobium loti MAFF303099]
          Length = 906

 Score =  972 bits (2512), Expect = 0.0,   Method: Composition-based stats.
 Identities = 591/889 (66%), Positives = 716/889 (80%), Gaps = 4/889 (0%)

Query: 25  MQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGK 84
           MQ+SYL+YA++VI+ RA+PD+RDGLKPVHRRIL+   + G  WN+KYVK AR   +VMGK
Sbjct: 1   MQSSYLSYAMSVIVSRALPDVRDGLKPVHRRILYAAHESGYHWNRKYVKSARPVADVMGK 60

Query: 85  YHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLD 144
           YHPHG+A+IYDAL RMAQDWSLR+ LI+GQGNFGS+DGDPPAA RYTE RL K AH LL+
Sbjct: 61  YHPHGDASIYDALVRMAQDWSLRVPLIDGQGNFGSIDGDPPAAMRYTESRLTKVAHELLE 120

Query: 145 DLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVA 204
           D+ KDTVDF+  YD S  EP VL AR+PN+LVNG GGIAVGMATNIP HNLGEV +G +A
Sbjct: 121 DIDKDTVDFQETYDASDTEPKVLPARFPNLLVNGSGGIAVGMATNIPPHNLGEVCNGAIA 180

Query: 205 VIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDRE 264
           +IDNP IDL ALMEII GPDFPTG ++LGR+GI +AY+TGRGSIV+RG  +IE+   DRE
Sbjct: 181 IIDNPAIDLPALMEIIPGPDFPTGGIVLGRSGIYSAYSTGRGSIVMRGKVNIEQRGNDRE 240

Query: 265 QIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVIL 324
            I++TE+PYQVNKA+M+EK+AELVR+KRI  I+D+RDESDRQGYRVVIELKR A ADVIL
Sbjct: 241 SIIITEVPYQVNKASMIEKMAELVRDKRIEGISDIRDESDRQGYRVVIELKRDAVADVIL 300

Query: 325 NQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRA 384
           NQLYR+T LQ+ F  NMVALNG KPE  TL  +LKAFV+FREEV+ RRTK+LL KARDRA
Sbjct: 301 NQLYRFTPLQTSFGANMVALNGGKPELLTLTDMLKAFVSFREEVITRRTKFLLRKARDRA 360

Query: 385 HVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSD 444
           HVLVGLAIAVAN+DEV+++IR +P+P+TAR +LM+R W A D++ LI LIDD  + I +D
Sbjct: 361 HVLVGLAIAVANIDEVIKLIRTAPDPQTAREQLMERRWPAGDVESLILLIDDPRHRINAD 420

Query: 445 GTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQE 504
           GT  LSE Q RAILELRL RLT LGRD+I +ELNS+G EI + LDILSSR+R+  I+K E
Sbjct: 421 GTYNLSEEQARAILELRLQRLTALGRDEIADELNSIGAEIVDYLDILSSRARVQQIVKDE 480

Query: 505 LLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGK 564
           L +V+DE  TPRRT + +G  DMEDED I REDMVVTVSH GY+KRVPLS+YRAQRRGGK
Sbjct: 481 LAAVRDEFGTPRRTELTDGGADMEDEDLIQREDMVVTVSHSGYIKRVPLSLYRAQRRGGK 540

Query: 565 GRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSL 624
           GRSG+  ++EDFVT LF+ +THT VLFFSS G VYKEKVWRLPIG+PQ+RGKALIN+L L
Sbjct: 541 GRSGMSTKEEDFVTRLFVANTHTPVLFFSSRGIVYKEKVWRLPIGNPQSRGKALINMLPL 600

Query: 625 NQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKL-DSRDE 683
            QGERITTIMP PEDE+SW  L V+FAT  G VRRNKLSDF+Q+NR+GKIAMKL +  DE
Sbjct: 601 EQGERITTIMPLPEDETSWGELDVMFATTRGTVRRNKLSDFVQVNRNGKIAMKLEEEGDE 660

Query: 684 ILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLH 743
           IL VETCT  +D+LLT   GQC+RF +  +RVF  RNSVGVRGI++A+ D++ISM+++ +
Sbjct: 661 ILGVETCTDNDDVLLTASSGQCIRFSVGDVRVFQSRNSVGVRGITMAETDRIISMSVIEN 720

Query: 744 ADADYDERICYMK---HMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFI 800
            DA   ER  Y+K            +G+ EEI     +   E  +S+ER + LK  EQ++
Sbjct: 721 VDASPAERAAYLKRAAAERRLAAGANGEEEEIALTNEEIGEEAELSDERYEFLKAHEQYV 780

Query: 801 LTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKG 860
           LTV+E G+GKR+SSYDFR++ R GKGIRATDVSK  EIG LVA FPV ++DQI+LVSD G
Sbjct: 781 LTVTEYGYGKRSSSYDFRLTGRGGKGIRATDVSKTAEIGRLVATFPVGNDDQIMLVSDGG 840

Query: 861 TLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAEST 909
           T+IRVPVN IR ASRATKGV IF+TA+ E+VVSVERI E +  +E+E T
Sbjct: 841 TVIRVPVNGIRFASRATKGVTIFNTAEGEKVVSVERISEPQSDEESEET 889



 Score = 56.3 bits (134), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 53/131 (40%), Gaps = 6/131 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFI-----QINRSGKIAMKLDSRDEILSVETCTQENDILLT 699
             YV+  T++G  +R+   DF                K      +++      ++ I+L 
Sbjct: 777 EQYVLTVTEYGYGKRSSSYDFRLTGRGGKGIRATDVSKTAEIGRLVATFPVGNDDQIMLV 836

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  G  +R P++ IR FA R + GV   + A+G++V+S+  +    +D +          
Sbjct: 837 SDGGTVIRVPVNGIR-FASRATKGVTIFNTAEGEKVVSVERISEPQSDEESEETVEGGTE 895

Query: 760 AQRRLISGDTE 770
           +       + E
Sbjct: 896 SAPDAGPENAE 906


>gi|158423952|ref|YP_001525244.1| DNA gyrase subunit A [Azorhizobium caulinodans ORS 571]
 gi|158330841|dbj|BAF88326.1| DNA gyrase subunit A [Azorhizobium caulinodans ORS 571]
          Length = 917

 Score =  970 bits (2508), Expect = 0.0,   Method: Composition-based stats.
 Identities = 541/901 (60%), Positives = 678/901 (75%), Gaps = 7/901 (0%)

Query: 1   MTEHIISSDE-EEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFG 59
           M ++            I  VSITDE+  SYL YA++VI+ RA+PD+RDGLKPVHRRILF 
Sbjct: 1   MADNDTPPQGGATPSDIRPVSITDELSRSYLDYAMSVIVARALPDVRDGLKPVHRRILFS 60

Query: 60  MMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS 119
           M + G EWNK+Y K AR+ G+V+GKYHPHGN ++YDAL RM Q +S+R+ LI+GQGNFGS
Sbjct: 61  MHENGYEWNKQYRKSARVVGDVIGKYHPHGNQSVYDALVRMVQTFSMRVPLIDGQGNFGS 120

Query: 120 VDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGG 179
           VDGDPPAA RYTE RL+K    LLD+LG+DTVDF+ NYD S  EP VL AR+PN+LVNG 
Sbjct: 121 VDGDPPAAMRYTEVRLEKVTQSLLDELGQDTVDFQANYDNSENEPSVLPARFPNLLVNGA 180

Query: 180 GGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKN 239
           GGIAVGMATNIP HNLGEV+DG VA++D+P +D + L++ I GPDFPTGA+I+GR+GI+ 
Sbjct: 181 GGIAVGMATNIPPHNLGEVIDGTVALLDDPVMDPELLLDYIPGPDFPTGALIMGRSGIRQ 240

Query: 240 AYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           AY TGRGSI++R  + IE    +RE I++TEIPYQVNKA M+EKIAELVR+KR+  IA++
Sbjct: 241 AYMTGRGSIMMRARATIETVRKEREAIIITEIPYQVNKATMIEKIAELVRDKRLEGIAEI 300

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDESDR+G RVVIE+KR A ADV+LN LYR T LQ+ F VNMVAL+G +P   TL   L 
Sbjct: 301 RDESDREGMRVVIEVKRDAQADVVLNNLYRMTPLQTSFGVNMVALSGGRPAVMTLHDTLT 360

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
           AF+AFREEVV RRTK+LL KARDRAHVLVGLAIAVAN+DE++++IR +P+P TAR  LM+
Sbjct: 361 AFIAFREEVVSRRTKFLLRKARDRAHVLVGLAIAVANIDEIIQLIRTAPDPGTARERLME 420

Query: 420 RSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           R W A D+  L+ LI D  + + SDGT  LS  Q RAIL+LRL RLT LGRD+I +EL+ 
Sbjct: 421 RHWPAKDVASLVALIADPRHVVASDGTYRLSMEQARAILDLRLQRLTALGRDEISDELDK 480

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           L +EI E L+IL+SR R+  II++ELL+++ E +TPRRT I EG  D++DED I REDMV
Sbjct: 481 LALEIAEYLEILASRPRMRAIIREELLALRAEFNTPRRTEITEGFGDLDDEDLIAREDMV 540

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           VTVSH GYVKRVPLS YRAQRRGGKGRS +  RDEDFVT LF+ STH  VLFFSS G VY
Sbjct: 541 VTVSHAGYVKRVPLSTYRAQRRGGKGRSAMQTRDEDFVTRLFVASTHAPVLFFSSKGQVY 600

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           K KVWRLP  +PQARGKALINIL L   ERIT+I+P PE+    +   ++FAT  G VRR
Sbjct: 601 KLKVWRLPAAAPQARGKALINILPLQPDERITSIVPLPENLEEHSLWQIMFATTGGTVRR 660

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           N L+DF Q+NR+GKIAMKL+  ++I SV+ C +  D+LLTT  G C+RFP+  +R+F GR
Sbjct: 661 NALADFSQVNRNGKIAMKLEEGEQIASVQLCNEHQDVLLTTANGACIRFPVPEVRLFKGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
           +SVGVRGI L +GD++ISMAI+ H DA  +ER+ Y++      R  + +   I       
Sbjct: 721 DSVGVRGIRLEEGDRLISMAIINHTDAAAEERVQYLRQS----RAQAAEDAPIELEGEAP 776

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
           + EG +   +  E++  EQFILT+SE G+GKRTSSY++R++ R GKGI A  V++ N  G
Sbjct: 777 AAEGKLDPVKFLEMETNEQFILTLSENGYGKRTSSYEYRVTGRGGKGIVAMAVNERN--G 834

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            LVA FPV D DQI+LV+D G LIR PVN IRI  R+++GV++F TA DERVVSVE I E
Sbjct: 835 KLVASFPVRDADQIMLVTDGGQLIRCPVNGIRIVGRSSQGVIVFDTAADERVVSVEHISE 894

Query: 900 S 900
            
Sbjct: 895 D 895



 Score = 57.1 bits (136), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 80/235 (34%), Gaps = 13/235 (5%)

Query: 535 REDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSS 594
               V+  +  G   R P+   R     G+   GV     +    L  ++        + 
Sbjct: 693 EHQDVLLTTANGACIRFPVPEVR--LFKGRDSVGVRGIRLEEGDRLISMAIINHTDAAAE 750

Query: 595 LGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKH 654
               Y  +             +     L          + P    E   N  +++  +++
Sbjct: 751 ERVQYLRQS-------RAQAAEDAPIELEGEAPAAEGKLDPVKFLEMETNEQFILTLSEN 803

Query: 655 GNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQCVRFPIS 711
           G  +R    ++    R   G +AM ++    ++++       + I+L T  GQ +R P++
Sbjct: 804 GYGKRTSSYEYRVTGRGGKGIVAMAVNERNGKLVASFPVRDADQIMLVTDGGQLIRCPVN 863

Query: 712 AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLIS 766
            IR   GR+S GV     A  ++V+S+  +   +A         +  +      +
Sbjct: 864 GIR-IVGRSSQGVIVFDTAADERVVSVEHISEDEAGEATEGEGEETGAPDESPEA 917


>gi|115524770|ref|YP_781681.1| DNA gyrase subunit A [Rhodopseudomonas palustris BisA53]
 gi|115518717|gb|ABJ06701.1| DNA gyrase subunit A [Rhodopseudomonas palustris BisA53]
          Length = 918

 Score =  970 bits (2507), Expect = 0.0,   Method: Composition-based stats.
 Identities = 553/914 (60%), Positives = 674/914 (73%), Gaps = 9/914 (0%)

Query: 2   TEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMM 61
           T+     +      I  VSI DEM+ SYL YA++VI+ RA+PD RDGLKPVHRRILFGM 
Sbjct: 6   TDDRKPGEPPAPSDIRPVSILDEMKRSYLDYAMSVIVARALPDARDGLKPVHRRILFGMY 65

Query: 62  QMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVD 121
           + G EWNK Y K AR  G+V+GKYHPHG+ ++YDA+ RMAQD+S+R+ LI+GQGNFGSVD
Sbjct: 66  ENGFEWNKPYRKSARTVGDVIGKYHPHGDQSVYDAMVRMAQDFSMRVPLIDGQGNFGSVD 125

Query: 122 GDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGG 181
           GD PAA RYTE RL K A  LLDDL KDTVD++ NYDGSF+EP VL A++PN+LVNG GG
Sbjct: 126 GDAPAAMRYTESRLTKIAQLLLDDLDKDTVDYQDNYDGSFREPRVLPAKFPNLLVNGAGG 185

Query: 182 IAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAY 241
           IAVGMATNIP HNLGEV+D CVA+I++P + +D L +II GPDFPTG +ILGR GI+ AY
Sbjct: 186 IAVGMATNIPPHNLGEVIDACVALIEDPALSIDDLSKIIPGPDFPTGGIILGRAGIRLAY 245

Query: 242 ATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRD 301
            TGRGSIV+RG   IE    DRE I+++EIPYQVNKA M+E+IAELVREK+I  I+DLRD
Sbjct: 246 HTGRGSIVMRGKVSIEPARKDREAIIISEIPYQVNKATMVERIAELVREKKIEGISDLRD 305

Query: 302 ESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAF 361
           ESDR G+RVVIEL+R A ADV+LNQLYR+T LQ+ F  NMVAL+  +P    L  +L  F
Sbjct: 306 ESDRDGFRVVIELRRDAVADVVLNQLYRFTPLQTNFGANMVALDAGRPLLMNLKDLLTLF 365

Query: 362 VAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRS 421
           VAFRE+VV RRTK+LLNKARDRAH+LVGLAIAVAN+DE++R+IR SP+P TAR  LM R 
Sbjct: 366 VAFREQVVTRRTKFLLNKARDRAHILVGLAIAVANIDEIIRVIRASPDPATARDTLMSRD 425

Query: 422 WNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLG 481
           W A D+  +I LIDD  + +  DGT  LS  Q +AIL+LRL RLT LGR++I  EL+ L 
Sbjct: 426 WPAQDVAAMITLIDDPRHRLNEDGTARLSFEQAKAILDLRLQRLTALGREEISEELDKLA 485

Query: 482 IEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVT 541
           +EI + L+IL SR+R+  IIK EL +VK E  TPRRT I+E   ++EDED I REDMVVT
Sbjct: 486 VEIADYLEILRSRARVQTIIKDELAAVKAEFATPRRTEIIEQEGEVEDEDLIQREDMVVT 545

Query: 542 VSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKE 601
           VSH GYVKRVPLS YRAQRRGGKGR+G+  R+EDFV+ LF+ STHT VLFFSS G VYKE
Sbjct: 546 VSHAGYVKRVPLSTYRAQRRGGKGRAGMATREEDFVSRLFVASTHTPVLFFSSRGQVYKE 605

Query: 602 KVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNK 661
           KVWRLP+  P  RGKALINIL L QGERI TIMP PEDESSW    V+FAT  G VRRNK
Sbjct: 606 KVWRLPLAPPNGRGKALINILPLEQGERINTIMPLPEDESSWAEFDVMFATTRGTVRRNK 665

Query: 662 LSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNS 721
           LSDF+ + RSG IAMKLD  + I+ V+ CT  +D+LLT   GQC+RF ++ +RVF  R S
Sbjct: 666 LSDFVDVRRSGIIAMKLDDGEAIVDVQICTDRDDVLLTAAEGQCIRFAVTDVRVFQSRAS 725

Query: 722 VGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISG-------DTEEITS 774
           +GVRG++LA GDQVIS+ I+ H DA   ER  Y+K   A RR  +G         E    
Sbjct: 726 MGVRGMALANGDQVISLTILRHFDATPAERTTYLKQSGAIRRAATGEEVEPSEVVEAAVE 785

Query: 775 LKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSK 834
            + ++     +S ER  E+   EQF+LT+SE GFGKRTSS+++R + R GKGI A  V+ 
Sbjct: 786 PEEETDGLAALSPERYAEMSANEQFVLTISENGFGKRTSSFEYRTTGRGGKGIVAMSVNA 845

Query: 835 INEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSV 894
            N  G LVA FPV + DQI+LV+DKG LIR PV  IRI  R+T+GV +F+TA+DE VVSV
Sbjct: 846 RN--GKLVASFPVEEEDQIMLVTDKGQLIRCPVGGIRIVGRSTQGVTVFNTAEDEHVVSV 903

Query: 895 ERIRESEIVDEAES 908
           E I E       + 
Sbjct: 904 EHIGEEAENGNGDG 917


>gi|86281831|gb|ABC90894.1| DNA gyrase subunit A protein [Rhizobium etli CFN 42]
          Length = 908

 Score =  970 bits (2506), Expect = 0.0,   Method: Composition-based stats.
 Identities = 620/872 (71%), Positives = 736/872 (84%), Gaps = 1/872 (0%)

Query: 34  INVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAI 93
           ++VI+ RA+PD+RDGLKPVHRRIL+GM ++G++WNKKYVKCAR++G+VMGKYHPHGNAAI
Sbjct: 1   MSVIVSRALPDVRDGLKPVHRRILYGMSELGIDWNKKYVKCARVTGDVMGKYHPHGNAAI 60

Query: 94  YDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDF 153
           YDALARMAQ WSLRL LI+GQGNFGSVDGDPPAAERYTECRL+KAAH LLDDL K+TVDF
Sbjct: 61  YDALARMAQPWSLRLPLIDGQGNFGSVDGDPPAAERYTECRLEKAAHSLLDDLDKETVDF 120

Query: 154 RPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDL 213
           R NYDG+  EPVV+ A++PN+LVNG GGIAVGMATNIP HNL EV+DGC+A+I++P I+L
Sbjct: 121 RDNYDGTLSEPVVVPAKFPNLLVNGAGGIAVGMATNIPPHNLSEVIDGCIALINDPAIEL 180

Query: 214 DALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPY 273
             LM+II GPDFPTGA ILGR GI++AY TGRGS+++RGV+ IE   GDREQI++TEIPY
Sbjct: 181 PELMQIIPGPDFPTGAKILGRAGIRSAYETGRGSVIMRGVATIEPMRGDREQIIITEIPY 240

Query: 274 QVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSL 333
           QVNKA M+EK+AELVREKRI  I+DLRDESDRQGYRVVIELKR A+A+VILNQLYRYT L
Sbjct: 241 QVNKATMIEKMAELVREKRIEGISDLRDESDRQGYRVVIELKRDANAEVILNQLYRYTPL 300

Query: 334 QSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIA 393
           Q+ F  NMVALNG KPE+ TL+ +L+AFV+FREEVV RRTK+LL KAR+RAHVLVGLAIA
Sbjct: 301 QTSFGCNMVALNGGKPEQLTLLDMLRAFVSFREEVVSRRTKFLLRKARERAHVLVGLAIA 360

Query: 394 VANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQ 453
           VAN+DEV+R+IR +P+P++AR ELM R W A D++ LI LIDD  + I  D T  LSE Q
Sbjct: 361 VANIDEVIRVIRQAPDPQSAREELMTRRWPAEDVESLIRLIDDPRHRINDDLTYNLSEEQ 420

Query: 454 TRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELD 513
            RAILELRLARLT LGRD+I +ELN +G EI++ LDILSSR R+  I+K EL +V+DE  
Sbjct: 421 ARAILELRLARLTALGRDEIGDELNKIGEEIRDYLDILSSRVRIQTIVKDELSAVRDEFG 480

Query: 514 TPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRD 573
           TPRRT IV+G L+M+DED I REDMVVTVSHLGY+KRVPL+ YRAQRRGGKGRSG+  RD
Sbjct: 481 TPRRTEIVDGGLEMDDEDLIAREDMVVTVSHLGYIKRVPLTTYRAQRRGGKGRSGMTTRD 540

Query: 574 EDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTI 633
           EDFV+ LF+V+THT VLFFSS G VYKEKVWRLPIG+P +RGKALIN+L L  GERITTI
Sbjct: 541 EDFVSRLFVVNTHTPVLFFSSRGIVYKEKVWRLPIGTPTSRGKALINMLPLEPGERITTI 600

Query: 634 MPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKL-DSRDEILSVETCTQ 692
           +P PEDE+SW+NL V+F+T  G VRRNKLSDF+Q+NR+GKIAMKL +  DEILSVETCT 
Sbjct: 601 LPLPEDEASWDNLDVMFSTTRGTVRRNKLSDFVQVNRNGKIAMKLEEEGDEILSVETCTD 660

Query: 693 ENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERI 752
            +D+LLTT LGQC+RF +  +RVFAGRNS+GVRGI+L +GD++ISM IV H DA+  ER 
Sbjct: 661 RDDVLLTTALGQCIRFSVDDVRVFAGRNSIGVRGINLGEGDRIISMTIVGHVDAEPWERA 720

Query: 753 CYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRT 812
            Y+K  +A+RR I  D E+I  +  + + EG +S+ER +ELK +EQF+LTVSEKGFGKR+
Sbjct: 721 AYLKRSAAERRAIGVDEEDIALVGEEVTEEGQLSDERYEELKAREQFVLTVSEKGFGKRS 780

Query: 813 SSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRI 872
           SSYDFRIS R GKGIRATD SK  EIG LVA FPV+D DQI+LVSD G LIRVPV  IRI
Sbjct: 781 SSYDFRISGRGGKGIRATDTSKTGEIGELVAAFPVDDGDQIMLVSDGGQLIRVPVGGIRI 840

Query: 873 ASRATKGVVIFSTAKDERVVSVERIRESEIVD 904
           ASRATKGV IFSTAKDE+VVSVERI E E  D
Sbjct: 841 ASRATKGVTIFSTAKDEKVVSVERISEPEEDD 872



 Score = 51.7 bits (122), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 52/145 (35%), Gaps = 6/145 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFI-----QINRSGKIAMKLDSRDEILSVETCTQENDILLT 699
             +V+  ++ G  +R+   DF                K     E+++       + I+L 
Sbjct: 765 EQFVLTVSEKGFGKRSSSYDFRISGRGGKGIRATDTSKTGEIGELVAAFPVDDGDQIMLV 824

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMS 759
           +  GQ +R P+  IR  A R + GV   S AK ++V+S+  +   + D  E        +
Sbjct: 825 SDGGQLIRVPVGGIR-IASRATKGVTIFSTAKDEKVVSVERISEPEEDDTEGAVDAAEAA 883

Query: 760 AQRRLISGDTEEITSLKNDSSVEGN 784
           A         E   +  +       
Sbjct: 884 AGADETPFADETPVADGDPGGAAEE 908


>gi|296447102|ref|ZP_06889034.1| DNA gyrase, A subunit [Methylosinus trichosporium OB3b]
 gi|296255371|gb|EFH02466.1| DNA gyrase, A subunit [Methylosinus trichosporium OB3b]
          Length = 911

 Score =  968 bits (2503), Expect = 0.0,   Method: Composition-based stats.
 Identities = 544/913 (59%), Positives = 671/913 (73%), Gaps = 6/913 (0%)

Query: 1   MTEHIISSDEE--EEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILF 58
           M +              I  VSI DEM+ SYL YA++VI+ RA+PD+RDGLKPVHRRI+F
Sbjct: 1   MADDDTEKTGAAAPGSDIRPVSIADEMKRSYLDYAMSVIVSRALPDVRDGLKPVHRRIMF 60

Query: 59  GMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFG 118
            M + G   +K YVK ARI G+VMGKYHPHG+AAIYDAL RMAQ +S+RL LI+GQGNFG
Sbjct: 61  SMHENGHTPDKPYVKSARIVGDVMGKYHPHGDAAIYDALVRMAQPFSMRLPLIDGQGNFG 120

Query: 119 SVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNG 178
           SVD DPPAA RYTE RL K A  LL+DL + TVDF+PNYD    EP VL AR+PN+LVNG
Sbjct: 121 SVDNDPPAAMRYTESRLAKPALALLEDLDEGTVDFKPNYDDKEMEPTVLPARFPNLLVNG 180

Query: 179 GGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIK 238
            GGIAVGMATNIP HNLGEV+D  +A+ID PD+ +  LMEI+ GPDFPT A ILGR GI+
Sbjct: 181 AGGIAVGMATNIPPHNLGEVIDAAIALIDRPDMSVAELMEIVPGPDFPTAATILGRGGIR 240

Query: 239 NAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIAD 298
           NAY+TGRGSI++R  + IE    +RE I+ TEIPYQVNKAA++E+IAELVREK+I  +AD
Sbjct: 241 NAYSTGRGSIIMRAKAEIETLRKEREAIIFTEIPYQVNKAALIERIAELVREKKIEGVAD 300

Query: 299 LRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGIL 358
           LRDESDR G R+V+ELKR A ADV+LNQL+R+T+LQS F VNM+ALNG +PE  TL  +L
Sbjct: 301 LRDESDRDGMRIVVELKRDAVADVVLNQLWRHTALQSSFPVNMIALNGGRPELLTLKDVL 360

Query: 359 KAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELM 418
            AFV FRE VV RRTK+ LNKARD AH+ VGLAIAVAN+DEV+R+IR S +   AR  LM
Sbjct: 361 VAFVDFRESVVTRRTKFRLNKARDAAHLQVGLAIAVANIDEVIRLIRTSADAAAAREALM 420

Query: 419 QRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELN 478
           +R W A D+  L+ LI D  + +  DGT+ LSE Q RAIL+LRL RLT LGR++I   LN
Sbjct: 421 ERLWPAKDMAPLVALIADPRHVLHEDGTIRLSEAQARAILDLRLQRLTALGREEIAEALN 480

Query: 479 SLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDM 538
            L  EI E L+IL SR +L GI+K E+++VK    TPRRT+IV+G  D+EDED I REDM
Sbjct: 481 KLAAEIAEYLEILRSREKLFGIVKDEMIAVKTAYATPRRTQIVDGDGDVEDEDLIAREDM 540

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           VVTVSH GY+KRVPLS YRAQRRGGKGRSG+  ++EDFV  LF+ STHT VLFFSSLG  
Sbjct: 541 VVTVSHAGYIKRVPLSTYRAQRRGGKGRSGMQTKEEDFVHRLFVASTHTPVLFFSSLGRA 600

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVR 658
           YKEKVWRLP+ +PQARGKAL+N+L L Q ERITTIMP PEDESSW  L  +FAT  G VR
Sbjct: 601 YKEKVWRLPLAAPQARGKALVNLLPLEQNERITTIMPLPEDESSWATLDAIFATTRGTVR 660

Query: 659 RNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAG 718
           RNKLSDF  + RSG IAMKLD  + I+ V T ++ +D+LLTT+ GQC+RFP++ +RVF  
Sbjct: 661 RNKLSDFSDVRRSGIIAMKLDEGEAIVDVATASENDDVLLTTREGQCIRFPVTDVRVFQS 720

Query: 719 RNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKND 778
           R+S+GVRG++LA  D+VIS++I+ H +A  +ER  Y+K  +AQRR  + +          
Sbjct: 721 RSSMGVRGVALAAEDRVISLSILRHFEASGEERAAYLKRAAAQRRAGAQENGAEEGAAEA 780

Query: 779 SSVEG--NISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKIN 836
                   +SE R ++++  EQ ILTVSE G+GKR+SS+++RI+ R GKGI A  V+  N
Sbjct: 781 EESSASIELSEARFRDMEQAEQIILTVSENGYGKRSSSFEYRITGRGGKGIVAMAVNARN 840

Query: 837 EIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVER 896
             G LVA FPV    +I+LV+D G LIR PV  IRI  R T+GV++F TA+ ERVVSVE 
Sbjct: 841 --GKLVASFPVGSGAEIMLVTDGGQLIRCPVEGIRIVGRGTQGVIVFDTAEGERVVSVEH 898

Query: 897 IRESEIVDEAEST 909
           I E+    E    
Sbjct: 899 IGETGAEAEVAEE 911


>gi|83593079|ref|YP_426831.1| DNA gyrase subunit A [Rhodospirillum rubrum ATCC 11170]
 gi|83575993|gb|ABC22544.1| DNA gyrase subunit A [Rhodospirillum rubrum ATCC 11170]
          Length = 943

 Score =  968 bits (2501), Expect = 0.0,   Method: Composition-based stats.
 Identities = 510/900 (56%), Positives = 680/900 (75%), Gaps = 9/900 (1%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           M+ +     + +   I+ VSI DEM+ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+ M
Sbjct: 1   MSTNTPKPIDLD---ISPVSIEDEMKRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYSM 57

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            + G E+NK Y K ARI G+VMGKYHPHG+ +IYDA+ RM Q++++RL LI+GQGNFGS+
Sbjct: 58  KESGYEFNKPYRKSARIVGDVMGKYHPHGDQSIYDAMVRMVQNFAMRLPLIDGQGNFGSM 117

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGD  AA RYTE R+ KAAH LLDD+ K+TVDF+PNYD + +EP+VL AR+PN+LVNG G
Sbjct: 118 DGDRAAAMRYTEARMAKAAHSLLDDIDKETVDFQPNYDETTREPIVLPARFPNLLVNGAG 177

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEV+D C A+IDNP +  + L+E++ GPDFPTG  ILGR+G++ A
Sbjct: 178 GIAVGMATNIPPHNLGEVIDACCAMIDNPAVTAEELLELVPGPDFPTGGTILGRSGVRAA 237

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           + TGRGS+++RG +H E  SG R+ I+VTE+PYQVNKA+M+EKIAELVREK++  I+D+R
Sbjct: 238 HLTGRGSVIMRGRTHFEDISGGRQAIIVTEVPYQVNKASMVEKIAELVREKKLEGISDIR 297

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR+G RVVIE+KR A A+V+LNQL+RYT LQ+ F VNM+ALNG KPE   L  I++A
Sbjct: 298 DESDRRGVRVVIEVKRDAMAEVVLNQLFRYTPLQTSFGVNMLALNGGKPELLALRPIIEA 357

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           F+ FREEV+ RRT + L KAR+RAH LVGLAIAVANLD V+++IR +P+P+ AR  LM R
Sbjct: 358 FITFREEVIRRRTIFELGKARERAHTLVGLAIAVANLDPVIKLIREAPDPQAAREGLMAR 417

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D++ LI LID+    +  DG   LSE+Q RAIL+LRL RLTGL RD +  EL  +
Sbjct: 418 DWPAMDVEPLIKLIDEPG-RMVIDGVYRLSEIQARAILDLRLHRLTGLERDKLHGELIEI 476

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
           G +I+E L IL SR+RL  I++ EL+ +K+   TPRRT + E   + + ED I RE+MVV
Sbjct: 477 GQQIEEYLHILRSRARLFEIMRAELVEMKEAYATPRRTTLEENEFEHDIEDLIQREEMVV 536

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TV++ GY+KRVPL+ YRAQRRGG+GR+G+ MRDEDFVT +F+V+TH  +LFFSS G VYK
Sbjct: 537 TVTNTGYIKRVPLTTYRAQRRGGRGRAGMSMRDEDFVTTIFVVNTHAPLLFFSSDGMVYK 596

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
            KV+RLP+G+PQARGKA++NI+ LN+GERITT+MP PEDE +W+ L V+FAT+ GNVRRN
Sbjct: 597 MKVYRLPLGTPQARGKAMVNIMPLNEGERITTVMPLPEDEGAWDQLDVMFATETGNVRRN 656

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
           +LSDF  +  +GKIAMKLD  D ++ V TCT E D+LLTT LG+ +RF +  +RVFAGR 
Sbjct: 657 RLSDFTNVMSNGKIAMKLDEGDHLIGVATCTDEQDVLLTTNLGKAIRFAVGDVRVFAGRT 716

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSS 780
           S GVRGI LA+ D+V  ++I+ H +A  + R  Y+K  SA RR       E        +
Sbjct: 717 STGVRGIRLAEDDRVNRLSILGHVEASAETRAAYLKQASALRRA--SGETEGEDDSTLDA 774

Query: 781 VEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGA 840
             G +S E  ++L+ +E+F+LTV+ +GFGKRTS+Y++R++ R G+GI   ++S+ N  G 
Sbjct: 775 EPGVLSAEEFEDLRQREEFLLTVTSRGFGKRTSAYEYRVTGRGGQGIANIEMSERN--GT 832

Query: 841 LVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFST-AKDERVVSVERIRE 899
           +VA FP+ + DQ+++++D G LIR+PVN++RIA R T+GV +F      E VVSV R+ E
Sbjct: 833 VVAAFPIANEDQVMMITDGGQLIRMPVNDVRIAGRKTQGVTLFRLSDDGEHVVSVARLPE 892



 Score = 60.6 bits (145), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 60/154 (38%), Gaps = 5/154 (3%)

Query: 643 WNNLYVVFATKHGNVRRNKLSDF-IQINRSGKIA-MKLDS-RDEILSVETCTQENDILLT 699
               +++  T  G  +R    ++ +       IA +++      +++      E+ +++ 
Sbjct: 789 QREEFLLTVTSRGFGKRTSAYEYRVTGRGGQGIANIEMSERNGTVVAAFPIANEDQVMMI 848

Query: 700 TKLGQCVRFPISAIRVFAGRNSVGVRGISL-AKGDQVISMAIVLHADADYDERICYMKHM 758
           T  GQ +R P++ +R  AGR + GV    L   G+ V+S+A +   + + D+     +  
Sbjct: 849 TDGGQLIRMPVNDVR-IAGRKTQGVTLFRLSDDGEHVVSVARLPEMNGNGDDGEGDDETP 907

Query: 759 SAQRRLISGDTEEITSLKNDSSVEGNISEERCQE 792
                  +    + +   +     G   E    +
Sbjct: 908 DESLAEDANGGRDESGEASGLPPAGQSPERNGDD 941


>gi|298291664|ref|YP_003693603.1| DNA gyrase subunit alpha [Starkeya novella DSM 506]
 gi|296928175|gb|ADH88984.1| DNA gyrase, A subunit [Starkeya novella DSM 506]
          Length = 918

 Score =  967 bits (2499), Expect = 0.0,   Method: Composition-based stats.
 Identities = 546/907 (60%), Positives = 682/907 (75%), Gaps = 12/907 (1%)

Query: 1   MTE-HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFG 59
           M++   +  ++     I  VSITDE+  SYL YA++VI+ RA+PD+RDGLKPVHRRILF 
Sbjct: 1   MSDSDTLKPEDGGPSDIRPVSITDELSRSYLDYAMSVIVSRALPDVRDGLKPVHRRILFS 60

Query: 60  MMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS 119
           M +      + Y K AR++G+ MGKYHPHGN AIYDAL R+AQD+S+RL LI+GQGNFGS
Sbjct: 61  MRENNYVPERPYNKSARVTGDTMGKYHPHGNQAIYDALVRLAQDFSMRLPLIDGQGNFGS 120

Query: 120 VDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGG 179
           +DGDPPAAERYTE RL K A  LLDDL KDTVDF+ NYDG  QEP VL AR+PN+LVNG 
Sbjct: 121 IDGDPPAAERYTEVRLAKPAMNLLDDLDKDTVDFQDNYDGREQEPTVLPARFPNLLVNGA 180

Query: 180 GGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKN 239
           GGIAVGMATNIP HNLGEVVD CVA+ID PD+D++ L++ I GPDFPTGA+ILGR+GI+ 
Sbjct: 181 GGIAVGMATNIPPHNLGEVVDACVALIDEPDLDIEKLLDYIHGPDFPTGALILGRSGIRQ 240

Query: 240 AYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           AY TGRGSIV+R  + IE+   DR+ I+VTEIPYQVNKA M+E+IAELVR+KR+  IA++
Sbjct: 241 AYLTGRGSIVMRSRATIEELRKDRDAIIVTEIPYQVNKATMIERIAELVRDKRLEGIAEI 300

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDES R+G RVV E+KR A ADV+LN LYR ++LQ+ F  NMVALNG KP   TL  +L 
Sbjct: 301 RDESSREGLRVVFEIKRDAQADVVLNNLYRMSALQTSFGANMVALNGGKPALMTLHDLLT 360

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
           AFVAFREEVV RRTK+LL KARDRAHVLVGLAIAVAN+DEV+  IR SP+P TAR  LM 
Sbjct: 361 AFVAFREEVVSRRTKFLLRKARDRAHVLVGLAIAVANIDEVIATIRRSPDPATAREALMT 420

Query: 420 RSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           R W A D+  LI LIDD  + +  DGT  LS  Q RAIL+LRL RLT LGRD++ +EL+ 
Sbjct: 421 RDWPAMDVAPLIALIDDPRHKLAEDGTYRLSAEQARAILDLRLQRLTALGRDEVADELDK 480

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           + +EI++ LDIL+SR R+  I+K ELL+VK E  TPR+T I +   D EDED I REDMV
Sbjct: 481 IAVEIRDYLDILASRERIRTIVKDELLAVKAEFGTPRKTEITDAEGDFEDEDLIAREDMV 540

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           VTVSH GY+KRVPLS YR+QRRGGKGRS +  RDEDFVT +F+ STH  VLFFSS G VY
Sbjct: 541 VTVSHAGYIKRVPLSTYRSQRRGGKGRSAMQTRDEDFVTRIFVASTHAPVLFFSSKGQVY 600

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           K KVWRLP+ +PQARGKAL+NIL L +GERIT+IM  P DE +W+ L ++F+T  G VRR
Sbjct: 601 KLKVWRLPLSAPQARGKALVNILPLTEGERITSIMALP-DEETWSRLQIMFSTTGGTVRR 659

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           N+LSDF  +NR+GKIAMKL+  + I  V+ CT+++D+LLT+  GQC+RFP+  +RVF GR
Sbjct: 660 NELSDFTNVNRNGKIAMKLEEGEAIADVDLCTEQDDVLLTSAKGQCIRFPVPEVRVFKGR 719

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKN-- 777
           +S+GVRGI L +GD++ISMAI+ H DA  +ER  Y+K  +A RR  +G        +   
Sbjct: 720 DSMGVRGIQLEEGDRLISMAIIRHVDATAEERAAYIKLANAVRRSQAGLENGAEEPETVA 779

Query: 778 ------DSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATD 831
                   +   +I + R  E+   EQFILT+SE GFGKRTSS+++R + R GKGI A  
Sbjct: 780 DADAEEAVAAPADIDQARYVEMSANEQFILTLSENGFGKRTSSFEYRTTRRGGKGIVAMA 839

Query: 832 VSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERV 891
           V++ N  G L+A FPV + DQI+LV+D G LIR PVN IRI  R ++GV++F+TA+DE+V
Sbjct: 840 VNERN--GPLIASFPVEEADQIMLVTDGGQLIRCPVNGIRIVGRGSQGVIVFNTAEDEKV 897

Query: 892 VSVERIR 898
           VSVER+ 
Sbjct: 898 VSVERVS 904



 Score =  102 bits (255), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 54/248 (21%), Positives = 92/248 (37%), Gaps = 16/248 (6%)

Query: 665 FIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGV 724
           F    ++     + D  DE L       E+ ++  +  G   R P+S  R    R   G 
Sbjct: 513 FGTPRKTEITDAEGDFEDEDLIAR----EDMVVTVSHAGYIKRVPLSTYRS-QRRGGKGR 567

Query: 725 RGISLAKGDQVISMAIVL-HADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEG 783
             +     D V  + +   HA   +      +  +   R  +S       +L N   +  
Sbjct: 568 SAMQTRDEDFVTRIFVASTHAPVLFFSSKGQVYKLKVWRLPLSAPQARGKALVNILPLTE 627

Query: 784 NISEERCQELKLKEQF----ILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
                    L  +E +    I+  +  G  +R    DF   NR+GK   A  + +     
Sbjct: 628 GERITSIMALPDEETWSRLQIMFSTTGGTVRRNELSDFTNVNRNGK--IAMKLEEGE--- 682

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRI-ASRATKGVVIFSTAKDERVVSVERIR 898
           A+  V    + D ++L S KG  IR PV E+R+   R + GV      + +R++S+  IR
Sbjct: 683 AIADVDLCTEQDDVLLTSAKGQCIRFPVPEVRVFKGRDSMGVRGIQLEEGDRLISMAIIR 742

Query: 899 ESEIVDEA 906
             +   E 
Sbjct: 743 HVDATAEE 750


>gi|188584270|ref|YP_001927715.1| DNA gyrase, A subunit [Methylobacterium populi BJ001]
 gi|179347768|gb|ACB83180.1| DNA gyrase, A subunit [Methylobacterium populi BJ001]
          Length = 908

 Score =  966 bits (2498), Expect = 0.0,   Method: Composition-based stats.
 Identities = 547/896 (61%), Positives = 673/896 (75%), Gaps = 5/896 (0%)

Query: 3   EHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQ 62
           +   +        I  VSITDEM+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+   +
Sbjct: 6   DDTGAGTPPPATDIKPVSITDEMRRSYLDYAMSVIVSRALPDARDGLKPVHRRILYSAFE 65

Query: 63  MGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDG 122
            G    +KYVK ARI G+V+G+YHPHG+ +IYDAL RMAQD+S+RL+LI+GQGNFGSVDG
Sbjct: 66  SGHLPERKYVKSARIVGDVIGQYHPHGDQSIYDALVRMAQDFSMRLMLIDGQGNFGSVDG 125

Query: 123 DPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGI 182
           DPPAA RYTE RL + A  LL D+ K+TVDF+ NYD S +EP VL AR+PN+LVNG GGI
Sbjct: 126 DPPAAMRYTESRLARPAISLLTDIDKNTVDFQSNYDDSREEPTVLPARFPNLLVNGAGGI 185

Query: 183 AVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYA 242
           AVGMATNIP HNLGE+VD CVA+ID+P + ++AL EI+ GPDFPTG +ILGR G + AY 
Sbjct: 186 AVGMATNIPPHNLGELVDACVALIDDPALTIEALNEIVPGPDFPTGGMILGRAGTRQAYT 245

Query: 243 TGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDE 302
           TGRGSI++R  SH+E+   +RE ++ TEIPYQVNKA ++EKIAELV++KRI  I+DLRDE
Sbjct: 246 TGRGSIIMRARSHVEELRKEREALIFTEIPYQVNKATLIEKIAELVKDKRIEGISDLRDE 305

Query: 303 SDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFV 362
           SDR G R+V+E+KR A ADV+LNQLYRYT LQ+ F  NMVALNG +PE   L  +L AF 
Sbjct: 306 SDRDGMRIVVEIKRDAMADVVLNQLYRYTPLQTSFGANMVALNGGRPELMNLKDLLLAFN 365

Query: 363 AFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSW 422
            FREEVV RRTK+LLNKAR+RAHVL GLAIAVAN+DEV+R+IR SP+P TAR  LM R W
Sbjct: 366 DFREEVVSRRTKFLLNKARERAHVLCGLAIAVANIDEVIRLIRTSPDPNTAREALMARDW 425

Query: 423 NASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGI 482
            A DI  LI L+DD  + +  DGT  LSE Q RAIL+LRL RLT LGRD+I +EL  L  
Sbjct: 426 PAHDIAPLIALVDDPRHRVADDGTYRLSETQARAILDLRLQRLTALGRDEIGDELKKLAD 485

Query: 483 EIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTV 542
           EI + LDIL SR+R+  I+K EL  V++   TPR+T I++    +EDED I REDMVVTV
Sbjct: 486 EIADYLDILRSRARIQAIVKHELAEVRELFATPRKTEIIDSDFSVEDEDLIAREDMVVTV 545

Query: 543 SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEK 602
           SH GYVKRVPLS YR+Q+RGGKGRSG+  RDEDFVT LF+ +THT VLFFS  G  YKEK
Sbjct: 546 SHAGYVKRVPLSTYRSQKRGGKGRSGMSTRDEDFVTRLFVANTHTPVLFFSDQGQAYKEK 605

Query: 603 VWRLPIGSPQARGKALINILSLNQG-ERITTIMPFPEDESSWNNLYVVFATKHGNVRRNK 661
           VWRLP+ +P ARGKAL+NIL L    ERITTIMP PEDE+SW  L V+FAT  GNVRRNK
Sbjct: 606 VWRLPVAAPNARGKALVNILHLQNEGERITTIMPLPEDEASWETLDVMFATASGNVRRNK 665

Query: 662 LSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNS 721
           LSDF+Q+NR+GKIAMKLD  D I+ VE C  + ++LLTT LGQC+RFP+  +RVF GR+S
Sbjct: 666 LSDFVQVNRNGKIAMKLDPGDHIVHVEICRPDQNVLLTTALGQCIRFPVEDVRVFKGRDS 725

Query: 722 VGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSV 781
            GVRGI+L K D+VISMAI+   DA  +ER  Y+K   A   +     E   + + + + 
Sbjct: 726 TGVRGINLGKDDKVISMAILNAFDASPEERAGYLKMRRAV--IGDSGEEGTENGEAEEAS 783

Query: 782 EGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGAL 841
              IS ER  ++   EQF+LT+SE+GFGKR+SSY++R S R GKGI A  V+  N  G L
Sbjct: 784 AAAISPERYTQMGAAEQFVLTLSERGFGKRSSSYEYRTSGRGGKGITAMRVNARN--GNL 841

Query: 842 VAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERI 897
           VA FPV  +DQI+LV++ G LIRVPV++IRI  RA++GV +F+T K ERVVSVE I
Sbjct: 842 VASFPVEASDQIMLVTNAGQLIRVPVDDIRIVGRASQGVTVFNTDKAERVVSVEHI 897


>gi|315500084|ref|YP_004088887.1| DNA gyrase, a subunit [Asticcacaulis excentricus CB 48]
 gi|315418096|gb|ADU14736.1| DNA gyrase, A subunit [Asticcacaulis excentricus CB 48]
          Length = 918

 Score =  966 bits (2497), Expect = 0.0,   Method: Composition-based stats.
 Identities = 513/914 (56%), Positives = 674/914 (73%), Gaps = 8/914 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+   +S      GI+ V+I DE++ SYL YA++VI+ RA+PD RDGLKPVHRRI++ M
Sbjct: 1   MTD-TPASGLPTPHGISHVTIEDELKRSYLDYAMSVIVSRALPDARDGLKPVHRRIVYAM 59

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            + G   +KKYVK A I G+VMG+YHPHG+ AIYDAL RMAQ +S+RLLL++GQGNFGSV
Sbjct: 60  YEEGRTHDKKYVKSANIVGDVMGRYHPHGDGAIYDALVRMAQPFSMRLLLVDGQGNFGSV 119

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTE R+ +AA  L+ D+ K+TVDF  NYDG+ QEP VL +R PN+LVNG G
Sbjct: 120 DGDPPAAMRYTESRMTRAAESLIADIDKNTVDFNDNYDGARQEPSVLPSRIPNLLVNGAG 179

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGE+++ C+A++D+P++  + L+ I+ GPDFPTG  ILGR+G + A
Sbjct: 180 GIAVGMATNIPPHNLGEIIEACLAMLDDPEVSTETLLGIVPGPDFPTGGEILGRSGARQA 239

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
             TGRGS+++RG + +E    DRE I+VTE+PYQVNKA ++E IAE+VREKRI  I+D+R
Sbjct: 240 LLTGRGSVIMRGKASVETIRKDREAIIVTELPYQVNKATLIEHIAEMVREKRIEGISDIR 299

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQG R+VIELKR AS DVILNQLYRY++LQ+ F VNM+ALN  +P++  L  +L+ 
Sbjct: 300 DESDRQGMRMVIELKRDASGDVILNQLYRYSALQTSFGVNMLALNHGRPQQMGLRKLLEI 359

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           F+ FREEVVVRRT++ LNKARDR HVLVGLAIAVAN+DE++ IIR S +P  AR  L  +
Sbjct: 360 FLDFREEVVVRRTRFELNKARDRGHVLVGLAIAVANIDEIIHIIRSSVDPTEARERLTAK 419

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
           +W A D+  LI+LI D    +   G + L+E Q RAIL L L+RLTGLGRD+I  E  +L
Sbjct: 420 NWPAGDMSPLIELIADPRSIVFEGGEVRLTEEQARAILALTLSRLTGLGRDEIFGEARTL 479

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
              I E L ILSSR R+LGI+++EL  VK     PRR+ IV+G  D+EDED I REDMVV
Sbjct: 480 AASIAEYLAILSSRERILGIVREELEEVKALYAEPRRSLIVDGEADIEDEDLIPREDMVV 539

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TV+H GYVKR PLS YR Q RGGKGRSG+ M+DED +T ++  STH  +LFFSS G  YK
Sbjct: 540 TVTHSGYVKRTPLSAYRTQHRGGKGRSGMAMKDEDAITGIYAASTHQPMLFFSSTGKAYK 599

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
            KVWRLP+G+PQ++GKA +N+L L++ E +T I+  PEDE++W+ L +VFAT+ G+VRRN
Sbjct: 600 LKVWRLPLGTPQSKGKAFVNLLPLDKHETVTNILTLPEDEAAWDRLDIVFATRSGDVRRN 659

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
           KLSDF+ +NR+GKIAMKL+  D I+ V  CT++ D+LL+T  G+ +RF +  +RVF GR+
Sbjct: 660 KLSDFVNVNRAGKIAMKLEEGDAIVGVALCTEDQDVLLSTASGRSIRFAVDEVRVFKGRD 719

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISG----DTEEITSLK 776
           S GVRG+ L + D VISMAI+   +A   ER  Y+KH ++ R  ++G     T  +    
Sbjct: 720 STGVRGVRLGEDDTVISMAILRRVEATPAERAAYLKHAASLRAAVTGEGEEATVVVEEEA 779

Query: 777 NDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKIN 836
            + + + ++S ER  EL   E+FILT+++ GFGKRTSSYD+R + R G+GI A D+SK  
Sbjct: 780 EEGAEDASLSVERIAELGAAEEFILTIADTGFGKRTSSYDYRRTGRGGQGIVAIDLSKR- 838

Query: 837 EIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVER 896
             G LVA FPV D DQ++LV+D G LIR PV++IR+A R T+GV IF T+  E+VVSVER
Sbjct: 839 -GGKLVASFPVEDTDQLLLVTDGGQLIRTPVSQIRVAGRNTQGVTIFRTS-GEKVVSVER 896

Query: 897 IRESEIVDEAESTE 910
           + E+   D  +  E
Sbjct: 897 LAETAEEDGPDEAE 910


>gi|27352960|dbj|BAC49961.1| DNA gyrase subunit A [Bradyrhizobium japonicum USDA 110]
          Length = 884

 Score =  965 bits (2493), Expect = 0.0,   Method: Composition-based stats.
 Identities = 554/886 (62%), Positives = 673/886 (75%), Gaps = 2/886 (0%)

Query: 25  MQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGK 84
           M+ SYL YA++VI+ RA+PD RDGLKPVHRRIL+ M + G   +KKYVK AR+ G+V+GK
Sbjct: 1   MKKSYLDYAMSVIVARALPDARDGLKPVHRRILYSMNEQGHTPDKKYVKSARVVGDVIGK 60

Query: 85  YHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLD 144
           YHPHG+ +IYDA+ RMAQD+S+R+ LI+GQGNFGSVDGDPPAA RYTE RL KAA  LL 
Sbjct: 61  YHPHGDQSIYDAMVRMAQDFSMRVPLIDGQGNFGSVDGDPPAAYRYTEARLTKAALALLA 120

Query: 145 DLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVA 204
           D+ KDTVDF+PNYD +  EP VL A++PN+LVNG GGIAVGMATNIP HNLGEV+D CVA
Sbjct: 121 DIDKDTVDFQPNYDNNETEPSVLPAKFPNLLVNGAGGIAVGMATNIPPHNLGEVIDACVA 180

Query: 205 VIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDRE 264
           +IDNP + +D L+ I+ GPDFPTG VILGR GI+ AY  GRGSIV+RG   IE    +RE
Sbjct: 181 LIDNPALTIDELINIVPGPDFPTGGVILGRAGIRAAYHLGRGSIVMRGKVAIETIRKERE 240

Query: 265 QIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVIL 324
            +++TEIPYQVNKA M+E+IAELV+EK+I  I DLRDESDR GYRVVIELKR A ADV+L
Sbjct: 241 ALIITEIPYQVNKATMVERIAELVKEKKIEGIGDLRDESDRDGYRVVIELKRDAVADVVL 300

Query: 325 NQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRA 384
           NQLYR+T LQ+ F VNMVAL+  +P    L  +L  FV FRE VV RRTK+LL KARDRA
Sbjct: 301 NQLYRFTPLQTSFGVNMVALDSGRPRIMHLKDLLAIFVDFRERVVTRRTKFLLAKARDRA 360

Query: 385 HVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSD 444
           H+LVGLAIAVAN+DE++R+IR SP+P TAR  LM R W A D++D++ LIDD  + I  D
Sbjct: 361 HILVGLAIAVANIDEMIRVIRTSPDPTTARDTLMSRDWPARDVEDMLTLIDDPRHRISPD 420

Query: 445 GTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQE 504
           GT+ LS  Q RAIL+LRL RLT LGRD+IR+EL+ L  EI + LDIL SR R+LGIIK E
Sbjct: 421 GTIRLSMEQARAILDLRLQRLTALGRDEIRDELDKLAGEIADYLDILRSRERVLGIIKTE 480

Query: 505 LLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGK 564
           L  VK E  TPRRT I+E   ++EDED I REDMVVTVSH GYVKRVPLS YRAQRRGGK
Sbjct: 481 LAEVKAEFATPRRTVIMEQEGEVEDEDLIQREDMVVTVSHAGYVKRVPLSAYRAQRRGGK 540

Query: 565 GRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSL 624
           GR+G+  RDEDFV+ LF+ STHT VLFFSS G VYKEKVWRLP+ +P ARGKALINIL L
Sbjct: 541 GRAGMQTRDEDFVSRLFVASTHTPVLFFSSRGQVYKEKVWRLPMAAPNARGKALINILPL 600

Query: 625 NQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEI 684
            QGERITTIMP PEDES+W NL V+FAT  GNVRRNKLSDF+ + RSG IAMKLD  + I
Sbjct: 601 EQGERITTIMPLPEDESTWGNLDVMFATTGGNVRRNKLSDFVDVRRSGIIAMKLDENEAI 660

Query: 685 LSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHA 744
           + V+ CT+ +D+LLT   GQC+RFP++ +RVF GR S+GVRGI+L +GD+VIS+AI+ H 
Sbjct: 661 VDVQICTERDDVLLTGAGGQCIRFPVTDVRVFTGRTSMGVRGIALGEGDKVISLAILRHV 720

Query: 745 DADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVS 804
           +   DER  Y+K   A     + +     +   ++S    +++ER  E+   EQ +LTVS
Sbjct: 721 ETTSDERSAYLKMRRAVAGEATAEEPAADAEAEETSGSFQLAQERYVEMSAAEQVVLTVS 780

Query: 805 EKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIR 864
             G+GKRTSSY++R + R GKGI A  V+  N  G LVA FPV D DQI+LV+DKG LIR
Sbjct: 781 VNGYGKRTSSYEYRTTGRGGKGIVAMSVNNRN--GNLVASFPVEDADQIMLVTDKGQLIR 838

Query: 865 VPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAESTE 910
            PV  IRIA R+T+GV++F TA+DE VVSVE I E        + E
Sbjct: 839 CPVEGIRIAGRSTQGVIVFDTAEDEHVVSVEHITEEAESGNGANGE 884


>gi|312116030|ref|YP_004013626.1| DNA gyrase subunit alpha [Rhodomicrobium vannielii ATCC 17100]
 gi|311221159|gb|ADP72527.1| DNA gyrase, A subunit [Rhodomicrobium vannielii ATCC 17100]
          Length = 941

 Score =  963 bits (2490), Expect = 0.0,   Method: Composition-based stats.
 Identities = 521/941 (55%), Positives = 673/941 (71%), Gaps = 34/941 (3%)

Query: 1   MTEHIISSDEEE-EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFG 59
           M +    +  +     I  + ITDEM+ SYL YA++VI+ RA+PD+RDGLKPVHRRILF 
Sbjct: 1   MADPSDGNKGDRGAGDIRPILITDEMKRSYLDYAMSVIVSRALPDVRDGLKPVHRRILFS 60

Query: 60  MMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS 119
           M + G  WNK Y K ARI G+V+GKYHPHG+ ++YDAL RM QD+S+R+ LI+GQGNFGS
Sbjct: 61  MSENGYSWNKPYRKSARIVGDVIGKYHPHGDQSVYDALVRMVQDFSMRVPLIDGQGNFGS 120

Query: 120 VDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGG 179
           VDGDPPAA RYTE RLQK +  LL+DL  DTVDF+ NYD S +EP VL AR+PN+LVNG 
Sbjct: 121 VDGDPPAAMRYTEVRLQKISDSLLNDLENDTVDFQDNYDNSEREPTVLPARFPNLLVNGA 180

Query: 180 GGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKN 239
           GGIAVGMATNIP HNLGEV+D C+A ++NP + ++ LME I GPDFPTG VI+GR GI+ 
Sbjct: 181 GGIAVGMATNIPPHNLGEVIDACLAFLENPALSIEQLMEHIPGPDFPTGGVIMGRAGIRA 240

Query: 240 AYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           AY  GRGS+V+RG  H+E    DR+ ++VTEIPYQVNKA + E+IAELVREKR+  I+D+
Sbjct: 241 AYLKGRGSVVVRGKVHVETIRKDRDALIVTEIPYQVNKATLQERIAELVREKRVEGISDV 300

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDESDR GYRVVIELKR A  DV+LNQLYR+TSLQS+F+ NMVALN  +PE+ TL+  ++
Sbjct: 301 RDESDRSGYRVVIELKRDAMPDVVLNQLYRFTSLQSVFAANMVALNSGRPEQHTLLDFIQ 360

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
           AF  FRE V+ RRTK+LL KARDRAHVLVGLA AVAN+DEV+++IR +P+P +AR  LM 
Sbjct: 361 AFTQFRETVITRRTKFLLGKARDRAHVLVGLATAVANIDEVIKLIRSAPDPASAREALMS 420

Query: 420 RSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           R W A DI  L+ LI+D    I       LS  Q +AILELRL RLT LGRD+I +EL +
Sbjct: 421 RDWPADDIAPLLLLIEDPRSRIHEGNVYRLSIDQAKAILELRLQRLTALGRDEIADELKA 480

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           L  +I++ L+ILSSR+R++ I++ EL ++K+E  TPRRT I++   +++DED I +EDMV
Sbjct: 481 LADKIRDYLNILSSRARVISIVRDELTAIKEEFATPRRTEILDVEGEVDDEDLIQKEDMV 540

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           VTVSH GY+KRVPLS YRAQRRGGKGRSG+  RDEDFVT LF+ +THT VLF SS G  Y
Sbjct: 541 VTVSHRGYIKRVPLSTYRAQRRGGKGRSGMTTRDEDFVTRLFVANTHTPVLFLSSRGMAY 600

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           K KVWRLP+ +PQARGKALIN+L L Q E IT+I+P PE+    + ++++FAT+ GNVRR
Sbjct: 601 KMKVWRLPLSAPQARGKALINLLPLQQDETITSILPLPEER-DESGVFILFATRSGNVRR 659

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           N+L+DF ++ ++GKIAMKLD  D+I   + C + +DILLTT  GQ +RFP++ +R+F GR
Sbjct: 660 NELADFAEVRQNGKIAMKLDPGDDIAGAQLCRETDDILLTTANGQAIRFPVTDVRIFKGR 719

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSL---- 775
            S GVRG+ L + D VIS+AI+ H +A   ER  Y+K  +A RR  +G+           
Sbjct: 720 ESTGVRGVRLDEDDTVISLAILRHMNATPAERAAYLKQANAMRRAAAGERAATEGDIVEQ 779

Query: 776 ----------------KNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRI 819
                             +S+   +++  R  E+   EQ++LT+SE+GFGKRTSSY++R 
Sbjct: 780 EAAAAAEAVEALDDGEAIESTDIADLTPARYGEMGAAEQYVLTMSERGFGKRTSSYEYRT 839

Query: 820 SNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKG 879
           S R GKGI A  V++ N  G L+A FPV D DQI+LV++ G LIR P+  I I  R+ +G
Sbjct: 840 SGRGGKGIIAMAVNERN--GRLIASFPVEDTDQIMLVTNGGKLIRCPIEGISITGRSAQG 897

Query: 880 VVIFSTAKDERVVSVERIR----------ESEIVDEAESTE 910
           V IF T +DERVVS E I             +   +AE  E
Sbjct: 898 VTIFRTDQDERVVSAELISDDGTGNGNGDGPDAGGDAEGEE 938



 Score = 57.9 bits (138), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 49/125 (39%), Gaps = 4/125 (3%)

Query: 645 NLYVVFATKHGNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTK 701
             YV+  ++ G  +R    ++    R   G IAM ++     +++       + I+L T 
Sbjct: 817 EQYVLTMSERGFGKRTSSYEYRTSGRGGKGIIAMAVNERNGRLIASFPVEDTDQIMLVTN 876

Query: 702 LGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQ 761
            G+ +R PI  I    GR++ GV      + ++V+S  ++                  A+
Sbjct: 877 GGKLIRCPIEGI-SITGRSAQGVTIFRTDQDERVVSAELISDDGTGNGNGDGPDAGGDAE 935

Query: 762 RRLIS 766
               +
Sbjct: 936 GEEPT 940


>gi|197104862|ref|YP_002130239.1| DNA gyrase subunit A [Phenylobacterium zucineum HLK1]
 gi|196478282|gb|ACG77810.1| DNA gyrase subunit A [Phenylobacterium zucineum HLK1]
          Length = 932

 Score =  963 bits (2489), Expect = 0.0,   Method: Composition-based stats.
 Identities = 520/916 (56%), Positives = 669/916 (73%), Gaps = 8/916 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+   +  ++   G+  ++I DE++ SYL YA++VI+ RA+PD+RDGLKPVHRRILF M
Sbjct: 1   MTDETHTPPDDRRGGVAPIAIEDELKRSYLDYAMSVIVSRALPDVRDGLKPVHRRILFSM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            + G   ++ YVK AR+ G+VMGKYHPHG+ AIYD + RMAQ +S+ LLLI+GQGNFGSV
Sbjct: 61  NEQGHTPDRGYVKSARVVGDVMGKYHPHGDVAIYDTMVRMAQPFSMNLLLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           D DPPAA RYTE R+ +AA  +L DL KDTVDF+ NYDGS QEPVVL +R PN+LVNG G
Sbjct: 121 DNDPPAAMRYTESRMTRAAMAILADLDKDTVDFKDNYDGSEQEPVVLPSRIPNLLVNGAG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEVVD C+A IDNP+I LD L++I+ GPDFPTG  I+GR+G + A
Sbjct: 181 GIAVGMATNIPPHNLGEVVDACLAYIDNPEIGLDELLDIVPGPDFPTGGEIIGRSGARQA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
             TGRGS+++RG + IE+   +RE IV+T IPYQVNKAA++E+IAELVREKRI  +ADLR
Sbjct: 241 LMTGRGSVIMRGKATIEEVRKEREAIVITAIPYQVNKAALVERIAELVREKRIEGVADLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR G RVV+E+KR ASA+VILNQLYRYT LQS F VNM+ALN  +PE+  L  ++ A
Sbjct: 301 DESDRDGMRVVVEMKRDASAEVILNQLYRYTPLQSSFGVNMLALNRGRPEQMGLREMVTA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV FREEVVVRRTK+ L+KARDR HVLVGLAIAVAN+DE + IIR S +P  AR  L+ +
Sbjct: 361 FVDFREEVVVRRTKFELSKARDRGHVLVGLAIAVANIDEFIHIIRSSKDPTEARERLVAK 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D+  L++LI D    +     + L++ Q RAIL L L+RLTGLGRD+I  E   L
Sbjct: 421 DWPAGDMLPLVELIADPRTLVIDGNKIRLTDEQARAILALTLSRLTGLGRDEIFGEAREL 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
              I+  L+IL+SR R++ I+++EL+ V+++   PRRT IVEG  D+EDED I RE+MV+
Sbjct: 481 AGVIRGHLEILASRERVMAIVREELVQVREQFAVPRRTEIVEGDADVEDEDLIAREEMVI 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TV+H GYVKR PL+ YR Q RGGKGRSG+  ++ED VT +F  +THT +LFFSS G  YK
Sbjct: 541 TVTHGGYVKRTPLATYRTQHRGGKGRSGMATKEEDAVTRVFSANTHTPMLFFSSGGKAYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
            KVWRLP+G+P +RGKA +N+L +  GE IT+I+P PEDE++W+   V+FAT+ GNVRRN
Sbjct: 601 LKVWRLPLGTPTSRGKAFVNLLPIEPGESITSILPLPEDEATWDQYDVMFATRSGNVRRN 660

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCT-QENDILLTTKLGQCVRFPISAIRVFAGR 719
           KLSDF+ I R+GKIAMKLD  D I+ V  C   +ND+LLTT LG+C+RF    +RVFAGR
Sbjct: 661 KLSDFVDIRRNGKIAMKLDEGDAIIGVGVCNAGQNDVLLTTALGRCIRFATEEVRVFAGR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR-----RLISGDTEEITS 774
           +S GVRGI LA+GD VISMAI+  A A   ER  Y+KH  A R          +T     
Sbjct: 721 DSTGVRGIRLAEGDSVISMAILRSAPATPAERAAYLKHAKAMRIATGEAEEGEETAAPEE 780

Query: 775 LKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSK 834
               +  E  +  ER  E+   E+ ILTVS +G+GKRTS+Y+FR + R G+G+ A D++K
Sbjct: 781 EDEANGEEAALGPERLAEMGAAEEIILTVSTEGYGKRTSAYEFRRTGRGGQGLLAQDLTK 840

Query: 835 INEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSV 894
               G L   FPV++ D+I+LVSD+G LIR+PV ++R+A R T+GV+IF  + DE VVSV
Sbjct: 841 R--GGKLAGSFPVDEGDEILLVSDQGQLIRIPVRQVRLAGRNTQGVIIFRKSADEHVVSV 898

Query: 895 ERIRESEIVDEAESTE 910
           ER+ E    DE E  +
Sbjct: 899 ERLAEPAGDDEVEDGD 914



 Score = 53.6 bits (127), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/126 (17%), Positives = 48/126 (38%), Gaps = 4/126 (3%)

Query: 648 VVFATKHGNVRRNKLSDFIQINRSGKIAMKL---DSRDEILSVETCTQENDILLTTKLGQ 704
           ++  +  G  +R    +F +  R G+  +         ++       + ++ILL +  GQ
Sbjct: 806 ILTVSTEGYGKRTSAYEFRRTGRGGQGLLAQDLTKRGGKLAGSFPVDEGDEILLVSDQGQ 865

Query: 705 CVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRL 764
            +R P+  +R  AGRN+ GV     +  + V+S+  +     D +     +         
Sbjct: 866 LIRIPVRQVR-LAGRNTQGVIIFRKSADEHVVSVERLAEPAGDDEVEDGDIGGEDGTDAG 924

Query: 765 ISGDTE 770
                +
Sbjct: 925 TDNGGD 930


>gi|304321597|ref|YP_003855240.1| DNA gyrase subunit A [Parvularcula bermudensis HTCC2503]
 gi|303300499|gb|ADM10098.1| DNA gyrase subunit A [Parvularcula bermudensis HTCC2503]
          Length = 924

 Score =  962 bits (2486), Expect = 0.0,   Method: Composition-based stats.
 Identities = 506/917 (55%), Positives = 660/917 (71%), Gaps = 12/917 (1%)

Query: 2   TEHIISS---DEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILF 58
           TE+I        + E+GI  +SIT+EMQ SYL YA++VI+ RAIPD RDGLKPVHRRIL+
Sbjct: 9   TENIPPQGAGSGDGEEGIAPISITEEMQKSYLDYAMSVIVSRAIPDARDGLKPVHRRILW 68

Query: 59  GMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFG 118
            M + G   +K++ K A + G+V+GKYHPHG+ A+YDAL RMAQ +S+RL L++GQGNFG
Sbjct: 69  SMQEQGYTHDKRHRKSANVVGDVIGKYHPHGDTAVYDALVRMAQHFSMRLPLLDGQGNFG 128

Query: 119 SVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNG 178
           S+D DPPAA RYTE R+   A  LL D+ KDTVDF   YDG  QEP VL AR+PN+LVNG
Sbjct: 129 SIDNDPPAAMRYTEVRMAAPAEALLADIDKDTVDFHETYDGERQEPGVLPARFPNLLVNG 188

Query: 179 GGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIK 238
            GGIAVGMATNIP HNLGE++D  V +ID P +  + L+ I+ GPDFPTGA I+G++G +
Sbjct: 189 AGGIAVGMATNIPPHNLGEIIDATVRLIDEPHVSDEELLSIVPGPDFPTGASIMGQSGAR 248

Query: 239 NAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIAD 298
            A  TGRGS+V+R  + +E+   DR  I+V++IP+QVNKAAM+E+IA LVREK++  IAD
Sbjct: 249 QALLTGRGSVVMRATTAVEEVRKDRFAIIVSDIPFQVNKAAMVERIAGLVREKKLEGIAD 308

Query: 299 LRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGIL 358
           LRDESDR G RVVIELKR A+A+V+LN LY+ + LQ+ F+ N++ALN  +PE+ TL  +L
Sbjct: 309 LRDESDRHGIRVVIELKRDANAEVVLNNLYKQSPLQTSFAYNLLALNRGRPEQMTLRTVL 368

Query: 359 KAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELM 418
           K+FV FREEVV RRTK+LL KARDRAHVLVGLAI+VAN+DEVVR+IR +PNP  AR  LM
Sbjct: 369 KSFVDFREEVVTRRTKHLLMKARDRAHVLVGLAISVANIDEVVRLIREAPNPAAAREALM 428

Query: 419 QRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELN 478
            R+W A D+  L+ L+ D  +++  DG++ LSE Q RAIL+LRL RLT LGRD+I +EL 
Sbjct: 429 GRNWPAKDLASLVALVADPRHSLQEDGSLRLSETQARAILDLRLQRLTALGRDEIGDELQ 488

Query: 479 SLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDM 538
           SL  +I + L IL  R R+L IIK EL  V++   TPR+T+ ++ +   + ED I REDM
Sbjct: 489 SLADKIADYLQILRDRDRVLTIIKDELADVRERFATPRKTQFIDAIEMED-EDLIAREDM 547

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           VVTVSH GYVKR  L  YRAQRRGGKGRSG+ M+D+DF++ LF+ +THT +LFF+  G  
Sbjct: 548 VVTVSHAGYVKRTSLDTYRAQRRGGKGRSGMAMKDDDFISQLFVGNTHTPLLFFTDRGMA 607

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVR 658
           YK K+WRLP G P +RGKA IN+L L+QGER+T I+P P+DE+ W ++ +VFAT+ GNVR
Sbjct: 608 YKLKLWRLPEGGPTSRGKAFINLLPLDQGERVTNILPLPDDEAQWADMDIVFATRSGNVR 667

Query: 659 RNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAG 718
           RNKLSDF  +N++GKIAMKLD  D ++ V    +  DILLTT+ G  +RFP+ A+RVF+G
Sbjct: 668 RNKLSDFTNVNKAGKIAMKLDEGDALVGVGIARESEDILLTTRNGMTIRFPVDAVRVFSG 727

Query: 719 RNSVGVRGISLAKGDQ-----VISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEIT 773
           R S GVRGI     D+     V+SMAI+ H D   +E   Y+KH +A RR  +G+ E   
Sbjct: 728 RTSTGVRGIRFKPNDEFGEDGVMSMAILRHLDVSSEEAKAYLKHAAAMRRA-AGEGETEG 786

Query: 774 SLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVS 833
           S       E  +S ER   ++  EQFILT +E G+GKRTSS+++R S R G+GI     S
Sbjct: 787 SDAEAEGSEAALSTERLAAMQAAEQFILTATENGYGKRTSSFEYRTSGRGGQGIAGIVTS 846

Query: 834 KINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVS 893
             N  G +VA FPV D D+I+LV+D G LIR  V +IR+A R T+GV I +T + ERVVS
Sbjct: 847 ARN--GRVVASFPVEDADEIMLVTDGGQLIRTGVADIRVAGRNTQGVKILTTRETERVVS 904

Query: 894 VERIRESEIVDEAESTE 910
           VE + E++  D+    E
Sbjct: 905 VEHVPEAQNDDDLPDDE 921


>gi|114707076|ref|ZP_01439975.1| DNA gyrase subunit A [Fulvimarina pelagi HTCC2506]
 gi|114537626|gb|EAU40751.1| DNA gyrase subunit A [Fulvimarina pelagi HTCC2506]
          Length = 950

 Score =  961 bits (2485), Expect = 0.0,   Method: Composition-based stats.
 Identities = 566/893 (63%), Positives = 702/893 (78%), Gaps = 6/893 (0%)

Query: 19  VSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARIS 78
           VSI DEMQ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+ M +MG+   + Y K A + 
Sbjct: 27  VSIIDEMQRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYAMHEMGLTSTRPYRKSAGVV 86

Query: 79  GEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKA 138
           GEVMGKYHPHG++AIYDAL RMAQDWSLR  LIEGQGN+GS+DGDPPAA RYTECRL+K 
Sbjct: 87  GEVMGKYHPHGDSAIYDALVRMAQDWSLRDRLIEGQGNYGSIDGDPPAAMRYTECRLRKI 146

Query: 139 AHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEV 198
           +  LL D+ K+TVDF+ NYDG  QEPVVL A +PN+LVNG GGIAVGMATNIP HNLGEV
Sbjct: 147 SDTLLADIDKETVDFQENYDGREQEPVVLPAGFPNLLVNGSGGIAVGMATNIPPHNLGEV 206

Query: 199 VDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEK 258
           +DGCVA+IDNP I L  +MEII GPDFPTGA++LG+ GI++AY+TGRGS+++RG  H E 
Sbjct: 207 IDGCVALIDNPAITLPEMMEIIPGPDFPTGAILLGKAGIQSAYSTGRGSLLMRGKVHTET 266

Query: 259 TSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGA 318
             GDRE I+VTE+PYQVNKA M+EK+AELVR+KRI  I+D+RDESDR+GYRVV+ELKR A
Sbjct: 267 IRGDREAIIVTEVPYQVNKATMIEKMAELVRDKRIEGISDIRDESDREGYRVVVELKRDA 326

Query: 319 SADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLN 378
           SADVILNQLYR+T LQ+ F  NMVALNG KPE+ TL+ +L AFVAFRE+VV RRTKYLL 
Sbjct: 327 SADVILNQLYRFTPLQTSFGANMVALNGGKPEQLTLMDMLSAFVAFREDVVNRRTKYLLR 386

Query: 379 KARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSS 438
           KAR+RAHVLVGLAIAVAN+DEV+++IR +P+P TAR +LM R W+A D+  L+ LIDD  
Sbjct: 387 KARERAHVLVGLAIAVANIDEVIKLIRAAPDPATAREQLMTREWDAKDVAPLVRLIDDPR 446

Query: 439 YTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLL 498
           + I   GT  LSE Q RAIL+LRL RLT LGRD+I +EL  +G EIK+ L+ILSSR+R++
Sbjct: 447 HRISDQGTYRLSEAQARAILDLRLQRLTALGRDEIGDELEKIGAEIKDYLEILSSRTRVM 506

Query: 499 GIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRA 558
            IIK EL +++DE  TPRRT + EG  D+EDED I REDMVVTVSH GY+KRVPLSVYR+
Sbjct: 507 QIIKDELTAIRDEFATPRRTELSEGAADLEDEDLIPREDMVVTVSHGGYIKRVPLSVYRS 566

Query: 559 QRRGGKGRSGVVMRDE-DFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKA 617
           QRRGGKGRSG+ ++++ D VT LF+ +THT VLFFSS G VYKEKVWRLP+ +PQ RGKA
Sbjct: 567 QRRGGKGRSGMSLKNDEDSVTRLFVANTHTPVLFFSSRGIVYKEKVWRLPLTTPQGRGKA 626

Query: 618 LINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMK 677
           L+N+L L + ERIT+I+P P +E +     V+FAT  G VRRNKLSDF  +NR+GKIAMK
Sbjct: 627 LVNLLPLEKNERITSILPLPNEEEAAERTNVMFATTRGTVRRNKLSDFTNVNRNGKIAMK 686

Query: 678 LDSR-DEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVI 736
           LD   D IL V TC++++D+LLT   GQC+RFP + +RVFAGRNSVGVRGISL K + V+
Sbjct: 687 LDDEQDSILGVATCSEDDDVLLTASSGQCIRFPTTDVRVFAGRNSVGVRGISLGKSETVV 746

Query: 737 SMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLK 796
           SMAI+ H DA  +ER  Y+K     RR + GDT   +    ++  +  I +ER  EL  +
Sbjct: 747 SMAILRHVDASAEERATYLK----MRRAVEGDTNGESDSDEEAVADVAIDQERYAELGAR 802

Query: 797 EQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILV 856
           E+ ILTVSE G+GKR+SSY+FR S R GKGIRATD ++++++GALVA FPV + DQ++LV
Sbjct: 803 EEMILTVSEYGYGKRSSSYEFRTSGRGGKGIRATDTNRLDKLGALVAGFPVENEDQLLLV 862

Query: 857 SDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAEST 909
           +D+G +IRVPV+ I +  RAT GV IF TA  ERVVSVERI +    +  E+ 
Sbjct: 863 TDRGQVIRVPVDGIGMKGRATGGVTIFRTADGERVVSVERIPDQGTDETGEAD 915



 Score = 53.6 bits (127), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 49/305 (16%), Positives = 94/305 (30%), Gaps = 48/305 (15%)

Query: 529 DEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTS 588
           +E+       V+  +  G V+R  LS +    R GK    +    +     +   S    
Sbjct: 647 NEEEAAERTNVMFATTRGTVRRNKLSDFTNVNRNGKIAMKLDDEQDSI-LGVATCSEDDD 705

Query: 589 VLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYV 648
           VL  +S G   +     + + + +         L  ++      I+   +  +     Y+
Sbjct: 706 VLLTASSGQCIRFPTTDVRVFAGRNSVGVRGISLGKSETVVSMAILRHVDASAEERATYL 765

Query: 649 VF-----------------------------------------ATKHGNVRRNKLSDFIQ 667
                                                       +++G  +R+   +F  
Sbjct: 766 KMRRAVEGDTNGESDSDEEAVADVAIDQERYAELGAREEMILTVSEYGYGKRSSSYEFRT 825

Query: 668 INR-----SGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSV 722
             R           +LD    +++      E+ +LL T  GQ +R P+  I    GR + 
Sbjct: 826 SGRGGKGIRATDTNRLDKLGALVAGFPVENEDQLLLVTDRGQVIRVPVDGI-GMKGRATG 884

Query: 723 GVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVE 782
           GV     A G++V+S+  +     D           S       GD      +++    E
Sbjct: 885 GVTIFRTADGERVVSVERIPDQGTDETGEADADVTDSVAPDGGDGDGGSDGPMRDAEGDE 944

Query: 783 GNISE 787
           G+I E
Sbjct: 945 GSIDE 949


>gi|159044025|ref|YP_001532819.1| DNA gyrase subunit A [Dinoroseobacter shibae DFL 12]
 gi|157911785|gb|ABV93218.1| DNA gyrase, A subunit [Dinoroseobacter shibae DFL 12]
          Length = 913

 Score =  959 bits (2479), Expect = 0.0,   Method: Composition-based stats.
 Identities = 492/913 (53%), Positives = 637/913 (69%), Gaps = 12/913 (1%)

Query: 1   MTEHIISSDEEEE-----KGITS-VSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHR 54
           MT+     +  +E       I   +SI +EM++SYL YA++VI+ RAIPDLRDGLKPVHR
Sbjct: 1   MTDTPEPPENTDETPPGGGRIQETISIAEEMKSSYLDYAMSVIVSRAIPDLRDGLKPVHR 60

Query: 55  RILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQ 114
           RIL+ M + G    K Y K AR  G+VMGKYHPHG++AIYDAL RMAQD+S+ L L++GQ
Sbjct: 61  RILYAMHETGNTHEKAYRKSARPVGDVMGKYHPHGDSAIYDALVRMAQDFSMSLPLLDGQ 120

Query: 115 GNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNV 174
           GNFGS+DGD PAA RYTE R+ K A  LL D+ K+TVDF+ NYDG  +EP VL AR+PN+
Sbjct: 121 GNFGSMDGDNPAAMRYTEVRMDKPAAALLADIEKETVDFQDNYDGKDREPTVLPARFPNM 180

Query: 175 LVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGR 234
           LVNG GGIAVGMATNIP HNLGEV+D  +A+I+ PD++++ LM+ I  PDFPTG  ILGR
Sbjct: 181 LVNGAGGIAVGMATNIPPHNLGEVIDATLALIETPDLEVEDLMQYIPAPDFPTGGQILGR 240

Query: 235 TGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIV 294
            G + AY  GRGS++IR  + IE+   DR  IV+ EIPYQVNK++M+EKIAELVREKRI 
Sbjct: 241 GGARKAYLEGRGSVIIRAKTRIEELRKDRYAIVLDEIPYQVNKSSMIEKIAELVREKRIE 300

Query: 295 DIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTL 354
            IA ++DESDR G RVVIELKR A+ +V+LNQLYR+T +Q+ F  NM+ALNG +PE+ TL
Sbjct: 301 GIAHVQDESDRVGVRVVIELKRDATPEVVLNQLYRFTPMQTSFGCNMLALNGGRPEQLTL 360

Query: 355 IGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETAR 414
              L +F++FREEVV RRT Y L KAR+R+HVL GLA+AV+N+DEVV  IR S +   AR
Sbjct: 361 KDFLSSFISFREEVVARRTAYDLRKARERSHVLCGLAVAVSNVDEVVATIRASADAAEAR 420

Query: 415 RELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIR 474
            +LM R W A+DI D I LIDD ++T+  DGT  LSE Q RAIL+LRL RLT +G  ++ 
Sbjct: 421 EKLMTRRWPAADIADYIRLIDDPTHTMNEDGTYNLSETQARAILDLRLQRLTQIGVKEVT 480

Query: 475 NELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIV 534
           +EL  L  +I+E LDIL SRSR++ II  EL  VKD+   PRRT I +   DMEDED I 
Sbjct: 481 DELQELAAKIQEYLDILRSRSRIMAIISDELREVKDQFAVPRRTEITDWSGDMEDEDLIE 540

Query: 535 REDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSS 594
           REDMVVTV+  GY+KR PL  +RAQRRGGKG +G+  +++D VT LF+ +THT +L F++
Sbjct: 541 REDMVVTVTSGGYIKRTPLVEFRAQRRGGKGLAGMATKEDDVVTTLFVANTHTPLLVFTT 600

Query: 595 LGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKH 654
            G VYK K WRLP G   ARGKAL+N+L ++ G  I  IMP    E  W +L +VFAT  
Sbjct: 601 DGMVYKLKTWRLPSGGRNARGKALVNVLPIDPGTSIAAIMPVDRAEEDWADLQIVFATSA 660

Query: 655 GNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIR 714
           G+VRRN LSDF  + R+GKIAMKL     ++    C++E+D++L T LG+ +RF  + +R
Sbjct: 661 GDVRRNALSDFTNVMRNGKIAMKLPEGVSLVKARICSEEDDVMLVTALGRAIRFRTTDVR 720

Query: 715 VFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITS 774
           VF GR+S GVRG+ LA+GD+V+SMA++ H  AD  ER  Y+K     RR ++G +EE  S
Sbjct: 721 VFKGRDSTGVRGVRLAEGDRVVSMAVIRHFVADPQERAAYLK----MRRAVAGLSEEAES 776

Query: 775 LKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSK 834
              D+   G +S ER  E+   E  ILT++E G GK +SS+D+ +  R G+G+ A D  K
Sbjct: 777 EDEDTVEAGQLSPERYAEMSAAEDLILTITEGGTGKISSSHDYPVRGRGGQGVTAMD--K 834

Query: 835 INEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSV 894
               G LVA FPV  +DQI+L +  G  IR PV+ I   SRA  GV +F+TA  E+VVSV
Sbjct: 835 AMRGGPLVACFPVEIDDQIMLATSTGQSIRCPVDGISFRSRAAGGVKVFNTAPGEQVVSV 894

Query: 895 ERIRESEIVDEAE 907
             I +    D  +
Sbjct: 895 AYIADRGEADGDD 907



 Score = 50.2 bits (118), Expect = 0.002,   Method: Composition-based stats.
 Identities = 38/223 (17%), Positives = 73/223 (32%), Gaps = 13/223 (5%)

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
             ED V+ V+ LG   R   +  R     G+  +GV          +  ++     +   
Sbjct: 697 SEEDDVMLVTALGRAIRFRTTDVRV--FKGRDSTGVRGVRLAEGDRVVSMAVIRHFVADP 754

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
                Y               G +               + P    E S     ++  T+
Sbjct: 755 QERAAY-------LKMRRAVAGLSEEAESEDEDTVEAGQLSPERYAEMSAAEDLILTITE 807

Query: 654 HGNVRRNKLSDFI---QINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPI 710
            G  + +   D+    +  +      K      +++      ++ I+L T  GQ +R P+
Sbjct: 808 GGTGKISSSHDYPVRGRGGQGVTAMDKAMRGGPLVACFPVEIDDQIMLATSTGQSIRCPV 867

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERIC 753
             I  F  R + GV+  + A G+QV+S+A +        +   
Sbjct: 868 DGI-SFRSRAAGGVKVFNTAPGEQVVSVAYIADRGEADGDDPA 909


>gi|260433573|ref|ZP_05787544.1| DNA gyrase, A subunit [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417401|gb|EEX10660.1| DNA gyrase, A subunit [Silicibacter lacuscaerulensis ITI-1157]
          Length = 909

 Score =  959 bits (2479), Expect = 0.0,   Method: Composition-based stats.
 Identities = 477/911 (52%), Positives = 629/911 (69%), Gaps = 13/911 (1%)

Query: 1   MTEHIISSDEEEEKGIT-------SVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVH 53
           M++     +  +E           +VSI  EM+ SYL YA++VI+ RAIPDLRDGLKPVH
Sbjct: 1   MSDTPEIPENMDETPPERPVYDGPTVSIESEMRTSYLDYAMSVIVSRAIPDLRDGLKPVH 60

Query: 54  RRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEG 113
           RRIL+ M + G   +K Y K AR  G+VMGKYHPHG++AIYDAL RMAQD+S+ L L++G
Sbjct: 61  RRILYAMHETGNTHDKPYRKSARPVGDVMGKYHPHGDSAIYDALVRMAQDFSMSLPLLDG 120

Query: 114 QGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPN 173
           QGNFGS+DGD PAA RYTE R+ K A  LL D+ K+TVDF+ NYDG  +EP VL AR+PN
Sbjct: 121 QGNFGSMDGDNPAAMRYTEVRMDKPAAALLADIEKETVDFQDNYDGKDKEPTVLPARFPN 180

Query: 174 VLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILG 233
           +LVNG GGIAVGMATNIP HNLGEVVD  +A+I++PD+  + L+E I GPDFPTG V+LG
Sbjct: 181 MLVNGAGGIAVGMATNIPPHNLGEVVDATLALIEDPDLTSEQLIEYIPGPDFPTGGVMLG 240

Query: 234 RTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRI 293
           R+G + AY  GRGS++IR  + +E+   DR  IVV EIPYQVNKA+M+EKIAE VREKRI
Sbjct: 241 RSGARKAYLEGRGSVIIRAKTRVEEIRKDRYAIVVDEIPYQVNKASMIEKIAEAVREKRI 300

Query: 294 VDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFT 353
             ++ ++DESDR G RVV+ELKR A+ +V+LNQLYR+T +Q+ F  NM+ALNG +PE+ T
Sbjct: 301 EGVSHVQDESDRNGVRVVVELKRDATPEVVLNQLYRFTPMQTSFGCNMLALNGGRPEQLT 360

Query: 354 LIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETA 413
           L   L +F+ FRE+VV RRT Y L KAR+R+HVL GLA+AV+N+DEVV  IR S +   A
Sbjct: 361 LRRFLTSFIDFREDVVARRTAYDLRKARERSHVLCGLAVAVSNVDEVVATIRSSADAAEA 420

Query: 414 RRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDI 473
           R +LM R W A++I+  + LIDD    +  DGT  LSE Q RAIL+LRL RLT +G  ++
Sbjct: 421 REKLMTRRWPAAEIESYLRLIDDPLSKMNDDGTYNLSEAQARAILDLRLQRLTQIGVKEV 480

Query: 474 RNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCI 533
            +EL  L  +IKE LDILSSR R++GII  EL  VK+    PRRT+IV+   DMEDED I
Sbjct: 481 TDELEDLAAKIKEYLDILSSRERIMGIIADELREVKENFAVPRRTQIVDWSGDMEDEDLI 540

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
            REDMVVTV+  GY+KR PL+ +RAQ+RGGKG SG+  ++ED VT LF+ +THT +LFF+
Sbjct: 541 EREDMVVTVTSGGYIKRTPLADFRAQKRGGKGLSGMQTKEEDVVTTLFVANTHTQLLFFT 600

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           + G VYK K WRLP      +GKA++NIL +  G  I  IMP    +  W NL +VFAT 
Sbjct: 601 TDGMVYKLKTWRLPQSGRTGKGKAIVNILPIPTGVSIAAIMPVDVPDEEWENLQIVFATS 660

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAI 713
            G+VRRN LSDF  + R+GKIAM L    E+++   C++++D++L T  G+ +RFP + +
Sbjct: 661 AGDVRRNALSDFTNVKRNGKIAMDLPEGVELVNARICSEDDDVMLVTNSGRAIRFPTTDV 720

Query: 714 RVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEIT 773
           RVF GR S GVRGI L  GD+V+SM+++ H+    ++R  Y+K     RR ++G T++  
Sbjct: 721 RVFKGRKSTGVRGIRLNDGDRVVSMSVIRHSKYTPEQRTAYLK----MRRAMAGLTDDAE 776

Query: 774 SLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVS 833
               ++  + N S E   E+   E  ILT++  G GK +SS+D+ +  R G G+ A D  
Sbjct: 777 PSDEEAVADPNFSTELYAEMSAVENLILTITAGGSGKLSSSHDYPVRGRGGMGVMAMD-- 834

Query: 834 KINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVS 893
           K    G LVA FPV  +DQI+L + KG  IRVPV+ I   SR+  GV +F+T K E VVS
Sbjct: 835 KAMRGGPLVASFPVEMDDQIMLATSKGQSIRVPVDGISFRSRSAGGVKVFNTGKGEEVVS 894

Query: 894 VERIRESEIVD 904
           V RI +    +
Sbjct: 895 VARIADQGDDE 905


>gi|144899944|emb|CAM76808.1| DNA gyrase, subunit A [Magnetospirillum gryphiswaldense MSR-1]
          Length = 894

 Score =  958 bits (2476), Expect = 0.0,   Method: Composition-based stats.
 Identities = 503/891 (56%), Positives = 672/891 (75%), Gaps = 29/891 (3%)

Query: 9   DEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWN 68
               +  +T V+I +EM+ SYL YA++VI+ RA+PD+RDGLKPVHRRILF M + G ++N
Sbjct: 5   PSPSQFDVTPVTIEEEMRRSYLDYAMSVIVSRALPDVRDGLKPVHRRILFAMKEGGYDYN 64

Query: 69  KKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAE 128
           K + K ARI G+VMGKYHPHG++AIYDA+ RMAQ +S+RL LI+GQGNFGS+DGD  AA 
Sbjct: 65  KPFRKSARIVGDVMGKYHPHGDSAIYDAMVRMAQSFSMRLPLIDGQGNFGSMDGDKAAAM 124

Query: 129 RYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMAT 188
           RYTE R+ ++AHFL++D+ KDTVDF PNYD S  EP+VL ARYPN+LVNG GGIAVGMAT
Sbjct: 125 RYTEARMARSAHFLIEDIDKDTVDFGPNYDDSSVEPLVLPARYPNLLVNGAGGIAVGMAT 184

Query: 189 NIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSI 248
           NIP HNLGEV+D C A+IDNPDI  + +ME++ GPDFPTG  ILGR+GI+ A  TGRGS+
Sbjct: 185 NIPPHNLGEVIDACCAMIDNPDITPEEVMELVPGPDFPTGGTILGRSGIRAAQLTGRGSV 244

Query: 249 VIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           V+RG  HIE+   DRE I+VTE+PYQVNKA M+E+IAELVR+K+I  ++DLRDESDR G 
Sbjct: 245 VMRGRCHIEEVRKDREAIIVTEVPYQVNKARMIEQIAELVRDKKIEGVSDLRDESDRDGV 304

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVIE+KR A ADV+L QLY++T LQ+ F VN +ALNG +P+  TL  I+ AF+ FREEV
Sbjct: 305 RVVIEIKRDAIADVVLAQLYKFTPLQTSFGVNSLALNGGRPQMMTLREIIAAFLRFREEV 364

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           + RRT + L KARDRAHVLVGL+IAVAN+D+++++IR + +P  AR +LM R W A D++
Sbjct: 365 ITRRTIFELGKARDRAHVLVGLSIAVANIDDMIKLIREASDPAVAREQLMARKWPALDVE 424

Query: 429 DLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECL 488
            LI LID+    I  DGT  LSEVQ +AIL+LRL RLTGL RD I +EL  +G +IKE L
Sbjct: 425 PLIRLIDEPGRGI-VDGTYSLSEVQAKAILDLRLHRLTGLERDKIGDELREIGEQIKEFL 483

Query: 489 DILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYV 548
           +ILSSR +LL +++ EL+ ++++  TPRRT I +   + + ED I REDMVVTV++ GY+
Sbjct: 484 EILSSRPKLLEVMRNELIDMRNQFATPRRTTIEDSEFEADIEDLIAREDMVVTVTNTGYI 543

Query: 549 KRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPI 608
           KRVPLS YRAQ+RGGKGRSG+ M+DEDF++ +F+ STHT VLFFSS G  YK KV+RLP+
Sbjct: 544 KRVPLSTYRAQKRGGKGRSGMSMKDEDFLSQVFVTSTHTPVLFFSSTGIAYKLKVYRLPL 603

Query: 609 GSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQI 668
           G+PQARGKA++NIL L +GE I+T+MP PEDE++W +L+V FAT  G+VRRN LSDF+ I
Sbjct: 604 GTPQARGKAMVNILPLGEGETISTVMPMPEDETTWGDLHVAFATSKGDVRRNLLSDFVDI 663

Query: 669 NRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGIS 728
             +GKIAMKL+  +++++V+ C+  +DILL T+LG+ +RF +  +RVF GR+S GVRGI 
Sbjct: 664 RANGKIAMKLNDGEQLIAVQPCSDSDDILLATRLGKAIRFQVGDVRVFKGRDSTGVRGIR 723

Query: 729 LAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEE 788
           L   DQVISM+++ H + D + R  Y+++                          +++  
Sbjct: 724 LDDADQVISMSVLRHVEFDMETRDAYLRN--------------------------DLTGP 757

Query: 789 RCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVN 848
             + +   EQ ILTV+E G+GKRTS+Y++RI+ R G+GI   D+++ N  G +VA FPV 
Sbjct: 758 EAERMSESEQMILTVTENGYGKRTSAYEYRITGRGGQGIANIDLTEKN--GPVVASFPVG 815

Query: 849 DNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            +D+I+LVSD GTLIR+PV++IRIA R T+GV++  TA++ERVVS  R+ +
Sbjct: 816 HDDEIMLVSDGGTLIRMPVDDIRIAGRKTQGVIVLRTAENERVVSTARLCD 866



 Score = 69.4 bits (168), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 43/255 (16%), Positives = 91/255 (35%), Gaps = 25/255 (9%)

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           V   +  G V+R  LS +   R  GK    + + D + +  +   S    +L  + LG  
Sbjct: 643 VAFATSKGDVRRNLLSDFVDIRANGKI--AMKLNDGEQLIAVQPCSDSDDILLATRLGKA 700

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYV---------- 648
            + +V  + +   +         L         +++   E +    + Y+          
Sbjct: 701 IRFQVGDVRVFKGRDSTGVRGIRLDDADQVISMSVLRHVEFDMETRDAYLRNDLTGPEAE 760

Query: 649 ---------VFATKHGNVRRNKLSDFI-QINRSGKIA-MKLDSRDEILSVETCTQ-ENDI 696
                    +  T++G  +R    ++         IA + L  ++  +        +++I
Sbjct: 761 RMSESEQMILTVTENGYGKRTSAYEYRITGRGGQGIANIDLTEKNGPVVASFPVGHDDEI 820

Query: 697 LLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMK 756
           +L +  G  +R P+  IR  AGR + GV  +  A+ ++V+S A +   +   +E      
Sbjct: 821 MLVSDGGTLIRMPVDDIR-IAGRKTQGVIVLRTAENERVVSTARLCDLNGSNEESEEEFD 879

Query: 757 HMSAQRRLISGDTEE 771
                     G  +E
Sbjct: 880 EGDDTAATPPGGDDE 894


>gi|114768820|ref|ZP_01446446.1| DNA gyrase subunit A [alpha proteobacterium HTCC2255]
 gi|114549737|gb|EAU52618.1| DNA gyrase subunit A [alpha proteobacterium HTCC2255]
          Length = 905

 Score =  958 bits (2475), Expect = 0.0,   Method: Composition-based stats.
 Identities = 471/912 (51%), Positives = 636/912 (69%), Gaps = 20/912 (2%)

Query: 1   MTEHIISSDEEEEK----GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRI 56
           MT+ I +  ++  +        +SI +EM+ SYL YA++VI+ RAIPDLRDGLKPVHRRI
Sbjct: 1   MTDEIKTPTDDTPEIPSYDGPQISIEEEMKTSYLDYAMSVIVSRAIPDLRDGLKPVHRRI 60

Query: 57  LFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGN 116
           L+ M + G   NK Y K A+  G+VMG YHPHG++AIYDAL RMAQD+S+ L LI+GQGN
Sbjct: 61  LYAMHENGYTHNKSYRKSAKSVGDVMGSYHPHGDSAIYDALVRMAQDFSMSLPLIDGQGN 120

Query: 117 FGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLV 176
           FGS+DGD  AA RYTE RL K + +LL D+ K+TV+F+ NYDG   EP VL ARYPN+LV
Sbjct: 121 FGSMDGDNAAAMRYTEARLDKPSEYLLLDIDKNTVNFQDNYDGKESEPTVLPARYPNMLV 180

Query: 177 NGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTG 236
           NG GGIAVGMATNIP HNLGEV+D  +A+IDNP++    LME +  PDFPTGAVILGR+G
Sbjct: 181 NGAGGIAVGMATNIPPHNLGEVIDATLALIDNPELTSSDLMEYVPAPDFPTGAVILGRSG 240

Query: 237 IKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDI 296
              AY  GRGS++IR  + +E+    R  I++ EIPYQVNKA+M+EKIAEL R+K+I  I
Sbjct: 241 AVKAYNEGRGSVIIRAKTRVEEIRAGRYAIIIDEIPYQVNKASMIEKIAELSRDKKIEGI 300

Query: 297 ADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIG 356
           + ++DESDR G RVV+ELKR A+A+V+LNQL+R+T LQ+ F  NM+ALNG KPE+ TL  
Sbjct: 301 SHVQDESDRVGVRVVVELKRDATAEVVLNQLFRFTPLQTSFGCNMLALNGGKPEQLTLYK 360

Query: 357 ILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRE 416
            L  F++FREEVV RRT + LNKAR+R+H+L GLA+AV+N+DE+V  IR S +P  AR +
Sbjct: 361 FLSYFISFREEVVARRTAFELNKARERSHILCGLAVAVSNVDEIVATIRGSNDPAEAREK 420

Query: 417 LMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNE 476
           LM R W A+DI   I LIDD S+T+  D +  LSE Q RAILELRL RLT +G  ++ +E
Sbjct: 421 LMTRRWPAADISQYISLIDDPSHTLNEDKSYNLSETQARAILELRLQRLTAMGVKEVTDE 480

Query: 477 LNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVRE 536
           L  L  +I+  L+IL SR R++ II  EL  V ++   PRRT I+E   DM+DED I +E
Sbjct: 481 LEELAGKIQNYLEILRSRDRIMSIISDELKEVHEKFAVPRRTEIIEWAGDMDDEDLIEKE 540

Query: 537 DMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLG 596
           DMVVT+++ GY+KR  L+ +R Q+RGGKG  G+  +DEDFVT++F+ +THT++LFF++ G
Sbjct: 541 DMVVTITNSGYIKRTNLAEFREQKRGGKGIQGMSTKDEDFVTNMFVANTHTALLFFTTDG 600

Query: 597 FVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGN 656
            VYK K WRLP+G   A+GKA++NIL ++ G  I  +MP    +  W NL +VFAT  G 
Sbjct: 601 MVYKLKTWRLPLGGRNAKGKAIVNILPIDTGVSIAALMPIDAPDEEWGNLQIVFATDAGG 660

Query: 657 VRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVF 716
           VRRN LSDF  +  +GKIAMKL     I++V   T+ +D LLTT LG+ +RFP + +RVF
Sbjct: 661 VRRNALSDFTNVKSNGKIAMKLPEGVSIVNVRIATESDDFLLTTSLGKAIRFPTTDVRVF 720

Query: 717 AGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLK 776
            GR+S GVRGI LA GD+V+SMA++ H +A  DER  Y K   A              L 
Sbjct: 721 KGRDSTGVRGIKLAPGDKVVSMAVIRHVNASSDERTAYFKMRRA--------------LS 766

Query: 777 NDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKIN 836
            D +   +IS+ER  EL   E +IL ++  GFGKR+S++++R+S R G+G+ A ++ + +
Sbjct: 767 EDETPNNDISQERYNELSELEDWILIITSGGFGKRSSAHEYRVSGRGGQGVAAANLDRRD 826

Query: 837 EIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVER 896
           +   +VA F V++ DQI+L +  G  IR PV+ I +  R++ GV +F+T   E+VVSV  
Sbjct: 827 DT--VVAAFTVHEEDQIMLATSTGQSIRCPVSGISLQGRSSSGVTVFNTKDGEKVVSVAY 884

Query: 897 IRESEIVDEAES 908
           I ++E  D ++ 
Sbjct: 885 IADTEDSDVSDD 896


>gi|182679031|ref|YP_001833177.1| DNA gyrase, A subunit [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634914|gb|ACB95688.1| DNA gyrase, A subunit [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 929

 Score =  956 bits (2471), Expect = 0.0,   Method: Composition-based stats.
 Identities = 545/900 (60%), Positives = 673/900 (74%), Gaps = 4/900 (0%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           M +H  +        I  VS++DEMQ+SYL YA++VI+ RA+PD+RDGLKPVHRRILF M
Sbjct: 1   MADHDENGQGPGGSDIKPVSLSDEMQSSYLAYAMSVIVSRALPDVRDGLKPVHRRILFSM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            +     ++ YVK ARI G+VMGKYHPHG+ AIYDAL RMAQ +S+RL LI+GQGNFGSV
Sbjct: 61  HENNHTPDRPYVKSARIVGDVMGKYHPHGDTAIYDALVRMAQGFSMRLPLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGDPPAA RYTE RL + A  LL D+  DTVDF+PNYDG   EPVVL AR+PN+LVNG G
Sbjct: 121 DGDPPAAMRYTESRLARPALALLADIDSDTVDFQPNYDGKEHEPVVLPARFPNLLVNGAG 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEV+D  +A+IDNP++ ++ L  I+ GPDFPTG  ILGR GI++A
Sbjct: 181 GIAVGMATNIPPHNLGEVIDAVIALIDNPEMSIEELTAIVPGPDFPTGGSILGRAGIRSA 240

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           YATGRGS+++R    IE+    RE ++VTEIPYQVNKA ++EKIAELVREKRI  I+DLR
Sbjct: 241 YATGRGSVLMRAKIEIEEIREKREALIVTEIPYQVNKATLIEKIAELVREKRIEGISDLR 300

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDRQG R+VIE+KR A  D++LNQL+RYT+LQS F  NM+ALNG +PE  TL   L A
Sbjct: 301 DESDRQGMRIVIEIKRDAVPDIVLNQLWRYTALQSSFPCNMIALNGGRPETLTLRDFLTA 360

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           F+ FREEVV RRTKYLL KARD AH+ VGLAIAVAN+DEV+R+IR S +   AR  L  R
Sbjct: 361 FIDFREEVVTRRTKYLLGKARDAAHLQVGLAIAVANIDEVIRLIRTSADAAEARAALCAR 420

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A D+  LI LI D  +T+  +GT+ LSE Q RAILELRL RLT LGRD+I   LN L
Sbjct: 421 DWPARDMAPLIALIADPRHTLTPEGTIRLSEAQARAILELRLQRLTALGRDEIAENLNKL 480

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
             EI + LDIL SR+RL GIIK E+++VK+   TPRRT I++    ++DED I REDMVV
Sbjct: 481 AAEIADYLDILGSRARLFGIIKDEMIAVKEAHATPRRTIILDSDAGVDDEDLIQREDMVV 540

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TVSH GY+KRVPLS YRAQRRGGKGRSG+  RD+DFV  LF+ STH  VLFFSS G VYK
Sbjct: 541 TVSHAGYIKRVPLSTYRAQRRGGKGRSGMQTRDQDFVARLFVASTHAPVLFFSSRGQVYK 600

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
           EKVWRLP+ +PQA GKAL+NIL L Q ERITTIMP PEDE  W +L V+FAT  G VRRN
Sbjct: 601 EKVWRLPLSAPQALGKALVNILPLEQDERITTIMPLPEDEKQWESLDVMFATTRGTVRRN 660

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
           KLSDF Q+NR+GKIAM+LD  ++I+ V+ CT+++D+LLTT  GQC+RF ++ +RVF GR+
Sbjct: 661 KLSDFAQVNRAGKIAMRLDEGEQIVDVQICTEQDDVLLTTANGQCIRFAVTDVRVFKGRD 720

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSS 780
           S+GVRGI+L +GD+VIS+AI+ H +AD DER  Y+K   A     + +        N   
Sbjct: 721 SMGVRGIALGEGDRVISLAILRHIEADSDERTAYLKRRRAVAGETAEEAASEAEEANAEE 780

Query: 781 VEG--NISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEI 838
             G  ++S ER  E+   EQ ILT+S  G+GKRTSS+++RI+ R GKGI A  V+  N  
Sbjct: 781 ALGSTSLSLERYAEMSAGEQIILTISANGYGKRTSSFEYRITGRGGKGIVAMAVNARN-- 838

Query: 839 GALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
           G LVA  PV + D I+LV++ G LIR PV  IR+A R T+GV++F+TA+DE+VVSVERI 
Sbjct: 839 GKLVASMPVEEGDGIMLVTNGGQLIRCPVEGIRVAGRGTQGVIVFNTAEDEQVVSVERIP 898



 Score = 53.6 bits (127), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/130 (19%), Positives = 56/130 (43%), Gaps = 6/130 (4%)

Query: 648 VVFATKHGNVRRNKLSDFI----QINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLG 703
           ++  + +G  +R    ++            +A+   +  ++++     + + I+L T  G
Sbjct: 802 ILTISANGYGKRTSSFEYRITGRGGKGIVAMAVNARNG-KLVASMPVEEGDGIMLVTNGG 860

Query: 704 QCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRR 763
           Q +R P+  IRV AGR + GV   + A+ +QV+S+  +   +A+  E     +       
Sbjct: 861 QLIRCPVEGIRV-AGRGTQGVIVFNTAEDEQVVSVERIPEDEAERGEEEGPGEQGPLGDS 919

Query: 764 LISGDTEEIT 773
             S + +   
Sbjct: 920 GPSDNGDTPE 929


>gi|46202307|ref|ZP_00208476.1| COG0188: Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase
           IV), A subunit [Magnetospirillum magnetotacticum MS-1]
          Length = 898

 Score =  955 bits (2469), Expect = 0.0,   Method: Composition-based stats.
 Identities = 508/897 (56%), Positives = 669/897 (74%), Gaps = 32/897 (3%)

Query: 4   HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQM 63
             + +  + +  IT V+I DEM+ SYL YA++VI+ RA+PD+RDGLKPVHRRILF M + 
Sbjct: 2   TTLPASPQFD--ITPVTIEDEMKRSYLDYAMSVIVSRALPDVRDGLKPVHRRILFAMNEA 59

Query: 64  GVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGD 123
           G  +NK + K ARI G+VMGKYHPHG++AIYDA+ RMAQ++S+RL L++GQGNFGS+DGD
Sbjct: 60  GYHFNKPFRKSARIVGDVMGKYHPHGDSAIYDAMVRMAQNFSMRLPLVDGQGNFGSMDGD 119

Query: 124 PPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIA 183
           PPAA RYTE RL K+AH LL+D+ K+TVDF+ NYD S  EP+VL ARYPN+LVNG GGIA
Sbjct: 120 PPAAMRYTEARLAKSAHSLLEDIDKETVDFQANYDESTHEPMVLPARYPNLLVNGAGGIA 179

Query: 184 VGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYAT 243
           VGMATNIP HNLGEV+D C A ID+P++ ++ LME++ GPDFPTG  ILGR GI+ A  T
Sbjct: 180 VGMATNIPPHNLGEVIDACCAYIDDPEVTVERLMELVPGPDFPTGGTILGRAGIRAAQLT 239

Query: 244 GRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDES 303
           GRGS+V+RG  HIE+   DRE I+VTEIPYQVNKA MLE+IAELVR+K+I  I+DLRDES
Sbjct: 240 GRGSVVMRGRVHIEEVRKDREAIIVTEIPYQVNKARMLEQIAELVRDKKIEGISDLRDES 299

Query: 304 DRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVA 363
           DR G RVVIE+KR A A+V+L QLYR+T LQ+ F VN +ALNG +PE  TL  I+ AF+A
Sbjct: 300 DRDGVRVVIEIKRDAIAEVVLAQLYRFTPLQTSFGVNSLALNGGRPEMMTLRDIIVAFIA 359

Query: 364 FREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWN 423
           FREEV+ RRT + L KARDRAHVL GLAIAVAN+DEV+R+IR +P+P  AR  LM R+W 
Sbjct: 360 FREEVITRRTIFELGKARDRAHVLAGLAIAVANIDEVIRLIRAAPDPGEARERLMTRAWP 419

Query: 424 ASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIE 483
             D++ LI LID+    I  DG   LSE+Q +AIL+LRL RLTGL RD I +EL  +G +
Sbjct: 420 VGDVEPLIQLIDEPGRAI-EDGCYRLSEIQAKAILDLRLHRLTGLERDKIGDELREIGHQ 478

Query: 484 IKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVS 543
           I+  L ILSSR RL  +++ EL+ ++++  TPRRT I E   + + ED I REDMVVTV+
Sbjct: 479 IEAYLLILSSRPRLFEVMRGELMEIREQFATPRRTTIEENEFEADIEDLIAREDMVVTVT 538

Query: 544 HLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKV 603
           + GY+KRVPLS YRAQ+RGGKGRSG+ ++DEDF++ +F+V+THT VLFFSS G  YK KV
Sbjct: 539 NTGYIKRVPLSAYRAQKRGGKGRSGMNIKDEDFLSQVFVVNTHTPVLFFSSTGIAYKLKV 598

Query: 604 WRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLS 663
           +RLP+G+PQARGKA++N+L L++GE I+TIMP PEDE+SW +L+V+F T  G+VRRN LS
Sbjct: 599 YRLPLGNPQARGKAMVNLLPLDEGETISTIMPLPEDETSWGDLHVMFVTSKGDVRRNPLS 658

Query: 664 DFIQINRSGKIAMKLDSRDEILSVETC-TQENDILLTTKLGQCVRFPISAIRVFAGRNSV 722
           DF ++  +GKIAMKL   + ++SV+TC  + +D+LL T LG+ +RFP+  +R F  R+S 
Sbjct: 659 DFTEVRANGKIAMKLGEGERLISVQTCAAETDDVLLATHLGKAIRFPVHDVREFKSRDST 718

Query: 723 GVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVE 782
           GVRGI L   D+VISM+I+ H D D + R  ++K                          
Sbjct: 719 GVRGIRLDGEDEVISMSILRHTDYDSETRDAFLK-------------------------- 752

Query: 783 GNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALV 842
           G++  E+ +++  ++QF+LTV+E GFGKRTS++++RI+ R G GI   D++   + G +V
Sbjct: 753 GDLPAEQMEKMGAEQQFVLTVTENGFGKRTSAFEYRITGRGGSGIANLDMTA--KTGTVV 810

Query: 843 AVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
           A FPVN  D I+LVSD G LIR+PV++IRIA R T+GV +  TA++ERVVS  R+ +
Sbjct: 811 ASFPVNHEDDIMLVSDGGKLIRMPVDDIRIAGRKTQGVTLLRTAENERVVSAARLCD 867



 Score = 66.7 bits (161), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 48/260 (18%), Positives = 96/260 (36%), Gaps = 28/260 (10%)

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           V+ V+  G V+R PLS +   R  GK    +    E  ++     +    VL  + LG  
Sbjct: 643 VMFVTSKGDVRRNPLSDFTEVRANGKIAMKLGE-GERLISVQTCAAETDDVLLATHLGKA 701

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPE-------------------- 638
            +  V  +     ++R    +  + L+  + + ++                         
Sbjct: 702 IRFPVHDVRE--FKSRDSTGVRGIRLDGEDEVISMSILRHTDYDSETRDAFLKGDLPAEQ 759

Query: 639 -DESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSV---ETCTQEN 694
            ++      +V+  T++G  +R    ++    R G     LD   +  +V        E+
Sbjct: 760 MEKMGAEQQFVLTVTENGFGKRTSAFEYRITGRGGSGIANLDMTAKTGTVVASFPVNHED 819

Query: 695 DILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICY 754
           DI+L +  G+ +R P+  IR  AGR + GV  +  A+ ++V+S A +    ++ DE    
Sbjct: 820 DIMLVSDGGKLIRMPVDDIR-IAGRKTQGVTLLRTAENERVVSAARLCDIGSNGDEAEEA 878

Query: 755 MKHMSAQRRLISGDTEEITS 774
            +                 +
Sbjct: 879 DEADEGVLDAAEDMAGGEDA 898


>gi|149914919|ref|ZP_01903448.1| DNA gyrase, A subunit [Roseobacter sp. AzwK-3b]
 gi|149811107|gb|EDM70944.1| DNA gyrase, A subunit [Roseobacter sp. AzwK-3b]
          Length = 908

 Score =  955 bits (2468), Expect = 0.0,   Method: Composition-based stats.
 Identities = 487/909 (53%), Positives = 629/909 (69%), Gaps = 12/909 (1%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           M E+     +       +VSI DEM+ SYL YA++VI+ RAIPDLRDGLKPVHRRIL+ M
Sbjct: 1   MEENTPERPQYGGP---TVSIEDEMKTSYLDYAMSVIVSRAIPDLRDGLKPVHRRILYAM 57

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            + G   +K Y K AR  G+VMGKYHPHG++AIYDAL RMAQD+S+ L L++GQGNFGS+
Sbjct: 58  HEGGNTHDKPYRKSARAVGDVMGKYHPHGDSAIYDALVRMAQDFSMSLPLLDGQGNFGSM 117

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGD  AA RYTE R+ K A  LL D+ KDTVDF+ NYDG   EP VL AR+PN+LVNG G
Sbjct: 118 DGDNAAAMRYTEVRMDKPAAALLADIEKDTVDFQDNYDGKDLEPTVLPARFPNMLVNGAG 177

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEV D  +A+I+NPD+  + L+E I GPDFPTG ++LGR+G + A
Sbjct: 178 GIAVGMATNIPPHNLGEVCDATLALIENPDLGSEDLIEYIPGPDFPTGGIMLGRSGARKA 237

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y  GRGS+VIR  + IE+   DR  IV+ EIPYQVNKAAM+EKIAE VREKRI  IA ++
Sbjct: 238 YIEGRGSVVIRSKTRIEEIRKDRYAIVIDEIPYQVNKAAMIEKIAETVREKRIEGIAHVQ 297

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DESDR G RVV+ELKR A+A+V+LNQL+R+T +Q+ F  NM+ALNG +PE+ TL G L A
Sbjct: 298 DESDRHGVRVVVELKRDATAEVVLNQLFRFTPMQTYFGCNMLALNGGRPEQLTLHGFLSA 357

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           F+ FREEVV RRT + L KARDR+HVL GLA+AV+N+DEVV  IR S +   AR +LM R
Sbjct: 358 FITFREEVVARRTAFELRKARDRSHVLCGLAVAVSNVDEVVATIRASADAAEARHKLMTR 417

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            W A DI + I LIDD ++T   DGT  LSE Q RAIL+LRL RLT LG  ++ +EL  L
Sbjct: 418 RWPAGDILEYIALIDDPTHTANDDGTYNLSETQARAILDLRLQRLTQLGVKEVTDELQEL 477

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
             +IKE L IL+SR R++ II  EL  VK++   PRRT+IV+   DM+DED I REDMVV
Sbjct: 478 AAKIKEYLAILASRERIMEIISTELREVKEQFSVPRRTQIVDWSGDMDDEDLIEREDMVV 537

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TV+  GY+KR  L+ +RAQ+RGGKG SG+  ++ED VT LF+ +THT +LFF++ G VYK
Sbjct: 538 TVTQGGYIKRTALADFRAQKRGGKGLSGMATKEEDVVTTLFVANTHTQLLFFTTDGMVYK 597

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
            K WRLP+G   ++GKA++NIL + QG  I  IMP    E  W++L V+FAT  G+VRRN
Sbjct: 598 LKTWRLPLGGRTSKGKAIVNILPIPQGVSIAAIMPVDRPEEEWDDLQVMFATTAGDVRRN 657

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
            LSDF  + R+GKIAM L    E+++   C + +DI+L T  G+ +RFP + +RVF GR 
Sbjct: 658 ALSDFTNVKRNGKIAMDLPDGIELVNARICDEGDDIMLVTNSGRAIRFPTTEVRVFKGRK 717

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSS 780
           S GVRGI L   D+V+SM+++ H DA  DER  Y+K   A               +   +
Sbjct: 718 STGVRGIRLQGDDRVVSMSVIRHFDASADERAAYLKMRRALAGAP-------DDGEEPEA 770

Query: 781 VEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGA 840
             G+I+ +R +E++  E  ILT+S +G GK +SS+D+ +  R G G++A D  K    G 
Sbjct: 771 AAGDITPDRFEEMQAAENLILTISTEGAGKLSSSHDYPVRGRGGMGVQAMD--KAMRGGD 828

Query: 841 LVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900
           LVA FPV  +DQI+L + +G  IRVPV+ I   SR+  GV +F T K E VVSV  I E 
Sbjct: 829 LVASFPVEIDDQIMLATSRGQSIRVPVDGISFRSRSAGGVKVFDTRKGEEVVSVAWIAEK 888

Query: 901 EIVDEAEST 909
              D+  ++
Sbjct: 889 GDQDDDAAS 897


>gi|294677501|ref|YP_003578116.1| DNA gyrase subunit A [Rhodobacter capsulatus SB 1003]
 gi|294476321|gb|ADE85709.1| DNA gyrase, A subunit [Rhodobacter capsulatus SB 1003]
          Length = 913

 Score =  955 bits (2467), Expect = 0.0,   Method: Composition-based stats.
 Identities = 471/916 (51%), Positives = 633/916 (69%), Gaps = 11/916 (1%)

Query: 1   MTEHIISSDE--EEEKGITS----VSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHR 54
           MT+ I  +D   +  K        VSI +EM+ +YL YA++VI+ RAIPDLRDGLKP HR
Sbjct: 1   MTDIIDPTDPSGDTPKRAHHAGPVVSIAEEMKTAYLDYAMSVIVSRAIPDLRDGLKPAHR 60

Query: 55  RILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQ 114
           RIL+ M + G   +K Y K AR  G+VMGKYHPHG+AAIYDAL RMAQD+S+ L L++GQ
Sbjct: 61  RILYAMHETGNTHDKPYRKSARPVGDVMGKYHPHGDAAIYDALVRMAQDFSMSLPLLDGQ 120

Query: 115 GNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNV 174
           GNFGS+DGD  AA RYTE R+ K A FLL D+ KDTVDF+ NYDG  +EP VL AR+PN+
Sbjct: 121 GNFGSMDGDSAAAMRYTEVRMDKPAAFLLADIEKDTVDFQDNYDGKDKEPTVLPARFPNM 180

Query: 175 LVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGR 234
           LVNG GGIAVGMATNIP HNLGEV+D  +A+I+NPD+  +ALM+ + GPDFPTGA I+GR
Sbjct: 181 LVNGAGGIAVGMATNIPPHNLGEVIDATLALIENPDLSSEALMDYVPGPDFPTGAQIMGR 240

Query: 235 TGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIV 294
            G + AY  GRGS++IR  + IE+   DR  I++ EIPYQVNKA M+EK+A+LVREK++ 
Sbjct: 241 GGARKAYLEGRGSVIIRAKTRIEEIRKDRFAIIIDEIPYQVNKATMIEKMADLVREKKLE 300

Query: 295 DIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTL 354
            IA + DESDR G RVVIELKR A+ADV+LNQLYR+T LQ+ F  NM+ALNG +PE+ TL
Sbjct: 301 GIASIADESDRVGVRVVIELKRDATADVVLNQLYRFTPLQTSFGCNMLALNGGRPEQLTL 360

Query: 355 IGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETAR 414
              L  F+AFREEVV RRT Y L KAR+R+H+L GLA+AV+N+DEVV  IR S +P  AR
Sbjct: 361 RDFLSHFIAFREEVVARRTAYELRKARERSHILCGLAVAVSNVDEVVATIRSSKDPAEAR 420

Query: 415 RELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIR 474
             LM+R W A +I + + LIDD  + +  DGT  LSEVQ RAIL+LRL RLT +G  ++ 
Sbjct: 421 DRLMERRWPAHEIVEYLRLIDDPLHPVNDDGTYNLSEVQARAILDLRLQRLTAMGVQEVT 480

Query: 475 NELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIV 534
           +EL  L  +I++ L IL+SR R++ II  EL  V+     PRRT IV+   D++DED I 
Sbjct: 481 DELAELAGKIRDYLAILASRERIMAIIATELREVRAAHAVPRRTEIVDWAGDLDDEDLIE 540

Query: 535 REDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSS 594
           REDMVVT++  GY+KR PL+ +RAQRRGGKG + +  +++D VT LF+ +THT +LFF++
Sbjct: 541 REDMVVTITSGGYIKRTPLAEFRAQRRGGKGLASMATKEDDVVTTLFVANTHTQLLFFTT 600

Query: 595 LGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKH 654
            G VY  K WRLP+    ++GKA++NIL + QG  + ++MP  E E +W++  V FAT  
Sbjct: 601 DGMVYSLKCWRLPLAGRTSKGKAIVNILPIPQGVSVASLMPVDEPEETWDDFQVFFATSD 660

Query: 655 GNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIR 714
           G+VRRN LSDF ++ ++GK AM+L     ++    C +E+DI+L T  G+ +RFP+  +R
Sbjct: 661 GDVRRNALSDFAKVMKNGKRAMELPEGVTLVDTRMCHEEDDIMLVTASGRAIRFPVPEVR 720

Query: 715 VFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITS 774
           +F GR+S GVRG+ LA+GD+V+SM+++ H +A+  ER  ++K   A+    + D  E   
Sbjct: 721 IFKGRSSTGVRGVRLAEGDKVVSMSVIRHFEAEPWERDAFVKRYRAELGGETEDEAETDR 780

Query: 775 LKNDSSV--EGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDV 832
              D +   EG +S+ R  E+   +  ILT++ KG GK +SS+ + +  R G+G+ A   
Sbjct: 781 DAEDEAEGGEGVLSDARYAEMLAAQDLILTITAKGLGKISSSHSYPVRGRGGQGVTA--F 838

Query: 833 SKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVV 892
            K    GALVA FPV   DQ++L +  G  IR PV  I   SRA  GV +F+T  +E VV
Sbjct: 839 EKSMRGGALVASFPVEPTDQVMLATSTGQSIRCPVAGISFRSRAAGGVKVFNTGAEEEVV 898

Query: 893 SVERIRESEIVDEAES 908
           SV R+ +    DEAE+
Sbjct: 899 SVARVADP-GDDEAEA 913


>gi|83311480|ref|YP_421744.1| Type IIA topoisomerase, A subunit [Magnetospirillum magneticum
           AMB-1]
 gi|82946321|dbj|BAE51185.1| Type IIA topoisomerase , A subunit [Magnetospirillum magneticum
           AMB-1]
          Length = 895

 Score =  955 bits (2467), Expect = 0.0,   Method: Composition-based stats.
 Identities = 509/910 (55%), Positives = 674/910 (74%), Gaps = 34/910 (3%)

Query: 4   HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQM 63
             + +  + +  IT V+I DEM+ SYL YA++VI+ RA+PD+RDGLKPVHRRILF M + 
Sbjct: 2   TTLPASPQFD--ITPVTIEDEMKRSYLDYAMSVIVSRALPDVRDGLKPVHRRILFAMNEA 59

Query: 64  GVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGD 123
           G  +NK + K ARI G+VMGKYHPHG++AIYDA+ RMAQ++S+RL L++GQGNFGS+DGD
Sbjct: 60  GYHFNKPFRKSARIVGDVMGKYHPHGDSAIYDAMVRMAQNFSMRLPLVDGQGNFGSMDGD 119

Query: 124 PPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIA 183
           PPAA RYTE RL ++AH LL+D+ K+TVDF+ NYD S  EP+VL ARYPN+LVNG GGIA
Sbjct: 120 PPAAMRYTEARLARSAHSLLEDIDKETVDFQANYDESTHEPMVLPARYPNLLVNGAGGIA 179

Query: 184 VGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYAT 243
           VGMATNIP HNLGEV+D C A ID+P++ ++ LME++ GPDFPTG  ILGR GI+ A  T
Sbjct: 180 VGMATNIPPHNLGEVIDACCAYIDDPEVTVERLMELVPGPDFPTGGTILGRAGIRAAQLT 239

Query: 244 GRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDES 303
           GRGS+V+RG  HIE+   DRE IVVTEIPYQVNKA MLE+IAELVR+K+I  I+DLRDES
Sbjct: 240 GRGSVVMRGRVHIEEVRKDREAIVVTEIPYQVNKARMLEQIAELVRDKKIEGISDLRDES 299

Query: 304 DRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVA 363
           DR G R+V+E+KR A A+V+L QLYR+T LQ+ F VN +ALNG +PE  TL  I+ AF+A
Sbjct: 300 DRDGVRMVVEIKRDAIAEVVLAQLYRFTPLQTSFGVNSLALNGGRPEMMTLRDIIVAFIA 359

Query: 364 FREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWN 423
           FREEV+ RRT + L KARDRAHVL GLAIAVAN+DEV+R+IR +P+P  AR +LM R+W 
Sbjct: 360 FREEVITRRTIFELGKARDRAHVLAGLAIAVANIDEVIRLIRAAPDPGEAREKLMTRAWP 419

Query: 424 ASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIE 483
             D++ LI LID+    I  DG   LSEVQ +AIL+LRL RLTGL RD I +EL  +G +
Sbjct: 420 VGDVEPLIRLIDEPGRAI-EDGCYRLSEVQAKAILDLRLHRLTGLERDKIGDELREIGHQ 478

Query: 484 IKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVS 543
           I+  L ILSSR RL+ +++ EL+ ++++  TPRRT I E   + + ED I REDMVVTV+
Sbjct: 479 IEAYLLILSSRPRLMEVMRGELMEIREQFATPRRTTIEENEFEADIEDLIAREDMVVTVT 538

Query: 544 HLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKV 603
           + GY+KRVPLS YRAQ+RGGKGRSG+ ++DEDF+T +F+V+THT VLFFSS G  YK KV
Sbjct: 539 NTGYIKRVPLSAYRAQKRGGKGRSGMNIKDEDFLTQVFVVNTHTPVLFFSSTGIAYKLKV 598

Query: 604 WRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLS 663
           +RLP+G+PQARGKA++N+L L+ GE I+TIMP PEDE++W +L+V+F T  G+VRRN LS
Sbjct: 599 YRLPLGNPQARGKAMVNLLPLDDGETISTIMPLPEDETTWGDLHVMFVTSKGDVRRNPLS 658

Query: 664 DFIQINRSGKIAMKLDSRDEILSVETCT-QENDILLTTKLGQCVRFPISAIRVFAGRNSV 722
           DF ++  +GKIAMKL   + ++SV+TC+ + +D+LL T  G+ +RFP+  +R F  R+S 
Sbjct: 659 DFTEVRANGKIAMKLGEGERLISVQTCSAESDDVLLATHRGKAIRFPVQDVREFKSRDST 718

Query: 723 GVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVE 782
           GVRGI L   D+VISM+I+ H D D + R  ++K                          
Sbjct: 719 GVRGIRLDGEDEVISMSILRHTDYDSETRDAFLK-------------------------- 752

Query: 783 GNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALV 842
           G++  ++  ++  ++QFILTV+E GFGKRTS++++RI+ R G GI   D++   + G +V
Sbjct: 753 GDLPADQMDKMVAEQQFILTVTENGFGKRTSAFEYRITGRGGSGIANLDMTA--KTGLVV 810

Query: 843 AVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE--S 900
           A FPVN  D I+LVSD G LIR+PV++IRIA R T+GV +  TA++ERVVS  R+ +  S
Sbjct: 811 ASFPVNHEDDIMLVSDGGKLIRMPVDDIRIAGRKTQGVTLLRTAENERVVSAARLCDIGS 870

Query: 901 EIVDEAESTE 910
              +  E+ E
Sbjct: 871 NGDEPDETDE 880



 Score = 71.4 bits (173), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 47/256 (18%), Positives = 95/256 (37%), Gaps = 28/256 (10%)

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           V+ V+  G V+R PLS +   R  GK    +   +           +   VL  +  G  
Sbjct: 643 VMFVTSKGDVRRNPLSDFTEVRANGKIAMKLGEGERLISVQTCSAESDD-VLLATHRGKA 701

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPE-------------------- 638
            +  V  +     ++R    +  + L+  + + ++                         
Sbjct: 702 IRFPVQDVRE--FKSRDSTGVRGIRLDGEDEVISMSILRHTDYDSETRDAFLKGDLPADQ 759

Query: 639 -DESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSV---ETCTQEN 694
            D+      +++  T++G  +R    ++    R G     LD   +   V        E+
Sbjct: 760 MDKMVAEQQFILTVTENGFGKRTSAFEYRITGRGGSGIANLDMTAKTGLVVASFPVNHED 819

Query: 695 DILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICY 754
           DI+L +  G+ +R P+  IR  AGR + GV  +  A+ ++V+S A +    ++ DE    
Sbjct: 820 DIMLVSDGGKLIRMPVDDIR-IAGRKTQGVTLLRTAENERVVSAARLCDIGSNGDEPDET 878

Query: 755 MKHMSAQRRLISGDTE 770
            +        ++G  +
Sbjct: 879 DEGAGDAAEDMAGGED 894


>gi|306841825|ref|ZP_07474508.1| DNA gyrase, A subunit [Brucella sp. BO2]
 gi|306288106|gb|EFM59500.1| DNA gyrase, A subunit [Brucella sp. BO2]
          Length = 889

 Score =  954 bits (2466), Expect = 0.0,   Method: Composition-based stats.
 Identities = 579/870 (66%), Positives = 706/870 (81%), Gaps = 2/870 (0%)

Query: 38  LGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDAL 97
           + RA+PD+RDGLKPVHRRIL  M +M + +N+ Y K A + GEVMGKYHPHG+A+IY AL
Sbjct: 1   MSRALPDVRDGLKPVHRRILHAMNEMNLAYNRPYRKSAGVVGEVMGKYHPHGDASIYGAL 60

Query: 98  ARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNY 157
            RMAQD+S+R  LI+GQGNFGS+DGDPPAA RYTECRL+K    LL D+ KDTV+F+ NY
Sbjct: 61  VRMAQDFSMRDPLIDGQGNFGSIDGDPPAAMRYTECRLEKVTESLLSDIDKDTVNFQDNY 120

Query: 158 DGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALM 217
           DG  QEPVVL AR+PN+LVNG GGIAVGMATNIP HNLGEV+DGCVA+IDNP I+L  LM
Sbjct: 121 DGREQEPVVLPARFPNLLVNGSGGIAVGMATNIPPHNLGEVIDGCVALIDNPAIELSELM 180

Query: 218 EIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNK 277
           E+I GPDFPTG +ILGR GI +AY TGRGS+++RG + IE   GDRE I++TEIPYQVNK
Sbjct: 181 ELIPGPDFPTGGIILGRNGINSAYTTGRGSVIMRGRATIEPMRGDREAIIITEIPYQVNK 240

Query: 278 AAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLF 337
           A+M+EK+AELVR+KRI  I+DLRDESDR+GYRVV+ELKR A ADV+LNQLYRYT LQ+ F
Sbjct: 241 ASMIEKMAELVRDKRIDGISDLRDESDREGYRVVVELKRDAVADVVLNQLYRYTPLQTSF 300

Query: 338 SVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANL 397
             NMVALNG KPE+ TL+ +L+AFVAFREEVV RRTK+LLNKARDRAHVLVGLAIAVAN+
Sbjct: 301 GCNMVALNGGKPEQLTLLDMLRAFVAFREEVVTRRTKFLLNKARDRAHVLVGLAIAVANI 360

Query: 398 DEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAI 457
           DEV+ +IR +P+P TAR +LM+R W A D+  LI LIDD  +T+  D T  LSE Q RAI
Sbjct: 361 DEVIALIRRAPDPATAREQLMERRWPAVDVAPLIRLIDDPRHTLNEDNTYNLSEEQARAI 420

Query: 458 LELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRR 517
           L+LRL RLT LGRD++ +ELN +G EI++ LDIL SR R++ I+K+E+++V+DE  TPRR
Sbjct: 421 LDLRLQRLTALGRDEVADELNKIGEEIRDYLDILGSRLRVMNIVKEEMIAVRDEFATPRR 480

Query: 518 TRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFV 577
           T I  G  +M+DED I REDMVVTVSH GY+KRVPL+ YRAQRRGGKGRSG+  ++EDFV
Sbjct: 481 TEIGFGGAEMDDEDLIAREDMVVTVSHAGYIKRVPLTTYRAQRRGGKGRSGMATKEEDFV 540

Query: 578 TDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFP 637
           T LF+ +THT VLFFSS G VYKEKVWRLP+G+PQ+RGKALIN+L L QGERITTIMP P
Sbjct: 541 TRLFVANTHTPVLFFSSRGIVYKEKVWRLPVGTPQSRGKALINMLPLQQGERITTIMPLP 600

Query: 638 EDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKL-DSRDEILSVETCTQENDI 696
           EDE SW NL V+F+T  G VRRNKLSDF+Q+NR+GKIAMKL D  DEILSV+TCT+ +D+
Sbjct: 601 EDEDSWANLDVMFSTTRGTVRRNKLSDFVQVNRNGKIAMKLEDEGDEILSVDTCTEFDDV 660

Query: 697 LLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMK 756
           LLT   GQC+RFP++ +RVFAGRNS+GVRGI+LA+GD+VISMAI+ H DA   ER  Y+K
Sbjct: 661 LLTCAGGQCIRFPVTDVRVFAGRNSIGVRGINLAEGDKVISMAILHHVDATPAERSAYLK 720

Query: 757 HMSAQRRLISGDT-EEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSY 815
              A+RR    D  ++I  +  D   E  +SE+R QELK +E+ +LTVSE G+GKR+SSY
Sbjct: 721 RSIAERRAQGADDADDIVVVGEDVDAEAELSEDRYQELKAREETVLTVSEFGYGKRSSSY 780

Query: 816 DFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASR 875
           +F IS R GKGIRATD SK +EIG LVA+FPV  +DQI+LVSD G LIRVPV+ IRIA R
Sbjct: 781 EFHISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDGGQLIRVPVDGIRIAGR 840

Query: 876 ATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           +TKGV IF+TA  E+VVSVERI +++  +E
Sbjct: 841 STKGVTIFNTADGEKVVSVERISDADSDEE 870



 Score = 54.0 bits (128), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 648 VVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKL 702
           V+  ++ G  +R+   +F        G  A      DEI   +++      + ILL +  
Sbjct: 765 VLTVSEFGYGKRSSSYEFHISGRGGKGIRATDTSKTDEIGKLVALFPVEGSDQILLVSDG 824

Query: 703 GQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
           GQ +R P+  IR  AGR++ GV   + A G++V+S+  +  AD+D +             
Sbjct: 825 GQLIRVPVDGIR-IAGRSTKGVTIFNTADGEKVVSVERISDADSDEENGNGGDAAPEGDT 883

Query: 763 RLISGD 768
              + +
Sbjct: 884 PAATQE 889


>gi|304391773|ref|ZP_07373715.1| DNA gyrase, A subunit [Ahrensia sp. R2A130]
 gi|303296002|gb|EFL90360.1| DNA gyrase, A subunit [Ahrensia sp. R2A130]
          Length = 941

 Score =  952 bits (2461), Expect = 0.0,   Method: Composition-based stats.
 Identities = 558/889 (62%), Positives = 695/889 (78%), Gaps = 6/889 (0%)

Query: 17  TSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCAR 76
            ++SI DEM+ SYL YA++VI+ RA+PD+RDGLKPVHRRIL+ M +MG++  K Y K A 
Sbjct: 38  ENISIVDEMRRSYLDYAMSVIVSRALPDVRDGLKPVHRRILYAMHEMGLDHTKSYRKSAA 97

Query: 77  ISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQ 136
           + GEVMGKYHPHG+++IYDAL RMAQD+++R +LI+GQGNFGS+DGD PAA RYTECRL 
Sbjct: 98  VIGEVMGKYHPHGDSSIYDALVRMAQDFAMRQMLIDGQGNFGSIDGDKPAAMRYTECRLA 157

Query: 137 KAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLG 196
           + +  LLDD+ K+TVDF+ NYDGS +EP+VL ARYPN+LVNG GGIAVGMATNIP HNLG
Sbjct: 158 RISDVLLDDIDKETVDFQANYDGSQREPMVLPARYPNLLVNGAGGIAVGMATNIPPHNLG 217

Query: 197 EVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHI 256
           EV+DGC+A+ID PDI+L  LME+I GPDFPTG +ILGR GIK+AY TGRGS+++RG +HI
Sbjct: 218 EVIDGCLAMIDKPDIELAELMELIPGPDFPTGGMILGRAGIKSAYETGRGSVIMRGKAHI 277

Query: 257 EKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKR 316
           E +  DRE I++ E+PYQVNKA+M+EKIAELVR+KRI  I+ +RDESDRQGYRVVIE+KR
Sbjct: 278 ETSGSDREAIIINEVPYQVNKASMVEKIAELVRDKRIEGISAVRDESDRQGYRVVIEVKR 337

Query: 317 GASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYL 376
            A AD++LNQLYRYT LQS F  N+VALNG KPE+  L+ +L+AFV FREEVV RRTK+L
Sbjct: 338 DAVADIVLNQLYRYTPLQSSFGCNLVALNGGKPEQMNLVDMLRAFVGFREEVVTRRTKFL 397

Query: 377 LNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDD 436
           LNK R RAHVLVGLAIAVAN+DEV+ +IR +P+P TAR +LM+R W A D+  LI LIDD
Sbjct: 398 LNKVRIRAHVLVGLAIAVANIDEVIALIRKAPDPATARAQLMERRWPAKDVAPLIALIDD 457

Query: 437 SSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSR 496
             + I  DGT  LSE Q RAIL+LRL RLT LGRD+I +ELN +G EI + LDILSSR+R
Sbjct: 458 PRHRINEDGTYNLSEEQARAILDLRLQRLTALGRDEIADELNLIGAEIADYLDILSSRAR 517

Query: 497 LLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVY 556
           +L I++ EL  V++E   PRRT I++   + +DED I RE+MVVTV+H GY+KRVPL+ Y
Sbjct: 518 VLDIVRTELGEVREEFANPRRTEIIDSGYEHDDEDLIAREEMVVTVTHGGYIKRVPLAAY 577

Query: 557 RAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGK 616
           RAQ RGGKGRSG+  +DEDFVT LF+V+THT VLFFS+ G  YK KVW+LP+  PQ RGK
Sbjct: 578 RAQARGGKGRSGMSTKDEDFVTRLFVVNTHTPVLFFSTRGIAYKLKVWKLPLAQPQGRGK 637

Query: 617 ALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAM 676
           A++N+L L  GE ITTIMP PEDE SW++L V+FAT  G VRRNKLSDF+Q+NR+GKIAM
Sbjct: 638 AMVNLLPLQAGETITTIMPLPEDEGSWDSLDVMFATTRGTVRRNKLSDFVQVNRNGKIAM 697

Query: 677 KL-DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQV 735
           KL D  D I+ VE C+  +D+LLT+  G  +RFP+  +RVF  RNSVGVRGI +   D V
Sbjct: 698 KLDDENDGIIGVEVCSASDDVLLTSSAGYGIRFPVDDVRVFNSRNSVGVRGIRMGASDHV 757

Query: 736 ISMAIVLHADADYDERICYMKHMSAQRRLISGDTEE-----ITSLKNDSSVEGNISEERC 790
           ISMAI+    A  +ER+ Y+K  SA RR  S D  E     + +   + +V  ++ EER 
Sbjct: 758 ISMAIMRGFAATPEERVSYIKQASALRRAASADDGEDADLDVVADDEEVTVASSLPEERY 817

Query: 791 QELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDN 850
            E+   EQFILT++++G+GKR+SSYDFR S R GKGI+ TDVSK  EIG LV  FPV D+
Sbjct: 818 IEMGAAEQFILTITDQGYGKRSSSYDFRKSGRGGKGIKVTDVSKEGEIGQLVGAFPVEDS 877

Query: 851 DQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
           DQI+LVS+ G LIRVPV+ IR ASR+TKGV +F TAKDE VV+VERI E
Sbjct: 878 DQIMLVSNSGQLIRVPVDGIRFASRSTKGVRVFRTAKDESVVAVERISE 926


>gi|221639040|ref|YP_002525302.1| DNA gyrase subunit A [Rhodobacter sphaeroides KD131]
 gi|221159821|gb|ACM00801.1| DNA gyrase subunit A (Dna topoisomerase ii (Subunit a))
           [Rhodobacter sphaeroides KD131]
          Length = 920

 Score =  952 bits (2460), Expect = 0.0,   Method: Composition-based stats.
 Identities = 484/919 (52%), Positives = 637/919 (69%), Gaps = 14/919 (1%)

Query: 1   MTEHIISSDEEEE-----KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRR 55
           MT+      ++EE      G+  VSI +EM+ +YL YA++VI+ RAIPDLRDGLKPVHRR
Sbjct: 1   MTDRPEEPGDDEEMGRPLSGLPQVSIAEEMKTAYLDYAMSVIVSRAIPDLRDGLKPVHRR 60

Query: 56  ILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQG 115
           IL+ M + G   +K Y K AR  G+ MGKYHPHG+ AIYDAL RMAQ +S+ L L++GQG
Sbjct: 61  ILYAMHETGNTSDKPYRKSARPVGDTMGKYHPHGDGAIYDALVRMAQPFSMGLKLLDGQG 120

Query: 116 NFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVL 175
           NFGS+DGD  AA RYTE R+ K A FLL D+ KDTVDF+ NYDG  +EP VL AR+PN+L
Sbjct: 121 NFGSMDGDNAAAMRYTEVRMDKPAAFLLADIDKDTVDFQDNYDGKDREPTVLPARFPNML 180

Query: 176 VNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRT 235
           VNG GGIAVGMATNIP HNLGEVVD  +A+I+NPDI  + LMEII GPDFPTG VILGR+
Sbjct: 181 VNGAGGIAVGMATNIPPHNLGEVVDATLAMIENPDISTERLMEIIPGPDFPTGGVILGRS 240

Query: 236 GIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVD 295
           G + AY  GRGS+++R  + +E+   DR  IV+ EIPYQVNKA M+EKIA++VREK+I  
Sbjct: 241 GARKAYLEGRGSVIMRAKARVEEIRKDRYAIVLDEIPYQVNKATMIEKIADMVREKKIEG 300

Query: 296 IADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLI 355
           IA ++DESDR G RVVIELKR A+ +V+LNQL+R+T +Q+ F  NM+ALNG +PE+ TL 
Sbjct: 301 IAHVQDESDRVGVRVVIELKRDATPEVVLNQLWRFTPMQTTFGCNMLALNGGRPEQLTLR 360

Query: 356 GILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARR 415
             L  F+ FRE+VV RRT Y L KAR+R+H+L GLA+AV+N+DEVV  IR S +P  AR 
Sbjct: 361 DFLIHFLTFREDVVARRTAYELRKARERSHILCGLAVAVSNVDEVVATIRSSADPAEARE 420

Query: 416 ELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRN 475
            LM R W A+DI D I LIDD S+TI  DGT  LSE+Q RAIL+LRL RLT +G  ++ +
Sbjct: 421 RLMTRRWPAADIADYIRLIDDPSHTINEDGTYNLSEIQARAILDLRLQRLTAMGVKEVTD 480

Query: 476 ELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVR 535
           EL  L  +I++ LDIL SR R++ II  EL  VKD    PRRT I E   D+EDED I R
Sbjct: 481 ELAELAAKIRDYLDILGSRERIMAIISDELREVKDLFAVPRRTEISEWAGDLEDEDLIER 540

Query: 536 EDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSL 595
           EDMVVT++  GY+KR PL+ +R+QRRGGKG + +  +++D VT LF+ +THT +LFF++ 
Sbjct: 541 EDMVVTITSGGYIKRTPLAEFRSQRRGGKGLASMATKEDDVVTTLFVANTHTQLLFFTTD 600

Query: 596 GFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHG 655
           G VY  K WRLP+G   A+GKA++NIL +  G  I  +M   E E  W+ L VVFAT  G
Sbjct: 601 GMVYDLKCWRLPLGGRTAKGKAIVNILPIATGISIAALMKIDEPEEEWDRLQVVFATSEG 660

Query: 656 NVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRV 715
           +VRRN+LSDF  + R+GKIAMKL     +++V  C +++D+++ T LG+ +RFP + +RV
Sbjct: 661 DVRRNRLSDFTNVKRNGKIAMKLPEGVSLVNVSICDEQDDVMMVTALGRAIRFPTTDVRV 720

Query: 716 FAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSL 775
           F+GR+S GVRGI LA GD+V+SM+++ H +AD  ER  Y+K     R +     E     
Sbjct: 721 FSGRDSTGVRGIRLASGDRVVSMSVIRHFEADPAERAAYLKQR---RLMAGVTEEAEADE 777

Query: 776 KNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKI 835
           + D+   G +S  R  E+   E  ILT++ +G GK +SS+D+ +  R G+G+ A    K 
Sbjct: 778 EEDAVEAGQLSPTRYAEMSAAEDLILTITARGLGKISSSHDYPVRGRGGQGVTA--FEKS 835

Query: 836 NEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVE 895
              G LVA FPV  +DQ++L +  G  IRVPV +I   SR+  GV +F T   E VVSV 
Sbjct: 836 MRGGQLVASFPVEMSDQVMLATSGGQSIRVPVEQISFRSRSAGGVRVFDTGASEEVVSVA 895

Query: 896 RIRE----SEIVDEAESTE 910
           RI +    ++ V++AE  E
Sbjct: 896 RIADAGDTADGVEDAEPGE 914


>gi|119386572|ref|YP_917627.1| DNA gyrase subunit A [Paracoccus denitrificans PD1222]
 gi|119377167|gb|ABL71931.1| DNA gyrase, A subunit [Paracoccus denitrificans PD1222]
          Length = 913

 Score =  952 bits (2460), Expect = 0.0,   Method: Composition-based stats.
 Identities = 480/918 (52%), Positives = 635/918 (69%), Gaps = 15/918 (1%)

Query: 1   MTEHIISSDEEEEKGITS----------VSITDEMQNSYLTYAINVILGRAIPDLRDGLK 50
           M +   + D+  E G +           + I  EM++SYL YA++VI+ RAIPDLRDGLK
Sbjct: 1   MADIPENDDDTPENGGSERAVMHHDGPVIDIAHEMRSSYLDYAMSVIVSRAIPDLRDGLK 60

Query: 51  PVHRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLL 110
           PVHRR+LF M + G   +K Y K AR  G+ MGKYHPHG+A+IYDAL RMAQD+S+ L L
Sbjct: 61  PVHRRVLFAMHETGNTHDKPYRKSARPVGDTMGKYHPHGDASIYDALVRMAQDFSMSLPL 120

Query: 111 IEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCAR 170
           ++GQGNFGS+DGD PAA RYTE R+ K + +LL D+ KDTV+F+ NYDG  +EP VL AR
Sbjct: 121 LDGQGNFGSMDGDSPAAMRYTEVRMDKPSAYLLMDIDKDTVEFQDNYDGKDREPTVLPAR 180

Query: 171 YPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAV 230
           +PN+LVNG GGIAVGMATNIP HNLGEVVD  +A+I++PD+  + L+EI+ GPDFPTG +
Sbjct: 181 FPNMLVNGAGGIAVGMATNIPPHNLGEVVDATLALIEDPDLPTERLLEIVPGPDFPTGGI 240

Query: 231 ILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVRE 290
           ILGR+G + AY  GRGSI++R  + IE+T   R+ I++ EIP+QVNKA+++EKIAEL +E
Sbjct: 241 ILGRSGARKAYLEGRGSIIVRAKTRIEETRAGRQAIILDEIPFQVNKASLIEKIAELAKE 300

Query: 291 KRIVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPE 350
           KRI  IA ++DESDR G RVVIELKR A+A+V+LNQL+R+T +Q+ F  NM+ALNG +PE
Sbjct: 301 KRIEGIAHVQDESDRVGVRVVIELKRDATAEVVLNQLFRFTPMQTSFGANMLALNGGRPE 360

Query: 351 RFTLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNP 410
           + TL   L  F+ FREEVV RRT Y L KAR+RAHVL GLA+AV+N+DEVV  IR S + 
Sbjct: 361 QLTLRDFLTHFLTFREEVVARRTAYELRKARERAHVLCGLAVAVSNVDEVVATIRSSADA 420

Query: 411 ETARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGR 470
             AR  LM R W A +I + + LIDD  + +  DGT  LSE Q RAILELRL RLT LG 
Sbjct: 421 AEARERLMTRRWPAHEIVEYLKLIDDPLHPVNEDGTYNLSETQARAILELRLQRLTQLGV 480

Query: 471 DDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDE 530
            ++ +EL SL   I+E L IL+SR R++GII  EL  VK+    PRRT I +   D++DE
Sbjct: 481 QEVTDELKSLAEAIREFLAILASRERIMGIISDELREVKNLFAVPRRTEITDWAGDLDDE 540

Query: 531 DCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVL 590
           D I REDMVVT++  GY+KR  L+ +RAQRRGGKG SG+  +++D VT LF+ +THT +L
Sbjct: 541 DLIEREDMVVTITSGGYIKRTALAEFRAQRRGGKGLSGMATKEDDVVTTLFVANTHTELL 600

Query: 591 FFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVF 650
           FF++ G VY+ K WRLP+G   A+GKA++NIL +  G  I  +MP    +S W+   V+F
Sbjct: 601 FFTTDGMVYRLKTWRLPLGGRTAKGKAIVNILPIGSGVSIAALMPVDAPQSEWDGYQVIF 660

Query: 651 ATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPI 710
           +T  G+VRRN LSDF  + R+GKIAMKL    E++     T+ +D++L T  G+ +RF  
Sbjct: 661 STSEGDVRRNALSDFANVMRNGKIAMKLPEGVELIGARMATESDDVMLFTAAGRAIRFQT 720

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTE 770
           + +RVF GR+S GVRGI LA GD+V+SM+I+ H +AD  ER  Y+K   A    +    E
Sbjct: 721 TDVRVFKGRDSTGVRGIRLASGDRVVSMSIIRHFEADAGERAAYLKMRRAVEGALDDGAE 780

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
                  D+ VE  IS+ER  E+   E  ILT++ +G GK +SS+D+ +  R G+G+ A 
Sbjct: 781 --ADEDEDNVVEAAISQERYAEMSAAEDLILTITARGAGKISSSHDYPVRGRGGQGVMAM 838

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
           D  K    G LVA FPV+ +DQI+L +  G  IRVPV+ I   SR+  GV +F+TA  E 
Sbjct: 839 D--KAMRGGPLVASFPVDRDDQIMLATSTGQSIRVPVDGISFRSRSAGGVRVFNTAPGEE 896

Query: 891 VVSVERIRESEIVDEAES 908
           VVSV RI E+   DEAE+
Sbjct: 897 VVSVARIAEN-GEDEAEA 913


>gi|149204038|ref|ZP_01881006.1| DNA gyrase subunit A [Roseovarius sp. TM1035]
 gi|149142480|gb|EDM30525.1| DNA gyrase subunit A [Roseovarius sp. TM1035]
          Length = 899

 Score =  951 bits (2459), Expect = 0.0,   Method: Composition-based stats.
 Identities = 479/891 (53%), Positives = 620/891 (69%), Gaps = 7/891 (0%)

Query: 18  SVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARI 77
           SVSIT EM+ SYL YA++VI+ RAIPDLRDGLKPVHRRIL+ M + G   +K Y K AR 
Sbjct: 15  SVSITHEMKTSYLDYAMSVIVSRAIPDLRDGLKPVHRRILYAMHESGNTHDKPYRKSARA 74

Query: 78  SGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQK 137
            G+VMGKYHPHG++AIYDAL RMAQD+S+ L L++GQGNFGS+DGD  AA RYTE R+ K
Sbjct: 75  VGDVMGKYHPHGDSAIYDALVRMAQDFSMSLPLLDGQGNFGSMDGDNAAAMRYTEVRMDK 134

Query: 138 AAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGE 197
            A +LL D+ K+TV+F+ NYDG  +EP VL AR+PN+LVNG GGIAVGMATNIP HNLGE
Sbjct: 135 PAAYLLADIEKETVNFQDNYDGKDREPTVLPARFPNMLVNGAGGIAVGMATNIPPHNLGE 194

Query: 198 VVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIE 257
           VVD  +A+IDNPD++ + L++ I GPDFPTG ++LGR+G + AY  GRGS++IR  +  E
Sbjct: 195 VVDATLALIDNPDLESEDLIQYIPGPDFPTGGLMLGRSGARKAYLEGRGSVIIRAKTRTE 254

Query: 258 KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRG 317
           +   DR  I++ EIPYQVNKA M+E+IAE  R+KRI  IA ++DESDR G RVVIELKR 
Sbjct: 255 EIRKDRYAIIIDEIPYQVNKATMIERIAEAARDKRIEGIAHVQDESDRNGVRVVIELKRD 314

Query: 318 ASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLL 377
           A+A+V+LNQLYR+T +Q+ F  NM+ALNG KPE+ TL   L  F+ FREEVV RRT Y L
Sbjct: 315 ATAEVVLNQLYRFTPMQTYFGCNMLALNGGKPEQLTLHRFLSLFITFREEVVARRTAYDL 374

Query: 378 NKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDS 437
            KAR+RAHVL GLA+AV+N+DEVV  IR S +   AR++LM+R W A DI   I LIDD 
Sbjct: 375 RKARERAHVLCGLAVAVSNVDEVVATIRGSMDAAEARQKLMERRWPAGDILPYIALIDDP 434

Query: 438 SYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRL 497
           S+   +DGT  LSEVQ RAIL+LRL RLT LG  ++ +EL  L  +IKE L IL+SR R+
Sbjct: 435 SHPANADGTYNLSEVQARAILDLRLQRLTQLGVKEVTDELQDLAGKIKEYLAILASRERI 494

Query: 498 LGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYR 557
           + II  EL  V++    PRRT IV+   DMEDED I REDMVVTV+  GY+KR  L+ +R
Sbjct: 495 MQIISDELREVRELFAVPRRTEIVDWSGDMEDEDLIEREDMVVTVTSGGYIKRTALADFR 554

Query: 558 AQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKA 617
           AQ+RGGKG SG+  +DED VT LF+ +THT +LFF++ G VYK K WRLP+G   ++GKA
Sbjct: 555 AQKRGGKGLSGMATKDEDVVTTLFVANTHTQLLFFTTGGMVYKLKTWRLPLGGRTSKGKA 614

Query: 618 LINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMK 677
           ++NIL +  G  I  IMP    E  W +L +VFAT  G+VRRN LSDF  + R+GKIAM 
Sbjct: 615 IVNILPIPTGVSIAAIMPVDRPEEDWEDLQIVFATSAGDVRRNALSDFTNVMRNGKIAMD 674

Query: 678 LDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVIS 737
           L    E+++   C  E+D++L T  G+ +RFP + +RVF GR S GVRGI L   D+V+S
Sbjct: 675 LPEGVELVNARICGPEDDVMLVTDSGRAIRFPTTEVRVFKGRKSTGVRGIRLLGDDRVVS 734

Query: 738 MAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKE 797
           M+++ H DA  D+R  Y+K      R      E+  +  ++ + +  +S E+  E++  E
Sbjct: 735 MSVIRHFDASADDRAAYLKM-----RRQLAGAEDDGTSDDEGNADAALSAEQFAEMQAAE 789

Query: 798 QFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVS 857
             ILT++ +G GK +SS+D+ +  R G G++A D  K    G +VA FPV   DQI+L +
Sbjct: 790 NLILTITARGTGKLSSSHDYPVRGRGGMGVQAMD--KGMRGGTVVASFPVTLEDQIMLAT 847

Query: 858 DKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAES 908
            KG  IRVPV  I   SR+  GV +F+T   E VVSV  I E    DE   
Sbjct: 848 SKGQSIRVPVMGISFRSRSAGGVKVFNTGAGEEVVSVAWIAEQAEEDETAE 898


>gi|83749097|ref|ZP_00946102.1| DNA gyrase subunit A [Ralstonia solanacearum UW551]
 gi|83724218|gb|EAP71391.1| DNA gyrase subunit A [Ralstonia solanacearum UW551]
          Length = 1016

 Score =  950 bits (2456), Expect = 0.0,   Method: Composition-based stats.
 Identities = 386/921 (41%), Positives = 568/921 (61%), Gaps = 65/921 (7%)

Query: 5   IISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMG 64
           I+   ++  K    VS+ +EM++SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M ++ 
Sbjct: 128 IVRPMDQFAKETLPVSLEEEMRSSYLAYAMSVIVGRALPDVRDGLKPVHRRVLYAMHELN 187

Query: 65  VEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDP 124
            +WN+ Y K ARI G+V+GKYHPHG++A+YD + RMAQD+SLR +L++GQGNFGSVDGD 
Sbjct: 188 NDWNRPYKKSARIVGDVIGKYHPHGDSAVYDTIVRMAQDFSLRYMLVDGQGNFGSVDGDN 247

Query: 125 PAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAV 184
            AA RYTE RL K AH LL D+ K+TV+F PNYDGS  EP +L AR PN+L+NG  GIAV
Sbjct: 248 AAAMRYTEIRLSKIAHELLADIDKETVNFEPNYDGSETEPSILPARIPNLLINGSSGIAV 307

Query: 185 GMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATG 244
           GMATNIP HNL EVVDGC+ ++ NPD  +D L+E+I  PDFPT  +I G +G++  Y TG
Sbjct: 308 GMATNIPPHNLREVVDGCLHLLRNPDATVDELIELIPAPDFPTAGIIYGISGVREGYRTG 367

Query: 245 RGSIVIRGVSHIEKTSGDREQ-IVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDES 303
           RG +V+R  +H E     + Q I+V E+PYQVNK  +LE+IAELV EKR+  I+D+RDES
Sbjct: 368 RGRVVMRAKTHFEDIDRGQRQSIIVDELPYQVNKRTLLERIAELVTEKRVEGISDIRDES 427

Query: 304 DRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVA 363
           D+ G RVVIELKRG   +V+LN LY+ T LQ  F +NMVAL   +P    L  +L+ F+ 
Sbjct: 428 DKSGMRVVIELKRGEVPEVVLNNLYKNTQLQDTFGMNMVALVDGQPRLLNLRQMLECFLL 487

Query: 364 FREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWN 423
            R EVV RRT + L KAR+R H+L GLA+A+AN+DE + II+ +P P  A++ELM RSW+
Sbjct: 488 HRREVVTRRTVFDLRKARERGHILEGLAVALANIDEFIAIIKAAPTPPIAKQELMGRSWD 547

Query: 424 ASDIKDLIDLIDDSS---------------YTIGSDGTMYLSEVQTRAILELRLARLTGL 468
           +  ++D++   +  +               + +  DG   LS+ Q + IL++RL RLTGL
Sbjct: 548 SGLVRDMLSRAESDTVGGRTAYRPEGLLPVFGMQGDGLYKLSDTQAQEILQMRLQRLTGL 607

Query: 469 GRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDME 528
            +D I  E   +  +I + LDIL+   R+  II +EL  ++ E    RR++I     +++
Sbjct: 608 EQDKIVQEYREVMAQIADLLDILARPERITAIIVEELTLIRSEFGDERRSQIEHNATELD 667

Query: 529 DEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTS 588
            ED I  +D+VVT+SH GY+K  P+S YRAQ+RGG+G+     +++D++  LF+ +TH  
Sbjct: 668 TEDLITPQDLVVTLSHSGYMKSQPISEYRAQKRGGRGKQAAATKEDDWIDTLFVANTHDY 727

Query: 589 VLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYV 648
           +L FS+ G +Y  KVW +P GS  +RG+ ++N+  L+ GE+I  I+P  + +      +V
Sbjct: 728 ILCFSNRGRLYWLKVWEVPQGSRNSRGRPIVNMFPLSPGEKINVILPVKQFD---EQHFV 784

Query: 649 VFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRF 708
             AT  G V++  L++F    ++G IA+ LD  D ++  +    ++D++L +  G+ VRF
Sbjct: 785 FMATSKGTVKKTALTEFSNPRKAGIIAVDLDEGDFLIGADITDGQHDVMLFSDAGKAVRF 844

Query: 709 PISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGD 768
             + +R   GR + GVRG++L +G QVI+M +     A   E+                 
Sbjct: 845 DENDVRPM-GRQARGVRGMNLEEGQQVIAMLVAPAETAGEGEQAVAGS------------ 891

Query: 769 TEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIR 828
                                          +LT +E G+GKRT   ++    R  KG+ 
Sbjct: 892 -------------------------------VLTATENGYGKRTPISEYTRHGRGTKGMI 920

Query: 829 ATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKD 888
           A   S+ N  G +VA   V   D+I+L++  G LIR  V+EIR   RAT+GV + +  + 
Sbjct: 921 AIQTSERN--GKVVAAALVAPEDEIMLITTGGVLIRTRVDEIREMGRATQGVTLIAVGEG 978

Query: 889 ERVVSVERIRESEIVDEAEST 909
            ++  ++R+ ES+   E  + 
Sbjct: 979 NKLSGLQRVVESDAEGEDAAD 999



 Score = 76.0 bits (185), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 49/244 (20%), Positives = 104/244 (42%), Gaps = 13/244 (5%)

Query: 533  IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
               +  V   +  G VK+  L+ +   R+ G     +   + DF+    I      V+ F
Sbjct: 778  FDEQHFVFMATSKGTVKKTALTEFSNPRKAGIIAVDLD--EGDFLIGADITDGQHDVMLF 835

Query: 593  SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNL----YV 648
            S  G   +     +     QARG   +N   L +G+++  ++  P + +          V
Sbjct: 836  SDAGKAVRFDENDVRPMGRQARGVRGMN---LEEGQQVIAMLVAPAETAGEGEQAVAGSV 892

Query: 649  VFATKHGNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQC 705
            + AT++G  +R  +S++ +  R   G IA++      ++++      E++I+L T  G  
Sbjct: 893  LTATENGYGKRTPISEYTRHGRGTKGMIAIQTSERNGKVVAAALVAPEDEIMLITTGGVL 952

Query: 706  VRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLI 765
            +R  +  IR   GR + GV  I++ +G+++  +  V+ +DA+ ++    +     +    
Sbjct: 953  IRTRVDEIREM-GRATQGVTLIAVGEGNKLSGLQRVVESDAEGEDAADGVTESDGEAPSA 1011

Query: 766  SGDT 769
                
Sbjct: 1012 DTTE 1015


>gi|99081173|ref|YP_613327.1| DNA gyrase subunit A [Ruegeria sp. TM1040]
 gi|99037453|gb|ABF64065.1| DNA gyrase A subunit [Ruegeria sp. TM1040]
          Length = 912

 Score =  950 bits (2455), Expect = 0.0,   Method: Composition-based stats.
 Identities = 483/919 (52%), Positives = 636/919 (69%), Gaps = 17/919 (1%)

Query: 1   MTEHIISSDEEEEKGIT-------SVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVH 53
           M++   + +  +E           +VSI  EM+NSYL YA++VI+ RAIPDLRDGLKPVH
Sbjct: 1   MSDTPETPENPDENLPQRPSYDGPTVSIESEMRNSYLDYAMSVIVSRAIPDLRDGLKPVH 60

Query: 54  RRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEG 113
           RRIL+ M + G   +K Y K AR  G+VMGKYHPHG++AIYDAL RMAQD+S+ L L++G
Sbjct: 61  RRILYAMHETGNSHDKAYRKSARPVGDVMGKYHPHGDSAIYDALVRMAQDFSMSLPLLDG 120

Query: 114 QGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPN 173
           QGNFGS+DGD PAA RYTE R+ K A F+L D+ K+TVDF+ NYDG  +EP VL AR+PN
Sbjct: 121 QGNFGSMDGDNPAAMRYTEVRMDKPAAFMLADIEKETVDFQDNYDGKDKEPTVLPARFPN 180

Query: 174 VLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILG 233
           +LVNG GGIAVGMATNIP HNLGEVVD  +A+I++PD+  + L+E + GPDFPTG V+LG
Sbjct: 181 MLVNGAGGIAVGMATNIPPHNLGEVVDATLALIEDPDLTSEQLIEYVPGPDFPTGGVMLG 240

Query: 234 RTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRI 293
           R+G + AY  GRGS++IR  + +E+   DR  IVV EIPYQVNKA+M+EKIAE VREKRI
Sbjct: 241 RSGARKAYLEGRGSVIIRAKTRVEEIRKDRYAIVVDEIPYQVNKASMIEKIAEQVREKRI 300

Query: 294 VDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFT 353
             +A ++DESDR G RVV+ELKR A+ +V+LNQLYR+T +Q+ F  NM+ALNG +PE+ T
Sbjct: 301 EGVAHVQDESDRNGVRVVVELKRDATPEVVLNQLYRFTPMQTSFGCNMLALNGGRPEQLT 360

Query: 354 LIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETA 413
           L   L +F+ FRE+VV RRT Y L KAR+R+H+L GLA+AV+N+DEVV  IR S +   A
Sbjct: 361 LRKFLTSFIDFREDVVARRTAYNLRKARERSHILCGLAVAVSNVDEVVATIRSSADAAEA 420

Query: 414 RRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDI 473
           R +LM R W A+DI   I LIDD ++T+  DGT  LSEVQ RAILELRL RLT LG  ++
Sbjct: 421 RHKLMTRRWPAADIAGYIRLIDDPTHTMNDDGTYNLSEVQARAILELRLQRLTQLGVKEV 480

Query: 474 RNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCI 533
            +EL  L  +IKE L+ILSSR R++ II  EL  V++    PRRT IV+   DMEDED I
Sbjct: 481 TDELEELAGKIKEYLEILSSRERIMSIIADELAEVRESFAVPRRTEIVDWSGDMEDEDLI 540

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
            REDMVVTV+  GY+KR PL+ +RAQ+RGGKG SG+  ++ED VT LF+ +THT +LFF+
Sbjct: 541 EREDMVVTVTSGGYIKRTPLADFRAQKRGGKGLSGMQTKEEDVVTTLFVANTHTQLLFFT 600

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           + G VYK K WRLP G   ++GKA++NIL +  G  I  IMP   DE  W++L ++FAT 
Sbjct: 601 TDGMVYKLKTWRLPQGGRTSKGKAIVNILPIPTGVSIAAIMPVDRDEKEWDDLQIMFATS 660

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLDS---RDEILSVETCTQENDILLTTKLGQCVRFPI 710
            G VRRN+LSDF  + R+GKIAMK +      ++++   C++++DI+L T  G+ +RFP 
Sbjct: 661 AGTVRRNRLSDFTNVMRNGKIAMKFEDENQGTKLINARICSEDDDIMLVTNTGRAIRFPT 720

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTE 770
           + +RVF  RNSVGVRGI L + D+V+SM+++ H+    ++R  Y+K   A   L   D  
Sbjct: 721 TEVRVFNSRNSVGVRGIKLGEDDEVVSMSVIRHSKYTPEQRSAYLKMRRAMAGLTDEDAS 780

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
                  D+  + N S E   E+   E  ILT++  G GK +SS+D+ +  R G G+ A 
Sbjct: 781 -----DEDAVEDPNFSTELFAEMSAAENLILTITAGGSGKLSSSHDYPVRGRGGMGVTAM 835

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
           D  K    GALVA FPV  +DQI+L + KG  IRVPV+ I   SR+  GV IF+T K E 
Sbjct: 836 D--KAMRGGALVASFPVELDDQIMLATSKGQSIRVPVDGISFRSRSAGGVRIFNTGKGEE 893

Query: 891 VVSVERIRESEIVDEAEST 909
           VVSV  I ++   +E    
Sbjct: 894 VVSVAWIADNGDDEETVEE 912


>gi|85705334|ref|ZP_01036433.1| DNA gyrase, subunit A [Roseovarius sp. 217]
 gi|85670207|gb|EAQ25069.1| DNA gyrase, subunit A [Roseovarius sp. 217]
          Length = 899

 Score =  950 bits (2455), Expect = 0.0,   Method: Composition-based stats.
 Identities = 484/907 (53%), Positives = 627/907 (69%), Gaps = 10/907 (1%)

Query: 4   HIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQM 63
                +     G  SVSIT EM+ SYL YA++VI+ RAIPDLRDGLKPVHRRIL+ M + 
Sbjct: 2   DETPPERPSYSG-PSVSITHEMKTSYLDYAMSVIVSRAIPDLRDGLKPVHRRILYAMHEG 60

Query: 64  GVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGD 123
           G   +K Y K AR  G+VMGKYHPHG++AIYDAL RMAQD+S+ L L++GQGNFGS+DGD
Sbjct: 61  GNTHDKPYRKSARAVGDVMGKYHPHGDSAIYDALVRMAQDFSMSLPLLDGQGNFGSMDGD 120

Query: 124 PPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIA 183
             AA RYTE R+ K A +LL D+ KDTV+F+ NYDG  +EP VL AR+PN+LVNG GGIA
Sbjct: 121 NAAAMRYTEVRMDKPAAYLLADIEKDTVNFQDNYDGKDREPTVLPARFPNMLVNGAGGIA 180

Query: 184 VGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYAT 243
           VGMATNIP HNLGEVVD  +A+I+NPD++ + L++ I GPDFPTG ++LGR+G + AY  
Sbjct: 181 VGMATNIPPHNLGEVVDATLALIENPDLESEDLIQYIPGPDFPTGGLMLGRSGARKAYLE 240

Query: 244 GRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDES 303
           GRGS++IR  + +E+   DR  I++ EIPYQVNKA M+E+IAE  REKRI  I+ ++DES
Sbjct: 241 GRGSVIIRAKTRVEEIRKDRYAIIIDEIPYQVNKATMIERIAEAAREKRIEGISHVQDES 300

Query: 304 DRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVA 363
           DR G RVVIELKR A+A+V+LNQL+R+T +Q+ F  NM+ALNG KPE+ TL   L  F+ 
Sbjct: 301 DRNGVRVVIELKRDATAEVVLNQLFRFTPMQTYFGCNMLALNGGKPEQLTLHRFLSLFIV 360

Query: 364 FREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWN 423
           FREEVV RRT + L +AR+RAHVL GLA+AV+N+DEVV  IR S +   AR +LM+R W 
Sbjct: 361 FREEVVARRTAFELRRARERAHVLCGLAVAVSNVDEVVATIRASADAAEARLKLMERRWP 420

Query: 424 ASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIE 483
           A +I   I LIDD S+    DGT  LSEVQ RAIL+LRL RLT LG  ++ +EL  L  +
Sbjct: 421 AREILPYIALIDDPSHPANEDGTYNLSEVQARAILDLRLQRLTQLGVKEVTDELQDLAGK 480

Query: 484 IKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVS 543
           IKE L IL+SR R++ II  EL  V+D    PRRT+IV+   DMEDED I REDMVVTV+
Sbjct: 481 IKEYLAILASRERIMQIISDELREVRDLFAVPRRTQIVDWSGDMEDEDLIEREDMVVTVT 540

Query: 544 HLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKV 603
             GY+KR  L+ +RAQ+RGGKG SG+  +DED VT LF+ +THT +LFF++ G VYK K 
Sbjct: 541 SGGYIKRTALADFRAQKRGGKGLSGMATKDEDVVTTLFVANTHTQLLFFTTGGMVYKLKT 600

Query: 604 WRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLS 663
           WRLP+G   ++GKA++NIL +  G  I  IMP    E  W +L +VFAT  G+VRRN LS
Sbjct: 601 WRLPLGGRTSKGKAIVNILPIPTGVSIAAIMPVDRPEEDWEDLQIVFATSAGDVRRNALS 660

Query: 664 DFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVG 723
           DF  + R+GKIAM L    E+++   C  E+D++L T  G+ +RFP + +RVF GR S G
Sbjct: 661 DFTNVMRNGKIAMDLPEGVELVNARICGPEDDVMLVTDSGRAIRFPTTEVRVFKGRKSTG 720

Query: 724 VRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEG 783
           VRGI L   D+V+SM+++ H DA  DER  Y+K      R      +E  +  ++ + + 
Sbjct: 721 VRGIRLLGNDRVVSMSVISHFDASADERAAYLKM-----RRQLAGADEDAAADDEGNADA 775

Query: 784 NISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVA 843
            IS ER +E++L E  ILT++ KG GK +SS+D+ +  R G G++A D  K    G +VA
Sbjct: 776 AISPERFEEMQLAENLILTITAKGTGKLSSSHDYPVRGRGGMGVQAMD--KGMRGGTVVA 833

Query: 844 VFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIV 903
            FPV   DQI+L + KG  IRVPV  I   SR+  GV +F+T   E VVSV  I E    
Sbjct: 834 SFPVTLEDQIMLATSKGQSIRVPVMGISFRSRSAGGVKVFNTGTGEEVVSVAWIAEQ--A 891

Query: 904 DEAESTE 910
           DE E+ E
Sbjct: 892 DEDETAE 898


>gi|77463183|ref|YP_352687.1| DNA gyrase subunit A [Rhodobacter sphaeroides 2.4.1]
 gi|77387601|gb|ABA78786.1| DNA gyrase/topoisomerase IV, subunit A [Rhodobacter sphaeroides
           2.4.1]
          Length = 907

 Score =  948 bits (2451), Expect = 0.0,   Method: Composition-based stats.
 Identities = 480/901 (53%), Positives = 629/901 (69%), Gaps = 9/901 (0%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
            G+  VSI +EM+ +YL YA++VI+ RAIPDLRDGLKPVHRRIL+ M + G   +K Y K
Sbjct: 6   SGLPQVSIAEEMKTAYLDYAMSVIVSRAIPDLRDGLKPVHRRILYAMHETGNTHDKPYRK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            AR  G+ MGKYHPHG+ AIYDAL RMAQ +S+ L L++GQGNFGS+DGD  AA RYTE 
Sbjct: 66  SARPVGDTMGKYHPHGDGAIYDALVRMAQPFSMGLKLLDGQGNFGSMDGDNAAAMRYTEV 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K A FLL D+ KDTVDF+ NYDG  +EP VL AR+PN+LVNG GGIAVGMATNIP H
Sbjct: 126 RMDKPAAFLLADIDKDTVDFQDNYDGKDREPTVLPARFPNMLVNGAGGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NLGEVVD  +A+I+NPDI  + LMEII GPDFPTG VILGR+G + AY  GRGS+++R  
Sbjct: 186 NLGEVVDATLAMIENPDISTERLMEIIPGPDFPTGGVILGRSGARKAYLEGRGSVIMRAK 245

Query: 254 SHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
           + +E+   DR  IV+ EIPYQVNKA M+EKIA++VREK+I  IA ++DESDR G RVVIE
Sbjct: 246 ARVEEIRKDRYAIVLDEIPYQVNKATMIEKIADMVREKKIEGIAHVQDESDRVGVRVVIE 305

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           LKR A+ +V+LNQL+R+T +Q+ F  NM+ALNG +PE+ TL   L  F+ FRE+VV RRT
Sbjct: 306 LKRDATPEVVLNQLWRFTPMQTTFGCNMLALNGGRPEQLTLRDFLSHFLTFREDVVARRT 365

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            Y L KAR+R+H+L GLA+AV+N+DEVV  IR S +P  AR  LM R W A+DI D I L
Sbjct: 366 AYELRKARERSHILCGLAVAVSNVDEVVATIRSSADPAEARERLMTRRWPAADIADYIRL 425

Query: 434 IDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSS 493
           IDD S+TI  DGT  LSE+Q RAIL+LRL RLT +G  ++ +EL  L  +I++ LDIL S
Sbjct: 426 IDDPSHTINEDGTYNLSEIQARAILDLRLQRLTAMGVKEVTDELAELAAKIRDYLDILGS 485

Query: 494 RSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPL 553
           R R++ II  EL  VKD    PRRT I E   D+EDED I REDMVVT++  GY+KR PL
Sbjct: 486 RERIMAIISDELREVKDLFAVPRRTEISEWAGDLEDEDLIEREDMVVTITSGGYIKRTPL 545

Query: 554 SVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQA 613
           + +R+QRRGGKG + +  +++D VT LF+ +THT +LFF++ G VY  K WRLP+G   A
Sbjct: 546 AEFRSQRRGGKGLASMATKEDDVVTTLFVANTHTQLLFFTTDGMVYDLKCWRLPLGGRTA 605

Query: 614 RGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGK 673
           +GKA++NIL +  G  I  +M   E E  W+ L VVFAT  G+VRRN+LSDF  + R+GK
Sbjct: 606 KGKAIVNILPIATGISIAALMKIDEPEEEWDRLQVVFATSEGDVRRNRLSDFTNVKRNGK 665

Query: 674 IAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGD 733
           IAMKL     +++V  C +++D+++ T LG+ +RF  + +RVF+GR+S GVRGI LA GD
Sbjct: 666 IAMKLPEGVSLVNVSICDEQDDVMMVTALGRAIRFSTTDVRVFSGRDSTGVRGIRLASGD 725

Query: 734 QVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQEL 793
           +V+SM+++ H +AD  ER  Y+K     R +     E     + D+   G +S  R  E+
Sbjct: 726 RVVSMSVIRHFEADPAERAAYLKQR---RLMAGVTEEAEADEEEDAVEAGQLSPTRYAEM 782

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
              E  ILT++ +G GK +SS+D+ +  R G+G+ A    K    G LVA FPV  +DQ+
Sbjct: 783 SAAEDLILTITARGLGKISSSHDYPVRGRGGQGVTA--FEKSMRGGQLVASFPVEMSDQV 840

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE----SEIVDEAEST 909
           +L +  G  IRVPV +I   SR+  GV +F T   E VVSV RI +    +E V++AE  
Sbjct: 841 MLATSGGQSIRVPVEQISFRSRSAGGVRVFDTGASEEVVSVARIADAGDTAEGVEDAEPG 900

Query: 910 E 910
           E
Sbjct: 901 E 901


>gi|295689998|ref|YP_003593691.1| DNA gyrase, subunit A [Caulobacter segnis ATCC 21756]
 gi|295431901|gb|ADG11073.1| DNA gyrase, A subunit [Caulobacter segnis ATCC 21756]
          Length = 918

 Score =  948 bits (2450), Expect = 0.0,   Method: Composition-based stats.
 Identities = 502/917 (54%), Positives = 659/917 (71%), Gaps = 9/917 (0%)

Query: 1   MTEH-IISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFG 59
           M++       +     I  ++I DE++ SYL YA++VI+ RA+PD RDGLKPVHRR+LF 
Sbjct: 1   MSDEHTTIPADGSRGDIAPINIEDELRRSYLDYAMSVIVSRALPDARDGLKPVHRRVLFS 60

Query: 60  MMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS 119
           M + G    + YVK AR+ G+VMGKYHPHG+A+IY  L RM Q +S+ L+LI+GQGNFGS
Sbjct: 61  MHEQGQTPERPYVKSARVVGDVMGKYHPHGDASIYFTLVRMTQPFSMGLVLIDGQGNFGS 120

Query: 120 VDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGG 179
           VDGD PAA RYTECR+   A  LL DL KDTVDF  NYDG  QEP VL AR PN+LVNG 
Sbjct: 121 VDGDMPAAMRYTECRMAPPAMALLADLDKDTVDFVDNYDGKEQEPTVLPARIPNLLVNGA 180

Query: 180 GGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKN 239
           GGIAVGMATNIP HNLGEV+D C+ +ID P+I  D L++++ GPDFPTG  I+GR G + 
Sbjct: 181 GGIAVGMATNIPPHNLGEVIDACLLLIDEPEITTDQLLDLVPGPDFPTGGEIIGRAGPRQ 240

Query: 240 AYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           A  TGRGS+++RGV+ +E     RE I+VTEIPYQVNKA ++E IAELVR+K++  IAD+
Sbjct: 241 ALLTGRGSVIMRGVASVEDLRAGREAIIVTEIPYQVNKANLVEHIAELVRDKKLEGIADI 300

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDES+R G R+VIELKR AS +VILNQLYR+T+LQS F VNM+ALN  +PE+  L  +L+
Sbjct: 301 RDESNRDGMRIVIELKRDASGEVILNQLYRFTALQSSFGVNMLALNRGRPEQMGLHKLLQ 360

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
            FV FREEVVVRRTK+ L KARDR HVLVGL IAVAN+DE + IIR S +P  AR  L+ 
Sbjct: 361 LFVEFREEVVVRRTKFELGKARDRGHVLVGLTIAVANIDEFIHIIRSSKDPTEARERLVA 420

Query: 420 RSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           +SW A D+  L++LI D        G + L++ Q RAIL L L+RLTGLGR++I NE  +
Sbjct: 421 KSWPAGDMLPLVELIADPRTIQEEGGLIRLTDEQARAILALTLSRLTGLGREEIGNEAET 480

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           L   I+  L++LS R+ ++ ++++EL+ V+++   PRR +IV+G  DMEDED IVREDMV
Sbjct: 481 LADAIRGYLELLSDRANIMAVVREELVEVREKFAVPRRCQIVDGDADMEDEDLIVREDMV 540

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           +TV+  GYVKR PL+ YR Q RGGKG+SG+  ++ED VT +F  STH  +LFF+S G VY
Sbjct: 541 ITVTMGGYVKRTPLANYRTQHRGGKGKSGMATKNEDAVTRVFSASTHAPLLFFTSGGKVY 600

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           K KVWRLP+G   +RGKA +N+L +  GE IT+I+  PEDE++W+ L V+FAT+ G+VRR
Sbjct: 601 KMKVWRLPLGVANSRGKAFVNLLPIESGETITSILALPEDEATWSGLDVMFATRSGSVRR 660

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           NKLSDF+ + R+GKIAMKLD  D I+ V  C  + D+LLTT  G+C+RF +  +RVFA R
Sbjct: 661 NKLSDFVDVRRNGKIAMKLDEGDGIVGVAVCNADQDVLLTTAAGRCIRFSVDEVRVFASR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEIT---SLK 776
           +S GVRG+ LA+GD+VISMA++   DA   ER  Y+KH  A  R    + ++        
Sbjct: 721 DSTGVRGVRLAEGDEVISMAVLRSVDATPAERAAYLKHQRAMLRAAGEEGDDAPVAAEEG 780

Query: 777 NDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKIN 836
            + + E  +S ER  EL   E+ +LTVS +GFGKRTS+YDFR + R G+G+ A D+SK  
Sbjct: 781 EEDADETTLSPERIAELGAAEEILLTVSSEGFGKRTSAYDFRRTGRGGQGLAAQDLSKR- 839

Query: 837 EIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVER 896
             G LV  FP++++DQI+LV+D+G LIRVPV++IR+A+R T+GV IF TA+DE VVSVER
Sbjct: 840 -GGRLVGSFPIDESDQILLVTDQGQLIRVPVSQIRVAARNTQGVTIFRTAQDEHVVSVER 898

Query: 897 IRESEIVD---EAESTE 910
           + +S   D   E    E
Sbjct: 899 LADSGGDDNQGEDSGAE 915


>gi|126462055|ref|YP_001043169.1| DNA gyrase subunit A [Rhodobacter sphaeroides ATCC 17029]
 gi|126103719|gb|ABN76397.1| DNA gyrase, A subunit [Rhodobacter sphaeroides ATCC 17029]
          Length = 907

 Score =  948 bits (2450), Expect = 0.0,   Method: Composition-based stats.
 Identities = 480/901 (53%), Positives = 629/901 (69%), Gaps = 9/901 (0%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
            G+  VSI +EM+ +YL YA++VI+ RAIPDLRDGLKPVHRRIL+ M + G   +K Y K
Sbjct: 6   SGLPQVSIAEEMKTAYLDYAMSVIVSRAIPDLRDGLKPVHRRILYAMHETGNTSDKPYRK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            AR  G+ MGKYHPHG+ AIYDAL RMAQ +S+ L L++GQGNFGS+DGD  AA RYTE 
Sbjct: 66  SARPVGDTMGKYHPHGDGAIYDALVRMAQPFSMGLKLLDGQGNFGSMDGDNAAAMRYTEV 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K A FLL D+ KDTVDF+ NYDG  +EP VL AR+PN+LVNG GGIAVGMATNIP H
Sbjct: 126 RMDKPAAFLLADIDKDTVDFQDNYDGKDREPTVLPARFPNMLVNGAGGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NLGEVVD  +A+I+NPDI  + LMEII GPDFPTG VILGR+G + AY  GRGS+++R  
Sbjct: 186 NLGEVVDATLAMIENPDISTERLMEIIPGPDFPTGGVILGRSGARKAYLEGRGSVIMRAK 245

Query: 254 SHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
           + +E+   DR  IV+ EIPYQVNKA M+EKIA++VREK+I  IA ++DESDR G RVVIE
Sbjct: 246 ARVEEIRKDRYAIVLDEIPYQVNKATMIEKIADMVREKKIEGIAHVQDESDRVGVRVVIE 305

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           LKR A+ +V+LNQL+R+T +Q+ F  NM+ALNG +PE+ TL   L  F+ FRE+VV RRT
Sbjct: 306 LKRDATPEVVLNQLWRFTPMQTTFGCNMLALNGGRPEQLTLRDFLSHFLTFREDVVARRT 365

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            Y L KAR+R+H+L GLA+AV+N+DEVV  IR S +P  AR  LM R W A+DI D I L
Sbjct: 366 AYELRKARERSHILCGLAVAVSNVDEVVATIRSSADPAEARERLMTRRWPAADIADYIRL 425

Query: 434 IDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSS 493
           IDD S+TI  DGT  LSE+Q RAIL+LRL RLT +G  ++ +EL  L  +I++ LDIL S
Sbjct: 426 IDDPSHTINEDGTYNLSEIQARAILDLRLQRLTAMGVKEVTDELAELAAKIRDYLDILGS 485

Query: 494 RSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPL 553
           R R++ II  EL  VKD    PRRT I E   D+EDED I REDMVVT++  GY+KR PL
Sbjct: 486 RERIMAIISDELREVKDLFAVPRRTEISEWAGDLEDEDLIEREDMVVTITSGGYIKRTPL 545

Query: 554 SVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQA 613
           + +R+QRRGGKG + +  +++D VT LF+ +THT +LFF++ G VY  K WRLP+G   A
Sbjct: 546 AEFRSQRRGGKGLASMATKEDDVVTTLFVANTHTQLLFFTTDGMVYDLKCWRLPLGGRTA 605

Query: 614 RGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGK 673
           +GKA++NIL +  G  I  +M   E E  W+ L VVFAT  G+VRRN+LSDF  + R+GK
Sbjct: 606 KGKAIVNILPIATGISIAALMKIDEPEEEWDRLQVVFATSEGDVRRNRLSDFTNVKRNGK 665

Query: 674 IAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGD 733
           IAMKL     +++V  C +++D+++ T LG+ +RF  + +RVF+GR+S GVRGI LA GD
Sbjct: 666 IAMKLPEGVSLVNVSICDEQDDVMMVTALGRAIRFSTTDVRVFSGRDSTGVRGIRLASGD 725

Query: 734 QVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQEL 793
           +V+SM+++ H +AD  ER  Y+K     R +     E     + D+   G +S  R  E+
Sbjct: 726 RVVSMSVIRHFEADPAERAAYLKQR---RLMAGVTEEAEADEEEDAVEAGQLSPTRYAEM 782

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
              E  ILT++ +G GK +SS+D+ +  R G+G+ A    K    G LVA FPV  +DQ+
Sbjct: 783 SAAEDLILTITARGLGKISSSHDYPVRGRGGQGVTA--FEKSMRGGQLVASFPVEMSDQV 840

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE----SEIVDEAEST 909
           +L +  G  IRVPV +I   SR+  GV +F T   E VVSV RI +    +E V++AE  
Sbjct: 841 MLATSGGQSIRVPVEQISFRSRSAGGVRVFDTGASEEVVSVARIADAGDTAEGVEDAEPG 900

Query: 910 E 910
           E
Sbjct: 901 E 901


>gi|3128378|gb|AAC16230.1| DNA gyrase subunit a [Rhodobacter capsulatus SB 1003]
          Length = 883

 Score =  947 bits (2448), Expect = 0.0,   Method: Composition-based stats.
 Identities = 462/886 (52%), Positives = 620/886 (69%), Gaps = 5/886 (0%)

Query: 25  MQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGK 84
           M+ +YL YA++VI+ RAIPDLRDGLKP HRRIL+ M + G   +K Y K AR  G+VMGK
Sbjct: 1   MKTAYLDYAMSVIVSRAIPDLRDGLKPAHRRILYAMHETGNTHDKPYRKSARPVGDVMGK 60

Query: 85  YHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLD 144
           YHPHG+AAIYDAL RMAQD+S+ L L++GQGNFGS+DGD  AA RYTE R+ K A FLL 
Sbjct: 61  YHPHGDAAIYDALVRMAQDFSMSLPLLDGQGNFGSMDGDSAAAMRYTEVRMDKPAAFLLA 120

Query: 145 DLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVA 204
           D+ KDTVDF+ NYDG  +EP VL AR+PN+LVNG GGIAVGMATNIP HNLGEV+D  +A
Sbjct: 121 DIEKDTVDFQDNYDGKDKEPTVLPARFPNMLVNGAGGIAVGMATNIPPHNLGEVIDATLA 180

Query: 205 VIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDRE 264
           +I+NPD+  +ALM+ + GPDFPTGA I+GR G + AY  GRGS++IR  + IE+   DR 
Sbjct: 181 LIENPDLSSEALMDYVPGPDFPTGAQIMGRGGARKAYLEGRGSVIIRAKTRIEEIRKDRF 240

Query: 265 QIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGASADVIL 324
            I++ EIPYQVNKA M+EK+A+LVREK++  IA + DESDR G RVVIELKR A+ADV+L
Sbjct: 241 AIIIDEIPYQVNKATMIEKMADLVREKKLEGIASIADESDRVGVRVVIELKRDATADVVL 300

Query: 325 NQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRA 384
           NQLYR+T LQ+ F  NM+ALNG +PE+ TL   L  F+AFREEVV RRT Y L KAR+R+
Sbjct: 301 NQLYRFTPLQTSFGCNMLALNGGRPEQLTLRDFLSHFIAFREEVVARRTAYELRKARERS 360

Query: 385 HVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSD 444
           H+L GLA+AV+N+DEVV  IR S +P  AR  LM+R W A +I + + LIDD  + +  D
Sbjct: 361 HILCGLAVAVSNVDEVVATIRSSKDPAEARDRLMERRWPAHEIVEYLRLIDDPLHPVNDD 420

Query: 445 GTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQE 504
           GT  LSEVQ RAIL+LRL RLT +G  ++ +EL  L  +I++ L IL+SR R++ II  E
Sbjct: 421 GTYNLSEVQARAILDLRLQRLTAMGVQEVTDELAELAGKIRDYLAILASRERIMAIIATE 480

Query: 505 LLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGK 564
           L  V+     PRRT IV+   D++DED I REDMVVT++  GY+KR PL+ +RAQRRGGK
Sbjct: 481 LREVRAAHAVPRRTEIVDWAGDLDDEDLIEREDMVVTITSGGYIKRTPLAEFRAQRRGGK 540

Query: 565 GRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSL 624
           G + +  +++D VT LF+ +THT +LFF++ G VY  K WRLP+    ++GKA++NIL +
Sbjct: 541 GLASMATKEDDVVTTLFVANTHTQLLFFTTDGMVYSLKCWRLPLAGRTSKGKAIVNILPI 600

Query: 625 NQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEI 684
            QG  + ++MP  E E +W++  V FAT  G+VRRN LSDF ++ ++GK AM+L     +
Sbjct: 601 PQGVSVASLMPVDEPEETWDDFQVFFATSDGDVRRNALSDFAKVMKNGKRAMELPEGVTL 660

Query: 685 LSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHA 744
           +    C +E+DI+L T  G+ +RFP+  +R+F GR+S GVRG+ LA+GD+V+SM+++ H 
Sbjct: 661 VDTRMCHEEDDIMLVTASGRAIRFPVPEVRIFKGRSSTGVRGVRLAEGDKVVSMSVIRHF 720

Query: 745 DADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSV--EGNISEERCQELKLKEQFILT 802
           +A+  ER  ++K   A+    + D  E      D +   EG +S+ R  E+   +  ILT
Sbjct: 721 EAEPWERDAFVKRYRAELGGETEDEAETDRDAEDEAEGGEGVLSDARYAEMLAAQDLILT 780

Query: 803 VSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTL 862
           ++ KG GK +SS+ + +  R G+G+ A    K    GALVA FPV   DQ++L +  G  
Sbjct: 781 ITAKGLGKISSSHSYPVRGRGGQGVTA--FEKSMRGGALVASFPVEPTDQVMLATSTGQS 838

Query: 863 IRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAES 908
           IR PV  I   SRA  GV +F+T  +E VVSV R+ +    DEAE+
Sbjct: 839 IRCPVAGISFRSRAAGGVKVFNTGAEEEVVSVARVADP-GDDEAEA 883


>gi|237808193|ref|YP_002892633.1| DNA gyrase, A subunit [Tolumonas auensis DSM 9187]
 gi|237500454|gb|ACQ93047.1| DNA gyrase, A subunit [Tolumonas auensis DSM 9187]
          Length = 862

 Score =  947 bits (2447), Expect = 0.0,   Method: Composition-based stats.
 Identities = 398/906 (43%), Positives = 577/906 (63%), Gaps = 68/906 (7%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
           K I  ++I DE++NSYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++  +WNK Y K
Sbjct: 6   KEIIPINIEDELRNSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHELSNDWNKPYKK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            AR+ G+V+GKYHPHG++A+YD + RMAQD+S+R  L++GQGNFGSVDGD  AA RYTE 
Sbjct: 66  SARVVGDVIGKYHPHGDSAVYDTIVRMAQDFSMRYTLVDGQGNFGSVDGDSAAAMRYTEI 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ + AH LL DL K+TVD+ PNYDG+ Q P V+  + PN+LVNG  GIAVGMATNIP H
Sbjct: 126 RMDRIAHELLADLEKETVDWVPNYDGTEQIPAVMPTKIPNLLVNGSSGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NL EVVDGC+A+++N ++ +D L+++I GPDFPTG +I GR+GI +AY TGRG I +R  
Sbjct: 186 NLTEVVDGCLALMENSELTIDELIQLIPGPDFPTGGIINGRSGILDAYRTGRGKIYVRAR 245

Query: 254 SHIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVI 312
           + IE      +E I+VTE+PY VNKA ++EKIAELV++K+I  I  LRDESD+ G RVVI
Sbjct: 246 TEIETDEKNGKESIIVTELPYTVNKARLVEKIAELVKDKKIEGITALRDESDKDGMRVVI 305

Query: 313 ELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRR 372
           EL+RG   +V+LN LY +T +Q++F +NMVAL   +P+   L  IL AF+  R EVV RR
Sbjct: 306 ELRRGELTEVMLNNLYTHTQMQNVFGINMVALVNGQPKTLNLKEILAAFIDHRREVVTRR 365

Query: 373 TKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLID 432
           T + L KAR+RAH+L GLAIA+AN+D V+ +I+ S +P  A++ L+ R W    + ++++
Sbjct: 366 TVFELRKARERAHILEGLAIALANIDPVIELIKNSSSPAEAKQGLVARGWALGAVAEMLE 425

Query: 433 LIDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEI 484
                +             D   +L+E Q +AIL+LRL +LTGL  + I +E   L  EI
Sbjct: 426 RAGGDAARPEWLEPEFGIRDDHYFLTEQQAQAILDLRLHKLTGLEHEKILDEYRELLGEI 485

Query: 485 KECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSH 544
            E L IL+S  RL+ +I++EL  VK +    RRT I    +++  ED I  ED+VVT+SH
Sbjct: 486 AELLRILASPERLMEVIREELEFVKSQFGDKRRTEIQAASIEINMEDLITPEDVVVTLSH 545

Query: 545 LGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVW 604
            GYVK  PLS Y AQRRGG+G++   ++DEDFV  L + +TH ++L FS+ G VY  KV+
Sbjct: 546 EGYVKYQPLSDYEAQRRGGRGKAAAKVKDEDFVEQLLVANTHDTILCFSTQGKVYWLKVY 605

Query: 605 RLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSD 664
           +LP  S  ARG+ +IN+L L++ ERIT I+P    +   ++ YV FAT  G V++ +LS 
Sbjct: 606 QLPEASRTARGRPIINLLPLDENERITAILPVKSYD---DDKYVFFATGDGTVKKTELSA 662

Query: 665 FIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGV 724
           + +   SG  A+ L+  D ++ V      ++I+L +  G+ VRF  S +R   GR + GV
Sbjct: 663 YSRPLSSGIRAINLNEGDSLIGVAITDGNSEIMLFSDAGKVVRFNESDVRSM-GRTATGV 721

Query: 725 RGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGN 784
           RG+ L + D+V+S+ +  +  A                                      
Sbjct: 722 RGMKLGETDKVVSLIVPQNGGA-------------------------------------- 743

Query: 785 ISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAV 844
                          ILT +E G+GKRT   ++ + +R+  G+ +  V++ N  G +V  
Sbjct: 744 ---------------ILTATENGYGKRTDLAEYPVKSRATLGVISIQVTERN--GKVVGA 786

Query: 845 FPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVD 904
             V+++D+I+L+++ GTL+R  V+E+ +  R T GV +  TA+DE++VS+ER+ E E  +
Sbjct: 787 IQVDESDEIMLITNAGTLVRTRVSEVGLIGRNTAGVRLIRTAEDEKLVSLERVAEPEGDE 846

Query: 905 EAESTE 910
                +
Sbjct: 847 SDAEGD 852


>gi|56696919|ref|YP_167281.1| DNA gyrase subunit A [Ruegeria pomeroyi DSS-3]
 gi|56678656|gb|AAV95322.1| DNA gyrase, A subunit [Ruegeria pomeroyi DSS-3]
          Length = 891

 Score =  947 bits (2447), Expect = 0.0,   Method: Composition-based stats.
 Identities = 468/880 (53%), Positives = 619/880 (70%), Gaps = 3/880 (0%)

Query: 19  VSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARIS 78
           VSI  EM+ SYL YA++VI+ RAIPDLRDGLKPVHRRIL+ M + G   +K Y K AR  
Sbjct: 5   VSIESEMRTSYLDYAMSVIVSRAIPDLRDGLKPVHRRILYAMHETGNGHDKPYRKSARPV 64

Query: 79  GEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKA 138
           G+VMGKYHPHG++AIYDAL RMAQD+S+ L L++GQGNFGS+DGD PAA RYTE R+ K 
Sbjct: 65  GDVMGKYHPHGDSAIYDALVRMAQDFSMSLPLLDGQGNFGSMDGDNPAAMRYTEVRMDKP 124

Query: 139 AHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEV 198
           A FLL D+ K+TVDF+ NYDG  +EP VL AR+PN+LVNG GGIAVGMATNIP HNLGEV
Sbjct: 125 AAFLLSDIDKETVDFQDNYDGKDREPTVLPARFPNMLVNGAGGIAVGMATNIPPHNLGEV 184

Query: 199 VDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEK 258
           VD  +A+ID+PD+  + L++ + GPDFPTG V+LGR+G + AY  GRGS++IR  + +E+
Sbjct: 185 VDATLALIDDPDLTSEQLIDYVPGPDFPTGGVMLGRSGARKAYLEGRGSVIIRAKTRVEE 244

Query: 259 TSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGA 318
              DR  I+V EIPYQVNKA M+EKIAE VREKRI  +A ++DESDR G RVV+ELKR A
Sbjct: 245 LRKDRYAIIVDEIPYQVNKATMIEKIAEAVREKRIEGVAHVQDESDRNGVRVVVELKRDA 304

Query: 319 SADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLN 378
           + +V+LNQLYR++ +Q+ F  NM+ALNG +PE+ TL   L  F+ FREEVV RRT + L 
Sbjct: 305 TPEVVLNQLYRFSPMQTSFGCNMLALNGGRPEQLTLRRFLTCFIDFREEVVARRTAHDLR 364

Query: 379 KARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSS 438
           KAR+R+HVL GLA+AV+N+DEVV  IR S +   AR +LM R W A+DI   + LIDD  
Sbjct: 365 KARERSHVLCGLAVAVSNVDEVVATIRSSADAADAREKLMTRRWPAADIAAYLRLIDDPL 424

Query: 439 YTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLL 498
             +  DGT  L+EVQ RAIL+LRL RLT LG  ++ +EL  L  +IKE L+IL SR R++
Sbjct: 425 SKMNEDGTYNLTEVQARAILDLRLQRLTQLGVKEVTDELEVLAGKIKEYLEILGSRERIM 484

Query: 499 GIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRA 558
           GII  EL  V+++   PRRT IV+   DMEDED I REDMVVTV+  GY+KR PL+ +RA
Sbjct: 485 GIIADELREVREQFAVPRRTEIVDWSGDMEDEDLIEREDMVVTVTSGGYIKRTPLADFRA 544

Query: 559 QRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKAL 618
           Q+RGGKG SG+  ++ED VT LF+ +THT +LFF++ G VYK K WRLP      +GKA+
Sbjct: 545 QKRGGKGLSGMQTKEEDVVTTLFVANTHTQLLFFTTDGMVYKLKTWRLPQSGRTGKGKAI 604

Query: 619 INILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKL 678
           +NIL +  G  I  IMP    +  W+ L +VFAT  G+VRRN LSDF  + R+GKIAMKL
Sbjct: 605 VNILPIPTGVSIAAIMPVDVPDEEWDALQIVFATSAGDVRRNALSDFTNVKRNGKIAMKL 664

Query: 679 DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISM 738
               E+++   C++E+D++L T  G+ +RFP + +RVF GR+S GVRGI L  GD+V+SM
Sbjct: 665 PEDVELVNARICSEEDDVMLITNSGRAIRFPTTDVRVFKGRDSTGVRGIRLQNGDRVVSM 724

Query: 739 AIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQ 798
           +++ H +A+  ER  ++K           + +   + ++    EG +++ER QE++  + 
Sbjct: 725 SVIRHFEAEPWERAEFIKRFRTILGA-EMEDDAAETDEDAVEGEGVLTDERYQEMQDAQD 783

Query: 799 FILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSD 858
            ILT++  G GK +SS+D+ +  R G+G++A         G L A FPV  +DQI+L + 
Sbjct: 784 LILTITVTGLGKLSSSHDYPVRGRGGQGVKAISAGPR--GGTLAASFPVLMDDQIMLATS 841

Query: 859 KGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
            G  IRVPV  I   SR+  GV +F+T+K E VVSV RI 
Sbjct: 842 GGQSIRVPVEGISFRSRSAGGVRVFNTSKGEEVVSVARIA 881


>gi|238760197|ref|ZP_04621343.1| DNA gyrase subunit A [Yersinia aldovae ATCC 35236]
 gi|238701576|gb|EEP94147.1| DNA gyrase subunit A [Yersinia aldovae ATCC 35236]
          Length = 884

 Score =  946 bits (2446), Expect = 0.0,   Method: Composition-based stats.
 Identities = 411/900 (45%), Positives = 571/900 (63%), Gaps = 68/900 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL KDTVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKDTVDFVPNYDGTEQIPAVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A+I++ +I +D LME I GPDFPT A+I GR GI  AY TGRG I +R  +
Sbjct: 187 LSEVIDGCLALIEDENITIDGLMEFIPGPDFPTAAIINGRRGIDEAYRTGRGKIYVRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVALSQGQPKLLNLKEILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +  P  A+  L+   W   ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRRAATPAEAKAGLIASPWELGNVAAMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGDDAARPEWLEAEFGIRDGKYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTLIA 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + IL +  RL+ +I++EL+++K++ +  RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELIFILENPERLMEVIREELVAIKEQYNDARRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PL+ Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      +V  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYE---EGRHVFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L + LG+ VRFP S +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGTNEVMLFSALGKVVRFPESQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+VIS+ I                                             
Sbjct: 723 GINLNGDDRVISLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV+E G+GKRT+  ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 738 --------PRGDGEILTVTENGYGKRTAVEEYPTKSRATQGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V   DQI++++D GTL+R  V+E+ +  R T+GV +  TA+DE VV ++R+ E E  DE
Sbjct: 788 QVAPTDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDE 847


>gi|83952094|ref|ZP_00960826.1| DNA gyrase subunit A [Roseovarius nubinhibens ISM]
 gi|83837100|gb|EAP76397.1| DNA gyrase subunit A [Roseovarius nubinhibens ISM]
          Length = 906

 Score =  946 bits (2446), Expect = 0.0,   Method: Composition-based stats.
 Identities = 472/893 (52%), Positives = 632/893 (70%), Gaps = 7/893 (0%)

Query: 19  VSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARIS 78
           ++I +EM+ SYL YA++VI+ RAIPDLRDGLKPVHRRIL+ M + G   +K Y K AR  
Sbjct: 1   MTIEEEMKTSYLDYAMSVIVSRAIPDLRDGLKPVHRRILYAMHETGNTHDKPYRKSARPV 60

Query: 79  GEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKA 138
           G+VMGKYHPHG++AIYDAL RMAQD+S+ L L++GQGNFGS+DGD  AA RYTE R+ K 
Sbjct: 61  GDVMGKYHPHGDSAIYDALVRMAQDFSMSLPLLDGQGNFGSMDGDNAAAMRYTEVRMDKP 120

Query: 139 AHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEV 198
           A  LL D+ KDTV+F+ NYDG  +EP VL AR+PN+LVNG GGIAVGMATNIP HNLGEV
Sbjct: 121 ASALLADIEKDTVNFQDNYDGKDREPTVLPARFPNMLVNGAGGIAVGMATNIPPHNLGEV 180

Query: 199 VDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEK 258
           VD  +A+IDNPD+  + L++ + GPDFPTGA++LGR+G + AY  GRGS++IR  + +E+
Sbjct: 181 VDATLALIDNPDLSSEELIDYVPGPDFPTGAIMLGRSGARKAYLEGRGSVIIRAKTRVEE 240

Query: 259 TSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGA 318
              DR  IV+ EIPYQVNKA+M+EKIAE  REKRI  IA ++DESDR G RVV+ELKR A
Sbjct: 241 IRRDRWAIVIDEIPYQVNKASMIEKIAEAAREKRIEGIAHVQDESDRNGVRVVVELKRDA 300

Query: 319 SADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLN 378
           +A+V+LNQL+R+T +Q+ F  NM+ALNG +PE+ TL G L AF+AFREEVV RRT Y L 
Sbjct: 301 TAEVVLNQLFRFTPMQTSFGCNMLALNGGRPEQLTLRGFLTAFIAFREEVVARRTAYDLR 360

Query: 379 KARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSS 438
           KAR+R+H+L GLA+AV+N+DEVV  IR S +   AR++LM+R W A DI + I LIDD +
Sbjct: 361 KARERSHILCGLAVAVSNVDEVVATIRSSADAAEARQKLMERRWPAGDILEYIALIDDPT 420

Query: 439 YTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLL 498
           +    DGT  LSE Q RAILELRL RLT LG  ++ +EL  L  +IKE L IL+SR R++
Sbjct: 421 HRANDDGTYNLSETQARAILELRLQRLTQLGVKEVTDELQELAAKIKEYLAILASRERIM 480

Query: 499 GIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRA 558
            II  EL  V+D+   PRRT I +   DM+DED I RE+MVVTV+  GY+KR  L+ +RA
Sbjct: 481 EIIADELREVRDQFAVPRRTEITDWSGDMDDEDLIEREEMVVTVTSGGYIKRTALADFRA 540

Query: 559 QRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKAL 618
           Q+RGGKG SG+  ++ED VT LF+ +THT +LFF++ G  YK K WRLP G   A+GKA+
Sbjct: 541 QKRGGKGLSGMQTKEEDVVTTLFVANTHTQLLFFTTDGMAYKLKTWRLPQGGRTAKGKAI 600

Query: 619 INILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKL 678
           +NIL +  G  +  IMP    E  WN+L +VFAT  G VRRN+LSDF  +  +GKIAMK 
Sbjct: 601 VNILPIPTGVSVAAIMPVDRPEEEWNDLQIVFATDAGTVRRNRLSDFTNVKSNGKIAMKF 660

Query: 679 DSRD---EILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQV 735
           +  +    +++   C++E+D++L T  G+ +RFP + +RVF  RNSVGVRGI L+  D+V
Sbjct: 661 EDENAGMSLINARICSEEDDVMLVTNSGRAIRFPTTDVRVFNSRNSVGVRGIRLSGEDKV 720

Query: 736 ISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKL 795
           +SM+++ H +A  +ER+ Y+K       L   + E  +  +++++V G +S ER  E+  
Sbjct: 721 VSMSVIRHFEASSEERVAYLKQRRLMAGLT--EDEAASDDEDETAVAGQLSPERYAEMSA 778

Query: 796 KEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIIL 855
            E  ILT++ KG GK +SS+D+ +  R G G+ A   +K    G ++A FPV   DQ++L
Sbjct: 779 VENLILTITAKGAGKLSSSHDYPVRGRGGLGVTAW--TKSMSNGPIIACFPVEMPDQVML 836

Query: 856 VSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAES 908
            + KG  IR+PV+ I   SR+  GV +F+T K+E VVSV  I +    DE E+
Sbjct: 837 ATSKGQSIRIPVDGISFRSRSAGGVRVFNTGKNEEVVSVAWIADRGDEDEDEA 889



 Score = 50.2 bits (118), Expect = 0.002,   Method: Composition-based stats.
 Identities = 43/246 (17%), Positives = 83/246 (33%), Gaps = 25/246 (10%)

Query: 534 VREDMVVTVSHLGYVKRVPLSVYR------AQRRGGKGRSGVVMRDEDFVTDLFIVSTHT 587
             ED V+ V++ G   R P +  R      +    G   SG        V   F  S+  
Sbjct: 676 SEEDDVMLVTNSGRAIRFPTTDVRVFNSRNSVGVRGIRLSGEDKVVSMSVIRHFEASSEE 735

Query: 588 SVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLY 647
            V +      +           S      A+   LS  +   ++ +              
Sbjct: 736 RVAYLKQRRLMAGLTEDEA--ASDDEDETAVAGQLSPERYAEMSAVENL----------- 782

Query: 648 VVFATKHGNVRRNKLSDFIQINRSGKIAMKLD----SRDEILSVETCTQENDILLTTKLG 703
           ++  T  G  + +   D+  +   G + +       S   I++       + ++L T  G
Sbjct: 783 ILTITAKGAGKLSSSHDYP-VRGRGGLGVTAWTKSMSNGPIIACFPVEMPDQVMLATSKG 841

Query: 704 QCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRR 763
           Q +R P+  I  F  R++ GVR  +  K ++V+S+A +     + ++         AQ +
Sbjct: 842 QSIRIPVDGI-SFRSRSAGGVRVFNTGKNEEVVSVAWIADRGDEDEDEAQTENQTEAQDQ 900

Query: 764 LISGDT 769
                 
Sbjct: 901 SPPDQD 906


>gi|114798624|ref|YP_761439.1| DNA gyrase subunit A [Hyphomonas neptunium ATCC 15444]
 gi|114738798|gb|ABI76923.1| DNA gyrase, A subunit [Hyphomonas neptunium ATCC 15444]
          Length = 926

 Score =  946 bits (2445), Expect = 0.0,   Method: Composition-based stats.
 Identities = 522/926 (56%), Positives = 681/926 (73%), Gaps = 18/926 (1%)

Query: 1   MTEHIISSDEEE-----------EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGL 49
           M++     DE E           + GI  +SI  E+++SYL YA++VI+ RA+PD+RDGL
Sbjct: 1   MSDPTTPPDEPETPENGAGKPPPQDGIEGISIESELKSSYLDYAMSVIVSRALPDVRDGL 60

Query: 50  KPVHRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLL 109
           KPVHRRILF M + G   +K Y K ARI G+V+GKYHPHG++A+YDAL RMAQ +S+ + 
Sbjct: 61  KPVHRRILFAMNEGGNTPDKPYSKSARIVGDVIGKYHPHGDSAVYDALVRMAQPFSMGVP 120

Query: 110 LIEGQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCA 169
           L++GQGNFGS+D DPPAA RYTE R+ K    LL DL KDTVDF+ NYDG  +EPVVL A
Sbjct: 121 LVDGQGNFGSIDNDPPAAMRYTESRMTKVTTHLLADLDKDTVDFQDNYDGKEKEPVVLPA 180

Query: 170 RYPNVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGA 229
           ++PN+LVNGGGGIAVGMATNIP HNLGE++D  +A+I++P I  +AL EI+ GPDFPTGA
Sbjct: 181 QFPNLLVNGGGGIAVGMATNIPPHNLGEIIDATLAMIEDPAITDEALCEIVPGPDFPTGA 240

Query: 230 VILGRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVR 289
           +I+G++G + A  TGRGS+++R  + IE+    RE I+V+EIPYQVNKAAM+ KIAELVR
Sbjct: 241 LIMGQSGSRKALMTGRGSVIMRSKTEIEEAKNGREAIIVSEIPYQVNKAAMITKIAELVR 300

Query: 290 EKRIVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKP 349
           EK+I  I+DLRDESDR G RVVIELKR ASADV+LNQLYR++ LQS F+VNM+ALNG +P
Sbjct: 301 EKKIEGISDLRDESDRNGIRVVIELKRDASADVVLNQLYRFSQLQSSFAVNMLALNGGRP 360

Query: 350 ERFTLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPN 409
           E   L  +L+ F+ FREEV+VRRTK+ L KARDRAHVLVGLA+AVAN+DEV+R+IR SP+
Sbjct: 361 ELMNLRKVLEYFITFREEVIVRRTKHDLGKARDRAHVLVGLALAVANIDEVIRLIRTSPD 420

Query: 410 PETARRELMQRSWNASDIKDLIDLIDDSSYTIG-SDGTMYLSEVQTRAILELRLARLTGL 468
           P TAR+ L+ ++W   D+  LIDLI D     G  +GT+YLS+ Q R+IL L L RLTGL
Sbjct: 421 PATARQRLLDKAWPQQDMGPLIDLIADRRTRRGSEEGTIYLSDEQARSILNLPLHRLTGL 480

Query: 469 GRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDME 528
           GRD+I NE   L  +I E L+IL SR R+LGIIK EL  VK++   PRR++ V+G +DME
Sbjct: 481 GRDEIGNEAKGLADKIAEYLEILRSRPRILGIIKAELAEVKEKFAVPRRSQFVDGGVDME 540

Query: 529 DEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTS 588
           DED I  EDMVVTV+H GYVKR PLS YR Q RGGKGRSG+ M+DEDF+  +F  +THT 
Sbjct: 541 DEDLIEVEDMVVTVTHGGYVKRTPLSTYRTQNRGGKGRSGMSMKDEDFIVRVFSATTHTE 600

Query: 589 VLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYV 648
           +LFFSS G VYKEKVWRLPIG P +RGKAL+NI  L   ERI ++MP P+ E +  +L V
Sbjct: 601 ILFFSSAGMVYKEKVWRLPIGGPTSRGKALVNIFPLAADERIESVMPLPDSEEAAEHLDV 660

Query: 649 VFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRF 708
           +FAT+ GNVRRN+L+DF ++NR+GKIAMKLD  D I+SV+ C++++D+LLTT LGQ +RF
Sbjct: 661 MFATRSGNVRRNRLADFTRVNRAGKIAMKLDEGDGIVSVQLCSEKDDVLLTTALGQAIRF 720

Query: 709 PISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGD 768
            ++ +RVFAGR+S GVRGI L   D VISM I+ H     +E   Y+KH +A RR ++G+
Sbjct: 721 AVTDVRVFAGRDSTGVRGIRLGAEDTVISMGILRHMGVTSEEARAYLKHAAAMRRAVTGE 780

Query: 769 TEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIR 828
            EEI+  +++   E  +S ER  EL   E+FI TV++ G GKR+S+YD+R++ R GKG+ 
Sbjct: 781 EEEISDDEDEVVAEAALSAERIAELGAAEEFIFTVADDGMGKRSSAYDYRVTGRGGKGLV 840

Query: 829 ATDVSKINEIG----ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFS 884
           A ++   ++ G     +   FPV D D+++LV+D G LIR PV++IRIA R+T GV +  
Sbjct: 841 AQNIWGRDKKGGPVKKVAQSFPVGDGDEVMLVTDGGQLIRTPVDQIRIAGRSTGGVWVLR 900

Query: 885 TAKDERVVSVERIRESEIV--DEAES 908
           T   ERVVS  R+ +      D+AE 
Sbjct: 901 TGDGERVVSAARLVDDGEGGMDKAEG 926


>gi|259415725|ref|ZP_05739645.1| DNA gyrase, A subunit [Silicibacter sp. TrichCH4B]
 gi|259347164|gb|EEW58941.1| DNA gyrase, A subunit [Silicibacter sp. TrichCH4B]
          Length = 928

 Score =  946 bits (2445), Expect = 0.0,   Method: Composition-based stats.
 Identities = 486/918 (52%), Positives = 638/918 (69%), Gaps = 17/918 (1%)

Query: 2   TEHIISSDEEEEK-------GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHR 54
           ++   + +  +E           +VSI  EM+NSYL YA++VI+ RAIPDLRDGLKPVHR
Sbjct: 18  SDTPETPENPDENLPARPSYDGPTVSIESEMRNSYLDYAMSVIVSRAIPDLRDGLKPVHR 77

Query: 55  RILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQ 114
           RIL+ M + G   +K Y K AR  G+VMGKYHPHG++AIYDAL RMAQD+S+ L L++GQ
Sbjct: 78  RILYAMHETGNSHDKAYRKSARPVGDVMGKYHPHGDSAIYDALVRMAQDFSMSLPLLDGQ 137

Query: 115 GNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNV 174
           GNFGS+DGD PAA RYTE R+ K A F+L D+ K+TVDF+ NYDG  +EP VL AR+PN+
Sbjct: 138 GNFGSMDGDNPAAMRYTEVRMDKPAAFMLADIEKETVDFQDNYDGKDKEPTVLPARFPNM 197

Query: 175 LVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGR 234
           LVNG GGIAVGMATNIP HNLGEVVD  +A+I++PD+  + L++ + GPDFPTG V+LGR
Sbjct: 198 LVNGAGGIAVGMATNIPPHNLGEVVDATLALIEDPDLTSEQLIDYVPGPDFPTGGVMLGR 257

Query: 235 TGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIV 294
           +G + AY  GRGS++IR  + +E+   DR  IVV EIPYQVNKA+M+EKIAE VREKRI 
Sbjct: 258 SGARKAYLEGRGSVIIRAKTRVEEIRKDRYAIVVDEIPYQVNKASMIEKIAEQVREKRIE 317

Query: 295 DIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTL 354
            +A ++DESDR G RVV+ELKR A+A+V+LNQLYR+T +Q+ F  NM+ALNG +PE+ TL
Sbjct: 318 GVAHVQDESDRNGVRVVVELKRDATAEVVLNQLYRFTPMQTSFGCNMLALNGGRPEQLTL 377

Query: 355 IGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETAR 414
              L +F+ FRE+VV RRT Y L KAR+R+H+L GLA+AV+N+DEVV  IR S +   AR
Sbjct: 378 RKFLTSFIDFREDVVARRTAYNLRKARERSHILCGLAVAVSNVDEVVATIRSSADAAEAR 437

Query: 415 RELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIR 474
           ++LM R W ASDI   I LIDD ++T+  DGT  LSEVQ RAILELRL RLT LG  ++ 
Sbjct: 438 QKLMTRRWPASDIAGYIRLIDDPTHTMNDDGTYNLSEVQARAILELRLQRLTQLGVKEVT 497

Query: 475 NELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIV 534
           +EL  L  +IKE L+ILSSR R++GII  EL  V++    PRRT IV+   DM+DED I 
Sbjct: 498 DELEELAAKIKEYLEILSSRERIMGIIADELTEVRNSFAVPRRTEIVDWSGDMDDEDLIE 557

Query: 535 REDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSS 594
           REDMVVTV+  GY+KR PL+ +RAQ+RGGKG SG+  ++ED VT LF+ +THT +LFF++
Sbjct: 558 REDMVVTVTSGGYIKRTPLADFRAQKRGGKGLSGMQTKEEDVVTTLFVANTHTQLLFFTT 617

Query: 595 LGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKH 654
            G VYK K WRLP G   A+GKA++NIL +  G  I  IMP    E  WN+L ++FAT  
Sbjct: 618 DGMVYKLKTWRLPQGGRTAKGKAIVNILPIPTGVSIAAIMPVDRAEEEWNDLQIMFATSA 677

Query: 655 GNVRRNKLSDFIQINRSGKIAMKLDSRDE---ILSVETCTQENDILLTTKLGQCVRFPIS 711
           G VRRN+LSDF  + R+GKIAMK +  +E   +++   C++++DI+L T  G+ +RFP +
Sbjct: 678 GTVRRNRLSDFTNVMRNGKIAMKFEDDNEGTKLINARICSEDDDIMLVTNTGRAIRFPTT 737

Query: 712 AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEE 771
            +RVF  RNSVGVRGI L  GD+V+SM+++ H+    ++R  Y+K   A   L   D   
Sbjct: 738 EVRVFNSRNSVGVRGIKLGDGDEVVSMSVIRHSKYTPEQRTAYLKMRRAMAGLTDEDAS- 796

Query: 772 ITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATD 831
                 D+  + N S E   E+   E  ILT++  G GK +SS+D+ +  R G G+ A D
Sbjct: 797 ----DEDAVEDPNFSTELFAEMSAAENLILTITAGGSGKLSSSHDYPVRGRGGMGVTAMD 852

Query: 832 VSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERV 891
             K    GALVA FPV  +DQI+L + KG  IRVPV+ I   SR+  GV IF+T K E V
Sbjct: 853 --KAMRGGALVASFPVELDDQIMLATSKGQSIRVPVDGISFRSRSAGGVRIFNTGKGEEV 910

Query: 892 VSVERIRESEIVDEAEST 909
           VSV  I ++   +E    
Sbjct: 911 VSVAWIADNGDDEETVEE 928


>gi|238794992|ref|ZP_04638588.1| DNA gyrase subunit A [Yersinia intermedia ATCC 29909]
 gi|238725695|gb|EEQ17253.1| DNA gyrase subunit A [Yersinia intermedia ATCC 29909]
          Length = 890

 Score =  946 bits (2445), Expect = 0.0,   Method: Composition-based stats.
 Identities = 409/905 (45%), Positives = 574/905 (63%), Gaps = 68/905 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL KDTVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKDTVDFVPNYDGTEQIPAVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A+I++ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG + IR  +
Sbjct: 187 LSEVIDGCLALIEDENITIEGLMEFIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVALSQGQPKLLNLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +  P  A+  L+  SW   ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRRAATPAEAKAGLIANSWELGNVASMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  +L+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGDDAARPEWLEAEYGIRDGRYFLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTLIG 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + IL +  RL+ +I++EL+++K++ +  RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELIFILENPDRLMEVIREELVAIKEQYNDARRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PL+ Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      ++  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYE---EGRHIFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L + LG+ VRFP S +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGSNEVMLFSALGKVVRFPESQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+VIS+ I                                             
Sbjct: 723 GINLNGDDRVISLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV+E G+GKRT+  ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 738 --------PRGDGEILTVTENGYGKRTAVEEYPTKSRATQGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V   DQI++++D GTL+R  V+E+ +  R T+GV +  TA+DE VV ++R+ E E  DE
Sbjct: 788 QVAPTDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDE 847

Query: 906 AESTE 910
               E
Sbjct: 848 ILDGE 852



 Score = 70.6 bits (171), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 62/417 (14%), Positives = 133/417 (31%), Gaps = 38/417 (9%)

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
            L K     H    L      L  +  +I    NP+     + +      +  +     +
Sbjct: 462 RLQKLTGLEHE-KLLDEYKELLTLIGELIFILENPDRLMEVIREELVAIKEQYNDARRTE 520

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTG---LGRDDIRNELNSLGIEIKECLDI-- 490
            ++ T   +    +++      L  +               R         IKE   I  
Sbjct: 521 ITANTSDINIEDLINQEDVVVTLSHQGYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDR 580

Query: 491 ---LSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTV----- 542
               ++   +L    +  L        P  +R   G   +        E +   +     
Sbjct: 581 LLVANTHDTILCFSSRGRLYWMKVYQLPEASRGARGRPIVNLLPLEPNERITAILPVREY 640

Query: 543 ---------SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
                    +  G VK+  L+ +   R  G     +   DE    DL        V+ FS
Sbjct: 641 EEGRHIFMATASGTVKKTALTEFSRPRSAGIIAVNLNEGDELIGVDL--TDGSNEVMLFS 698

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           +LG V +    ++      A G   +  ++LN  +R+ +++          +  ++  T+
Sbjct: 699 ALGKVVRFPESQVRSMGRTATG---VRGINLNGDDRVISLI------IPRGDGEILTVTE 749

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLD---SRDEILSVETCTQENDILLTTKLGQCVRFPI 710
           +G  +R  + ++   +R+ +  + +       +++        + I++ T  G  VR  +
Sbjct: 750 NGYGKRTAVEEYPTKSRATQGVISIKVSERNGKVVGAVQVAPTDQIMMITDAGTLVRTRV 809

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISG 767
           S +    GRN+ GV  I  A+ + V+ +  V   + D +                + 
Sbjct: 810 SEV-SVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDEILDGESLDGEEGGEDNAA 865


>gi|16125827|ref|NP_420391.1| DNA gyrase subunit A [Caulobacter crescentus CB15]
 gi|221234588|ref|YP_002517024.1| DNA gyrase subunit A [Caulobacter crescentus NA1000]
 gi|13422971|gb|AAK23559.1| DNA gyrase subunit A [Caulobacter crescentus CB15]
 gi|220963760|gb|ACL95116.1| DNA gyrase subunit A [Caulobacter crescentus NA1000]
          Length = 919

 Score =  945 bits (2443), Expect = 0.0,   Method: Composition-based stats.
 Identities = 500/914 (54%), Positives = 657/914 (71%), Gaps = 7/914 (0%)

Query: 1   MTEH-IISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFG 59
           M++       +     I  ++I DE++ SYL YA++VI+ RA+PD RDGLKPVHRR+LF 
Sbjct: 1   MSDDHNTIPADGSRGDIAPINIEDELRRSYLDYAMSVIVSRALPDARDGLKPVHRRVLFS 60

Query: 60  MMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGS 119
           M + G    + YVK AR+ G+VMGKYHPHG+A+IY  L RM Q +S+ L+LI+GQGNFGS
Sbjct: 61  MHEQGQTPERPYVKSARVVGDVMGKYHPHGDASIYFTLVRMTQSFSMGLVLIDGQGNFGS 120

Query: 120 VDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGG 179
           VDGD PAA RYTECR+   A  LL DL KDTVDF  NYDG  QEP VL +R PN+LVNG 
Sbjct: 121 VDGDMPAAMRYTECRMAPPAMALLADLDKDTVDFADNYDGKEQEPTVLPSRIPNLLVNGA 180

Query: 180 GGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKN 239
           GGIAVGMATNIP HNLGEV+D C+ +ID PD+  D L++++ GPDFPTG  I+GR G + 
Sbjct: 181 GGIAVGMATNIPPHNLGEVIDACLLLIDQPDVTTDQLLDLVPGPDFPTGGEIIGRAGPRQ 240

Query: 240 AYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           A  TGRGS+++RGV+ +E+    RE I+VTEIPYQVNKA ++E IAELVR+K+I  +AD+
Sbjct: 241 ALLTGRGSVIMRGVASVEELRAGREAIIVTEIPYQVNKANLVEHIAELVRDKKIEGVADI 300

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDES+R G R+V+ELKR AS +VILNQLYR+T+LQS F VNM+ALN  +PE+  L  +++
Sbjct: 301 RDESNRDGMRIVVELKRDASGEVILNQLYRFTALQSSFGVNMLALNRGRPEQMGLHQLIQ 360

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
            FV FREEVVVRRTK+ L KARDR HVLVGL IAVAN+DE + IIR S +P  AR  L+ 
Sbjct: 361 LFVDFREEVVVRRTKFELGKARDRGHVLVGLTIAVANIDEFIHIIRSSKDPTEARERLVA 420

Query: 420 RSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           +SW A D+  L++LI D        G + L++ Q RAIL L L+RLTGLGRD+I NE  +
Sbjct: 421 KSWPAGDMLPLVELIADPRTVQEDGGLIRLTDEQARAILALTLSRLTGLGRDEIGNEAAA 480

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           L   I+  L++LS R+ ++ ++++EL+ V+++   PRR +IV+G  DMEDED IVREDMV
Sbjct: 481 LADAIRGYLELLSDRANIMAVVREELVEVREKFAIPRRCQIVDGDADMEDEDLIVREDMV 540

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           +TV+  GYVKR PL+ YR Q RGGKG+SG+  ++ED VT +F  STH  +LFF+S G VY
Sbjct: 541 ITVTMGGYVKRTPLANYRTQHRGGKGKSGMATKNEDAVTRVFSASTHAPLLFFTSGGKVY 600

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
           K KVWRLP+G   +RGKA +N+L +  GE IT+I+  PEDE++W  L V+FAT+ G+VRR
Sbjct: 601 KMKVWRLPLGVANSRGKAFVNLLPIEPGETITSILALPEDEATWGGLDVMFATRSGSVRR 660

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           NKLSDF+ + R+GKIAMKLD  D I+ V  C  + D+LLTT  G+C+RF +  +RVFA R
Sbjct: 661 NKLSDFVDVRRNGKIAMKLDEGDGIVGVAVCNADQDVLLTTAAGRCIRFSVDEVRVFASR 720

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEIT----SL 775
           +S GVRG+ L  GDQVISMA++   DA   ER  Y+KH  A  R   G+  E T      
Sbjct: 721 DSTGVRGVKLLDGDQVISMAVLRSVDATPAERAAYLKHQRAMLRAADGEEGEDTATAADD 780

Query: 776 KNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKI 835
            ++   E +++ ER  EL   E+ +LTVS +GFGKRTS+YDFR + R G+G+ A D+SK 
Sbjct: 781 GDEEVGEASLTPERIAELGAAEEILLTVSSEGFGKRTSAYDFRRTGRGGQGLAAQDLSKR 840

Query: 836 NEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVE 895
              G LV  FP++++DQI+LV+D+G LIRVPV++IR+A+R T+GV IF TA+DE VVSVE
Sbjct: 841 --GGRLVGSFPIDESDQILLVTDQGQLIRVPVSQIRVAARNTQGVTIFRTAQDEHVVSVE 898

Query: 896 RIRESEIVDEAEST 909
           R+ +S   D     
Sbjct: 899 RLADSGGDDNQGED 912


>gi|238788613|ref|ZP_04632405.1| DNA gyrase subunit A [Yersinia frederiksenii ATCC 33641]
 gi|238723208|gb|EEQ14856.1| DNA gyrase subunit A [Yersinia frederiksenii ATCC 33641]
          Length = 884

 Score =  945 bits (2442), Expect = 0.0,   Method: Composition-based stats.
 Identities = 409/905 (45%), Positives = 572/905 (63%), Gaps = 68/905 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL KDTVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKDTVDFVPNYDGTEQIPAVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A I++ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG + IR  +
Sbjct: 187 LSEVIDGCLAYIEDENISIEGLMEYIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVALSQGQPKLLNLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +  P  A+  L+   W   ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRRAATPAEAKAGLIANPWELGNVASMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGDDAARPEWLEAEFGIRDGKYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTIIG 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + IL +  RL+ +I++EL+++K++ +  RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELIFILENPERLMEVIREELVAIKEQYNDARRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PL+ Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      ++  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYE---EGRHIFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L + LG+ VRFP + +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGSNEVMLFSALGKVVRFPETQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+VIS+ I                                             
Sbjct: 723 GINLNGDDRVISLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV+E G+GKRT+  ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 738 --------PRGDGEILTVTENGYGKRTAVEEYPTKSRATQGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V   DQI++++D GTL+R  V+E+ I  R T+GV +  TA+DE VV ++R+ E E  DE
Sbjct: 788 QVTPTDQIMMITDAGTLVRTRVSEVSIVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDE 847

Query: 906 AESTE 910
               E
Sbjct: 848 ILDGE 852



 Score = 73.7 bits (179), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 65/434 (14%), Positives = 136/434 (31%), Gaps = 38/434 (8%)

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
            L K     H    L      L  +  +I    NPE     + +      +  +     +
Sbjct: 462 RLQKLTGLEHE-KLLDEYKELLTIIGELIFILENPERLMEVIREELVAIKEQYNDARRTE 520

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTG---LGRDDIRNELNSLGIEIKECLDI-- 490
            ++ T   +    +++      L  +               R         IKE   I  
Sbjct: 521 ITANTSDINIEDLINQEDVVVTLSHQGYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDR 580

Query: 491 ---LSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTV----- 542
               ++   +L    +  L        P  +R   G   +        E +   +     
Sbjct: 581 LLVANTHDTILCFSSRGRLYWMKVYQLPEASRGARGRPIVNLLPLEPNERITAILPVREY 640

Query: 543 ---------SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
                    +  G VK+  L+ +   R  G     +   DE    DL        V+ FS
Sbjct: 641 EEGRHIFMATASGTVKKTALTEFSRPRSAGIIAVNLNEGDELIGVDL--TDGSNEVMLFS 698

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           +LG V +    ++      A G   +  ++LN  +R+ +++          +  ++  T+
Sbjct: 699 ALGKVVRFPETQVRSMGRTATG---VRGINLNGDDRVISLI------IPRGDGEILTVTE 749

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLD---SRDEILSVETCTQENDILLTTKLGQCVRFPI 710
           +G  +R  + ++   +R+ +  + +       +++     T  + I++ T  G  VR  +
Sbjct: 750 NGYGKRTAVEEYPTKSRATQGVISIKVSERNGKVVGAVQVTPTDQIMMITDAGTLVRTRV 809

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTE 770
           S +    GRN+ GV  I  A+ + V+ +  V   + D +                +    
Sbjct: 810 SEV-SIVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDEILDGESLDGEEGGEENAALNT 868

Query: 771 EITSLKNDSSVEGN 784
                      E +
Sbjct: 869 PEEDEPAADEAEDD 882


>gi|330433402|gb|AEC18461.1| DNA gyrase subunit A [Gallibacterium anatis UMN179]
          Length = 877

 Score =  944 bits (2441), Expect = 0.0,   Method: Composition-based stats.
 Identities = 417/905 (46%), Positives = 578/905 (63%), Gaps = 41/905 (4%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
           K I  V+I +EM++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M   G ++NK Y K
Sbjct: 6   KDIIPVNIEEEMKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMAVGGNDYNKPYRK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            ARI G+V+GKYHPHG++A+YD L RMAQ +SLR  L++GQGNFGS+DGD PAA RYTE 
Sbjct: 66  SARIVGDVIGKYHPHGDSAVYDTLVRMAQPFSLRYPLVDGQGNFGSIDGDSPAAMRYTEA 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ + AH LL DL K+TVD++PNYDGS   P VL  + P +LVNG  GIAVGMATNIP H
Sbjct: 126 RMTQIAHELLADLDKETVDYQPNYDGSEMIPEVLPTKVPALLVNGSSGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NLGEVVDGC+A IDN  I +D LM  I GPDFPT A+I G+ GI+ AY TGRG I IR  
Sbjct: 186 NLGEVVDGCLAYIDNEQITIDELMSYIPGPDFPTAAIINGKRGIEEAYKTGRGKIYIRAK 245

Query: 254 SHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
           + IE     RE I+V EIPYQVNKA ++EKIAELV+EK+I  I+ LRDESD+ G R+VIE
Sbjct: 246 ADIETDDKGRESIIVHEIPYQVNKARLIEKIAELVKEKKIEGISGLRDESDKDGMRIVIE 305

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +++LN LY  T LQ  F +N+VAL+  +P+   L  +++AFV  R EVV RRT
Sbjct: 306 VKRDAVGEIVLNNLYALTQLQVTFGINIVALDHGQPKLLNLKELIEAFVLHRREVVTRRT 365

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            Y L KAR+RAH+L GLAIA+AN+D ++ +IR +P P  A+  L+ + W   +++ ++  
Sbjct: 366 VYELRKARERAHILEGLAIALANIDPIIELIRNAPTPAAAKEGLLSQPWQLGNVEAMLAA 425

Query: 434 IDDSSYTIGS--------DGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
               +              G  +LSE Q +AIL+LRL +LTGL  + I +E  SL   I 
Sbjct: 426 AGVDAARPEDLDENLGIRGGVYHLSEAQAQAILDLRLQKLTGLEHEKILDEYKSLLDVIA 485

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E L IL S +RL+ +I++EL  +K + + PRRT I     D+  ED I  ED+VVT+SH 
Sbjct: 486 ELLHILHSPARLMEVIREELEKIKAQYNDPRRTEITASSGDINLEDLINPEDVVVTLSHE 545

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PLS Y AQRRGGKG+S   M+DEDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 546 GYVKYQPLSDYEAQRRGGKGKSATKMKDEDFIEKLLVANTHDTILCFSSRGRLYWLKVYQ 605

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L + ERIT I+P  E      + ++V AT  G V++  L++F
Sbjct: 606 LPQASRGARGRPIVNLLPLEENERITAILPVKEYA---EDKFIVMATAGGLVKKTALTEF 662

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L   DE++ V+     N+I+L +  G+ VRF  +A+R   GR + GVR
Sbjct: 663 SRPRANGIIAVNLRDDDELIGVDITEGNNEIMLFSAQGRVVRFDENAVRAM-GRTAAGVR 721

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI LA                           ++        D EE  + + D S++ +I
Sbjct: 722 GIKLA---------------------------LTNDISDEENDNEESGNDETDQSLDLSI 754

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
            +     +      ILT ++ G+GKRT   ++   +R+ KG+ +  VS+ N  G +VA  
Sbjct: 755 DKVVSLVIPKTNGAILTATQNGYGKRTDLAEYPTKSRNTKGVISIKVSERN--GKVVAAA 812

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V +NDQI+L++D GTL+R  V EI +  R T+GV +  T+  E+VVS+ER+ + +  ++
Sbjct: 813 QVEENDQIMLITDAGTLVRTRVAEISLVGRNTQGVRLIRTSDTEQVVSIERVCDDDEEND 872

Query: 906 AESTE 910
             + E
Sbjct: 873 TVAEE 877


>gi|260913652|ref|ZP_05920128.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Pasteurella dagmatis
           ATCC 43325]
 gi|260632191|gb|EEX50366.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Pasteurella dagmatis
           ATCC 43325]
          Length = 901

 Score =  944 bits (2440), Expect = 0.0,   Method: Composition-based stats.
 Identities = 415/918 (45%), Positives = 586/918 (63%), Gaps = 42/918 (4%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+ +    +   + I+ +SI +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M
Sbjct: 7   MTDLV---QDNTHQDISPISIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAM 63

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            + G  +NK Y K ARI G+V+GKYHPHG++A+YD L RMAQ +SLR +L++GQGNFGS+
Sbjct: 64  HEGGNAYNKPYRKSARIVGDVIGKYHPHGDSAVYDTLVRMAQPFSLRYMLVDGQGNFGSI 123

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGD  AA RYTE R+ K AH LL DL K+TV+F PNYDGS Q P VL  + P +LVNG  
Sbjct: 124 DGDAAAAMRYTEARMTKIAHELLADLDKETVNFVPNYDGSEQIPEVLPTKVPALLVNGSS 183

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEV+DGC+A I+N +I +D LM  I GPDFPT A+I GR GI+ A
Sbjct: 184 GIAVGMATNIPPHNLGEVLDGCLAYIENNEITIDELMTYIPGPDFPTAALINGRKGIEEA 243

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRG I +R  + +E      E IVV EIPYQVNKA ++EKIA+LV+EK+I  I+ + 
Sbjct: 244 YKTGRGKIYVRAKAEVETDEKGGETIVVHEIPYQVNKAKLIEKIADLVKEKKIEGISAIT 303

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           D SD+ G R+ I++KR A  +V+LN LY  T LQ  F +N+VAL+  +P+   L  +++A
Sbjct: 304 DLSDKDGMRIEIKIKRDAVGEVVLNNLYALTQLQVTFGINIVALDKGQPKLLNLKQLIEA 363

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV  R EVV RRT Y L KAR+RAH+L GLAIA+AN+D ++ +IR +PNPETA+REL+ +
Sbjct: 364 FVLHRREVVTRRTVYELRKARERAHILEGLAIALANVDPIIELIRQAPNPETAKRELIAQ 423

Query: 421 SWNASDIKDLIDLIDDSSYTIGS--------DGTMYLSEVQTRAILELRLARLTGLGRDD 472
            W    + D++      +             DG  YL+EVQ +AIL+LRL +LT LG D+
Sbjct: 424 PWKLGHVADMLAAAGVDAARPEELEEQYGIRDGMYYLTEVQAQAILDLRLQKLTNLGHDE 483

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDC 532
           I +E   L   I E L IL S  RL+ +I++EL  ++++ + PRRT I     D+  ED 
Sbjct: 484 ILDEYQKLLEVIGELLYILRSPERLMEVIREELEQIREQFNDPRRTEITASSGDINLEDL 543

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
           I +ED+VVT+SH GYVK  PL+ Y AQRRGGKG+S    ++EDF+  L + +TH ++L F
Sbjct: 544 IAQEDVVVTLSHEGYVKYQPLTDYEAQRRGGKGKSAAKTKEEDFIERLLVANTHDTILCF 603

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           SS G +Y  KV++LP  S  +RG+ ++NIL L++ ERIT I+P    E    + +VV AT
Sbjct: 604 SSRGRLYWLKVYQLPQASRGSRGRPIVNILPLDENERITAILPVTAYE---EDKFVVMAT 660

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISA 712
             G V++  L++F +   SG IA+ L   DE++ V+     N+I+L +  G+ VRF  SA
Sbjct: 661 AGGIVKKISLTEFSRPRSSGIIALNLRDEDELIGVDITDGSNEIMLFSAQGRVVRFSESA 720

Query: 713 IRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEI 772
           +R   GR + GVRGI LA                                   + + E+I
Sbjct: 721 VRAM-GRAATGVRGIKLA-------------------------LTNDLSDDESAVEIEDI 754

Query: 773 TSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDV 832
           +   +D  ++ N+ +     +   +  ILT ++ G+GKRT   ++   +R+ KG+ +  V
Sbjct: 755 SDDNSDDILDLNVDKVVSLVIPKNQGAILTATQNGYGKRTELVEYPTKSRNTKGVISIKV 814

Query: 833 SKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVV 892
           S+ N  G +VA   V + DQI+L++D GTL+R  VNEI +  R T+GV +  T +DE +V
Sbjct: 815 SERN--GKVVAATQVEETDQIMLITDAGTLVRTRVNEISVVGRNTQGVRLIRTTEDETLV 872

Query: 893 SVERIRESEIVDEAESTE 910
            ++R+ E +   E   +E
Sbjct: 873 GLQRVCEVDEEAEDFDSE 890


>gi|146277213|ref|YP_001167372.1| DNA gyrase subunit A [Rhodobacter sphaeroides ATCC 17025]
 gi|145555454|gb|ABP70067.1| DNA gyrase, A subunit [Rhodobacter sphaeroides ATCC 17025]
          Length = 904

 Score =  944 bits (2439), Expect = 0.0,   Method: Composition-based stats.
 Identities = 472/899 (52%), Positives = 623/899 (69%), Gaps = 7/899 (0%)

Query: 12  EEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKY 71
              G+  VSI +EM+ +YL YA++VI+ RAIPDLRDGLKPVHRRIL+ M + G   +K Y
Sbjct: 4   PHGGLPQVSIAEEMKTAYLDYAMSVIVSRAIPDLRDGLKPVHRRILYAMHETGNTHDKPY 63

Query: 72  VKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYT 131
            K AR  G+ MGKYHPHG+ AIYDAL RMAQ +S+ L L++GQGNFGS+DGD  AA RYT
Sbjct: 64  RKSARPVGDTMGKYHPHGDGAIYDALVRMAQPFSMGLKLLDGQGNFGSMDGDNAAAMRYT 123

Query: 132 ECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIP 191
           E R+ K A FLL D+ KDTVDF+ NYDG  +EP VL AR+PN+LVNG GGIAVGMATNIP
Sbjct: 124 EVRMDKPAAFLLADIDKDTVDFQDNYDGKDREPTVLPARFPNMLVNGAGGIAVGMATNIP 183

Query: 192 THNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIR 251
            HNLGEVVD  +A+I+NPDI  + LMEII GPDFPTG VILGR+G + AY  GRGS+++R
Sbjct: 184 PHNLGEVVDATLAMIENPDISTERLMEIIPGPDFPTGGVILGRSGARKAYLEGRGSVIMR 243

Query: 252 GVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVV 311
               +E+   DR  IV+ EIPYQVNKA M+EKIA++VREK+I  IA ++DESDR G RVV
Sbjct: 244 AKVRVEEIRKDRYAIVLDEIPYQVNKATMIEKIADMVREKKIEGIAHVQDESDRVGVRVV 303

Query: 312 IELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVR 371
           IELKR A+ +V+LNQL+R+T +Q+ F  NM+ALNG +PE+ TL   L  F+ FRE+VV R
Sbjct: 304 IELKRDATPEVVLNQLWRFTPMQTTFGCNMLALNGGRPEQLTLRDFLSHFLTFREDVVAR 363

Query: 372 RTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLI 431
           RT Y L KAR+R+H+L GLA+AV+N+DEVV  IR S +P  AR  LM R W A+DI D I
Sbjct: 364 RTAYELRKARERSHILCGLAVAVSNVDEVVATIRSSADPAEARERLMTRRWPAADIADYI 423

Query: 432 DLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDIL 491
            LIDD S+TI  DGT  LSE+Q RAIL+LRL RLT +G  ++ +EL  L  +I++ LDIL
Sbjct: 424 RLIDDPSHTINEDGTYNLSEIQARAILDLRLQRLTAMGVKEVTDELAELAAKIRDYLDIL 483

Query: 492 SSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRV 551
            SR R++ II  EL  VK     PRRT I E   D+EDED I REDMVVT++  GY+KR 
Sbjct: 484 GSRERIMAIISDELREVKALFAVPRRTEISEWAGDLEDEDLIEREDMVVTITSGGYIKRT 543

Query: 552 PLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSP 611
           PL+ +R+QRRGGKG + +  +++D VT LF+ +THT +LFF++ G VY  K WRLP+G  
Sbjct: 544 PLAEFRSQRRGGKGLASMATKEDDVVTTLFVANTHTQLLFFTTDGMVYDLKCWRLPLGGR 603

Query: 612 QARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRS 671
            A+GKA++NIL +  G  I  +M   E E+ W+ L VVFAT  G+VRRN+LSDF  + R+
Sbjct: 604 TAKGKAIVNILPIATGISIAALMKIDEPEAEWDRLQVVFATSEGDVRRNRLSDFTNVKRN 663

Query: 672 GKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAK 731
           GKIAMKL     +++V  C + +D+++ T +G+ +RF  + +RVF+GR+S GVRGI LA+
Sbjct: 664 GKIAMKLPEGVSLVNVSICDENDDVMMVTAMGRAIRFQTTDVRVFSGRDSTGVRGIRLAE 723

Query: 732 GDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQ 791
           GD+V+SM+++ H +AD  ER  Y+K       +      +      ++   G +S  R  
Sbjct: 724 GDRVVSMSVIRHFEADPAERAAYLKQRRLMAGVTEEAESDEDEDAIEA---GQLSPTRYA 780

Query: 792 ELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDND 851
           E+   E  ILT++ +G GK +SS+D+ +  R G+G+ +    K    G LVA FP+  +D
Sbjct: 781 EMSAAEDLILTITARGLGKISSSHDYPVRGRGGQGVTS--FEKSMRGGPLVACFPIEMSD 838

Query: 852 QIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAESTE 910
           Q++L +  G  IRVPV +I   SR+  GV +F T  +E VVSV RI   +  D AE  E
Sbjct: 839 QVMLATSGGQSIRVPVEQISFRSRSAGGVRVFDTGGNEEVVSVARIA--DAGDTAEVIE 895


>gi|308049654|ref|YP_003913220.1| DNA gyrase subunit A [Ferrimonas balearica DSM 9799]
 gi|307631844|gb|ADN76146.1| DNA gyrase subunit A [Ferrimonas balearica DSM 9799]
          Length = 876

 Score =  943 bits (2438), Expect = 0.0,   Method: Composition-based stats.
 Identities = 411/904 (45%), Positives = 575/904 (63%), Gaps = 67/904 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT ++I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++G +WNK Y K 
Sbjct: 7   EITPINIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNELGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR  L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYTLVDGQGNFGSVDGDSAAAMRYTEVR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + + AH LL DL K+TVD+ PNYDG+ Q P VL  + PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MDRIAHELLADLDKETVDYVPNYDGTEQIPAVLPTKVPNLLVNGASGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EVVDGC+ +IDN    +D L+EII GPDFPTG +I GR GI  AY TGRG I +R  +
Sbjct: 187 LTEVVDGCLHLIDNEHATIDELIEIIPGPDFPTGGIINGRKGIFEAYRTGRGKIYVRAKT 246

Query: 255 HIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIEL 314
            +E     RE I+V EIPYQVNKA ++EKIAELV++K+I  I+ LRDESD+ G R+VIEL
Sbjct: 247 EVETDKNGREAIIVNEIPYQVNKARLIEKIAELVKDKKIEGISGLRDESDKDGMRIVIEL 306

Query: 315 KRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTK 374
           KRG   +V+LN LY  T +Q++F +NMVAL   +P+ F L  +L+AF+  R EVV RRT 
Sbjct: 307 KRGEVPEVVLNNLYAQTQMQTVFGMNMVALANGQPKIFNLKEMLEAFIRHRREVVTRRTV 366

Query: 375 YLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLI 434
           Y L KAR+RAH+L GLAIA+AN+D ++ +IR SP P  AR  L+ + W+  ++  +++  
Sbjct: 367 YELRKARERAHILEGLAIALANIDPIIELIRQSPTPAEAREALLSQGWDLGNVAGMLEKA 426

Query: 435 DDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKE 486
            D +             DG  YL+  Q +AIL+LRL +LTGL  + I +E  SL  +I E
Sbjct: 427 GDDAARPEWLTPEYGIRDGKYYLTLEQAKAILDLRLQKLTGLEHEAILDEYKSLLEQIAE 486

Query: 487 CLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLG 546
            L IL S  RL+ +I++EL +VK +    R T I     D+  ED I +ED+VVT+SH G
Sbjct: 487 LLHILGSTERLMEVIREELEAVKTQYGDERMTEISAASADISMEDLITQEDVVVTLSHQG 546

Query: 547 YVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRL 606
           YVK  PL+ Y AQRRGGKG+S   M+DEDF+  L + +TH ++L FSS+G VY  +V++L
Sbjct: 547 YVKYQPLTDYEAQRRGGKGKSATKMKDEDFIERLLVANTHDTILCFSSIGKVYWMRVFQL 606

Query: 607 PIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFI 666
           P+ S  ARG+ ++N+L L +GERIT I+P  E      + +++FAT  G V++  L+ + 
Sbjct: 607 PLASRTARGRPIVNLLPLGEGERITAILPVEEYS---ADKFILFATAKGTVKKTALNAYS 663

Query: 667 QINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRG 726
           +   SG  A+ L   DE++ V      N+++L +  G+ VRF    +R   GR + GVRG
Sbjct: 664 RPLSSGIRAINLADDDELIGVNITEGNNEVMLFSDAGKVVRFNEDQVRAM-GRTATGVRG 722

Query: 727 ISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNIS 786
           I+L   D+V+S+ +                                              
Sbjct: 723 INLEGSDRVVSLIV---------------------------------------------- 736

Query: 787 EERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFP 846
                    ++  ILTV+E GFGKRT   ++   +R+ KG+ +  VS+ N  G +V    
Sbjct: 737 -------PDEDGAILTVTENGFGKRTPQQEYPTKSRATKGVISIKVSERN--GLVVGAVQ 787

Query: 847 VNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEA 906
           V +ND+I+L++++GTL+R  V+E+    R T+GV +  TA+ E+VV +ERI E E+ +  
Sbjct: 788 VGENDEIMLITNRGTLVRTRVSEVSEVGRNTQGVRLIRTAEGEQVVGLERIDEVEVDESL 847

Query: 907 ESTE 910
              E
Sbjct: 848 LEGE 851



 Score = 78.3 bits (191), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 43/252 (17%), Positives = 99/252 (39%), Gaps = 15/252 (5%)

Query: 531 DCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVL 590
           +    +  ++  +  G VK+  L+ Y      G     +   D+D +  + I   +  V+
Sbjct: 637 EEYSADKFILFATAKGTVKKTALNAYSRPLSSGIRAINLA--DDDELIGVNITEGNNEVM 694

Query: 591 FFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVF 650
            FS  G V +    ++      A G   +  ++L   +R+ +++          +  ++ 
Sbjct: 695 LFSDAGKVVRFNEDQVRAMGRTATG---VRGINLEGSDRVVSLI------VPDEDGAILT 745

Query: 651 ATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVR 707
            T++G  +R    ++   +R+ K  + +   +     +      + ++I+L T  G  VR
Sbjct: 746 VTENGFGKRTPQQEYPTKSRATKGVISIKVSERNGLVVGAVQVGENDEIMLITNRGTLVR 805

Query: 708 FPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISG 767
             +S +    GRN+ GVR I  A+G+QV+ +  +   + D       +   +        
Sbjct: 806 TRVSEVSEV-GRNTQGVRLIRTAEGEQVVGLERIDEVEVDESLLEGEIDTEAEGESQPEA 864

Query: 768 DTEEITSLKNDS 779
            + +  +   D 
Sbjct: 865 QSGDTEATGADE 876


>gi|315633980|ref|ZP_07889269.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Aggregatibacter
           segnis ATCC 33393]
 gi|315477230|gb|EFU67973.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Aggregatibacter
           segnis ATCC 33393]
          Length = 885

 Score =  943 bits (2438), Expect = 0.0,   Method: Composition-based stats.
 Identities = 423/904 (46%), Positives = 588/904 (65%), Gaps = 39/904 (4%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
           + IT VSI +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M + G  +NK Y K
Sbjct: 6   QDITPVSIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHEGGNAYNKPYRK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            ARI G+V+GKYHPHG++A+YD L RMAQ +SLR +L++GQGNFGSVDGD PAA RYTE 
Sbjct: 66  SARIVGDVIGKYHPHGDSAVYDTLVRMAQPFSLRYMLVDGQGNFGSVDGDAPAAMRYTEA 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K AH LL DL K+TV+F PNYDGS Q P VL  + P +LVNG  GIAVGMATNIP H
Sbjct: 126 RMTKIAHELLADLDKETVNFVPNYDGSEQIPEVLPTKVPALLVNGSSGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NLGEV+DGC+A I+N DI +D LM  I GPDFPT A+I GR GI+ AY TGRG I +R  
Sbjct: 186 NLGEVLDGCLAYIENNDITIDELMSHIPGPDFPTAALINGRKGIEEAYKTGRGKIYVRAR 245

Query: 254 SHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
           + IE     RE I+V EIPYQVNKA ++EKIAE V+EK+I  I+ LRDESD+ G R+VIE
Sbjct: 246 AEIETDEKGRESIIVNEIPYQVNKAKLIEKIAEFVKEKKIEGISGLRDESDKDGMRIVIE 305

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T +Q  F +N+VAL+  +P+   L  +++AFV  R EVV RRT
Sbjct: 306 IKRDAVGEVVLNNLYALTQMQVTFGINIVALDHGQPKLLNLKQLIEAFVLHRREVVTRRT 365

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KAR+R H+L GLAIA+AN+D ++ +IR +PNPE+A+REL+ R W    + +++  
Sbjct: 366 IFELRKARERTHILEGLAIALANVDPIIELIRQAPNPESAKRELLARPWQLGHVAEMLAA 425

Query: 434 IDDSSYTIGS--------DGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
               +             DG  YL+EVQ +AIL+LRL +LT LG D+I +E   L   I 
Sbjct: 426 TGVDAARPEDLDEQYGIRDGLYYLTEVQAQAILDLRLQKLTNLGHDEILDEYKKLLEAIG 485

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E L IL S  RL+ +I++EL  ++++ + PRRT I     D+  ED I +ED+VVT+SH 
Sbjct: 486 ELLYILRSPERLMEVIREELEQIREQFNDPRRTEITAASGDINLEDLIAQEDVVVTLSHE 545

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  P+S Y AQRRGGKG+S   M++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 546 GYVKYQPISDYEAQRRGGKGKSATKMKEEDFIEKLLVANTHDTILCFSSRGRLYWLKVYQ 605

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  +RG+ ++NIL LN+ ERIT I+P    E    + +VV AT  G V++  L++F
Sbjct: 606 LPQASRGSRGRPIVNILPLNENERITAILPVTAYE---EDKFVVMATAGGIVKKIALTEF 662

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   SG IA+ L   DE++ V+     N+I+L +  G+ VRF  SA+R   GR + GVR
Sbjct: 663 SRPRSSGIIALNLRDEDELIGVDITDGNNEIMLFSSQGRVVRFSESAVRAM-GRLATGVR 721

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI LA                                   +G+ EE++    + +++ NI
Sbjct: 722 GIKLA-------------------------LTNDLNDDESAGEIEEVSDDNTEETLDLNI 756

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
            +     +   +  ILT ++ G+GKRT   ++   +R+ KG+ +  VS+ N  G +VA  
Sbjct: 757 DKVVSLVIPKNDGEILTATQNGYGKRTKLEEYPTKSRNTKGVISIKVSERN--GKVVAAT 814

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V D DQI+L++D GTL+R  V+E+ I  R T+GV +  T+++E VVS+ERI + +  + 
Sbjct: 815 QVVDTDQIMLITDAGTLVRTRVSEVSIVGRNTQGVRLIRTSENEHVVSLERICDVDDEEG 874

Query: 906 AEST 909
            + +
Sbjct: 875 EQES 878


>gi|167646833|ref|YP_001684496.1| DNA gyrase subunit A [Caulobacter sp. K31]
 gi|167349263|gb|ABZ71998.1| DNA gyrase, A subunit [Caulobacter sp. K31]
          Length = 922

 Score =  943 bits (2436), Expect = 0.0,   Method: Composition-based stats.
 Identities = 498/922 (54%), Positives = 657/922 (71%), Gaps = 14/922 (1%)

Query: 1   MTEHI-----ISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRR 55
           M++         +       +T ++I DE++ SYL YA++VI+ RA+PD RDGLKPVHRR
Sbjct: 1   MSDDQNTIPGSPASPASRGDVTPINIEDELRRSYLDYAMSVIVSRALPDARDGLKPVHRR 60

Query: 56  ILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQG 115
           +LF M + G    + YVK AR+ G+VMGKYHPHG+A+IY  L RM Q +S+ L+LI+GQG
Sbjct: 61  VLFSMHEQGQTPERSYVKSARVVGDVMGKYHPHGDASIYFTLVRMTQSFSMGLVLIDGQG 120

Query: 116 NFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVL 175
           NFGSVDGD PAA RYTECR+   A  LL DL KDTVDF+ NYDG  QEPVVL +R PN+L
Sbjct: 121 NFGSVDGDMPAAMRYTECRMAPPAMSLLADLDKDTVDFQDNYDGKEQEPVVLPSRIPNLL 180

Query: 176 VNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRT 235
           VNG GGIAVGMATNIP HNLGE+VD C+ +ID PD+  D L++++ GPDFPTG  I+GR 
Sbjct: 181 VNGAGGIAVGMATNIPPHNLGEIVDACLLMIDEPDVTTDRLLDLVPGPDFPTGGEIIGRA 240

Query: 236 GIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVD 295
           G + A  TGRGS+++RG++ +E+    RE I++T IPYQVNK+ ++E IAE+VR+KRI  
Sbjct: 241 GPRQALLTGRGSVIMRGLATVEEIRTGREAIIITAIPYQVNKSNLVEYIAEMVRDKRIEG 300

Query: 296 IADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLI 355
           ++D+RDES+R G R+V+ELKR AS +VILNQLYR+T+LQS F VNM+ALN  +P +  L 
Sbjct: 301 VSDIRDESNRDGMRIVVELKRDASGEVILNQLYRFTALQSSFGVNMLALNRGRPSQMGLR 360

Query: 356 GILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARR 415
            ++  FV FREEVVVRRTK+ L KARDR HVLVGL IAVAN+DE + IIR S +P  AR 
Sbjct: 361 ELIDIFVKFREEVVVRRTKFELGKARDRGHVLVGLTIAVANIDEFIHIIRSSKDPTEARE 420

Query: 416 ELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRN 475
            L+ ++W A D+  L++LI D        G + L++ Q RAIL L L+RLTGLGRD+I N
Sbjct: 421 RLVAKAWPAGDMLPLVELIADPRTVQEDGGLIRLTDEQARAILALTLSRLTGLGRDEIGN 480

Query: 476 ELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVR 535
           E  SL   IK  LD+LS R+ ++ ++++EL+ V+++   PRR +IV+G  D+EDED IVR
Sbjct: 481 EAASLAEAIKGFLDLLSDRANIMAVVREELVEVREKFAIPRRCQIVDGDADVEDEDLIVR 540

Query: 536 EDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSL 595
           EDMV+TV+  GYVKR PL+ YR Q RGGKG+SG+  + ED VT +F  STH  +LFF+S 
Sbjct: 541 EDMVITVTLGGYVKRTPLAAYRTQHRGGKGKSGMATKTEDAVTRVFSASTHAPLLFFTSG 600

Query: 596 GFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHG 655
           G VYK KVWRLP G   +RGKA +N+L +  GE IT+I+  PEDE++W+ L V+FAT+ G
Sbjct: 601 GKVYKMKVWRLPQGVANSRGKAFVNLLPIEPGETITSILTLPEDEATWDGLDVMFATRSG 660

Query: 656 NVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRV 715
           +VRRNKLSDF+ + R+GKIAMKLD  D I+ V  C    DILL T  G+C+RF    +RV
Sbjct: 661 SVRRNKLSDFVDVRRNGKIAMKLDEGDGIIGVAVCDSGKDILLNTAAGRCIRFSTDEVRV 720

Query: 716 FAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSL 775
           FA R+S GVRG+ LA GD VISM+++ + DA   ER  Y+KH  A  R +  + +E  + 
Sbjct: 721 FASRDSTGVRGVRLAPGDSVISMSVLRNVDATPAERAAYLKHQRAMARAMGEEGDEAPAA 780

Query: 776 KNDSSV---EGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDV 832
             DS     E +++ ER  EL   E+ +LTVS +GFGKRTS+YD+R + R G+G+ A D+
Sbjct: 781 VEDSEEDVGEASLTPERIAELGAAEEILLTVSSEGFGKRTSAYDYRRTGRGGQGLTAQDL 840

Query: 833 SKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVV 892
           SK    G LV  FPV+++DQI+LV+D G LIRVPV++IR+A+R T+GV IF TA DE VV
Sbjct: 841 SKR--GGKLVGSFPVDESDQILLVTDAGQLIRVPVSQIRVAARNTQGVTIFRTAADEHVV 898

Query: 893 SVERIRESEIV----DEAESTE 910
           SVER+ E+       DE E+ E
Sbjct: 899 SVERLAETGGDDSTGDENEADE 920


>gi|254417991|ref|ZP_05031715.1| DNA gyrase, A subunit [Brevundimonas sp. BAL3]
 gi|196184168|gb|EDX79144.1| DNA gyrase, A subunit [Brevundimonas sp. BAL3]
          Length = 927

 Score =  942 bits (2435), Expect = 0.0,   Method: Composition-based stats.
 Identities = 489/917 (53%), Positives = 657/917 (71%), Gaps = 11/917 (1%)

Query: 1   MTEHIISSDEEE------EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHR 54
           MT+    +             I++++I DE++ SYL YA++VI+ RA+PD RDGLKPVHR
Sbjct: 1   MTDDSYENAATPIVPGGGGSDISTITIEDELKRSYLDYAMSVIVSRALPDARDGLKPVHR 60

Query: 55  RILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQ 114
           RIL+ M  + +   + Y KCAR+ G+V+G++HPHG+A++Y AL RMAQ +S+ L+L++GQ
Sbjct: 61  RILYSMHDLNMTPERSYSKCARVVGDVLGRFHPHGDASVYMALVRMAQPFSMGLMLVDGQ 120

Query: 115 GNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNV 174
           GNFGSVDGD PA+ RYTE ++  AA  L+ D+ KDTVDF+PNYD    EPVVL +R PN+
Sbjct: 121 GNFGSVDGDMPASMRYTEAKMAPAAVALMADIDKDTVDFQPNYDEKELEPVVLPSRIPNL 180

Query: 175 LVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGR 234
           LVNG GGIAVGMATNIP HNLGEVVD  +A++D+P++  DAL++I+ GPDFPTG  I+GR
Sbjct: 181 LVNGAGGIAVGMATNIPPHNLGEVVDAALALLDDPNVTDDALLDIVPGPDFPTGGEIMGR 240

Query: 235 TGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIV 294
           T  +NA   GRGS+++RG + +E+   DRE IVVTE+PYQVNK  ++E+IAE+VREKR+ 
Sbjct: 241 TAPRNALRDGRGSVIVRGRASVEEIRKDREAIVVTELPYQVNKQTLIERIAEMVREKRLE 300

Query: 295 DIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTL 354
            I+D+RDESDRQG R+VIELKR AS DVILNQL+RYT++QS F VNM+ALN  +PE+  L
Sbjct: 301 GISDVRDESDRQGMRIVIELKRDASGDVILNQLWRYTAMQSSFGVNMLALNHGRPEQMGL 360

Query: 355 IGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETAR 414
             +L+ F+ FREEVVVRR K+ LNKARDR HVLVGLA+AVAN+DEV+ IIR S +P  AR
Sbjct: 361 RDLLQIFLDFREEVVVRRVKFELNKARDRGHVLVGLAVAVANIDEVIHIIRSSADPTEAR 420

Query: 415 RELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIR 474
             L  + W   D+  L++LI D    + +  ++ L++ Q RAIL L L+RLTGLGRDDI 
Sbjct: 421 ERLQAKPWPVGDMMALVELIADPRSVVINGDSLQLTDEQARAILALTLSRLTGLGRDDIF 480

Query: 475 NELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIV 534
            E N L   I+  L ILS R  +L II+ +L+ VKD+   PRRT I EG  +MEDED I 
Sbjct: 481 GEANGLADTIQGHLTILSDRKNVLAIIRDDLIDVKDKFAVPRRTLIGEGDGEMEDEDLIP 540

Query: 535 REDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSS 594
           REDMVVTV+H GYVKRV L+ YR Q RGGKG+SG+ M+DED +T +F  STHT VLFF++
Sbjct: 541 REDMVVTVTHGGYVKRVALNAYRTQHRGGKGKSGMTMKDEDAITGVFSASTHTPVLFFAT 600

Query: 595 LGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKH 654
            G  YK K WRLP+G+PQ+RGKA +N+L +  G+ I  ++P PEDE++W +  ++FAT  
Sbjct: 601 NGKAYKLKTWRLPLGNPQSRGKAFVNLLPIEPGDSIMNVLPLPEDETTWGDYDIMFATSS 660

Query: 655 GNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIR 714
           G+VRRNKLSDF  +NR+GKIAMKL+  D ++ V  CT ++D+LLTT LG+ +RF    +R
Sbjct: 661 GDVRRNKLSDFATVNRAGKIAMKLEGDDRMVGVGLCTADDDVLLTTALGRAIRFKADDVR 720

Query: 715 VFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEE--- 771
           VF GR+S GVRG+ L  GD+VISMAI+   DA  +ER  Y+KH +A R+ ++G   E   
Sbjct: 721 VFKGRDSTGVRGVRLQDGDEVISMAILGRVDATPEERSAYVKHANAMRKALAGAEAEEDV 780

Query: 772 -ITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
              +   D   +  ++ ER  EL   EQFILTV+E GFGKR+S+Y++R + R G+G+ A 
Sbjct: 781 AAPAEAEDEVADAALTVERIAELGAAEQFILTVTETGFGKRSSAYEYRRTGRGGQGLTAH 840

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
            +        L A FPV + D ++LV+  G +IR  ++++RI  R+++GV IF T KDE+
Sbjct: 841 GLGGRAGT-RLAAAFPVEETDDLLLVTSGGQMIRTRMDQVRIVGRSSQGVTIFRTGKDEK 899

Query: 891 VVSVERIRESEIVDEAE 907
           VVSVER+ ES   DEA+
Sbjct: 900 VVSVERLPESGGSDEAD 916



 Score = 56.3 bits (134), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 50/122 (40%), Gaps = 5/122 (4%)

Query: 645 NLYVVFATKHGNVRRNKLSDFIQI----NRSGKIAMKLDSRDEILSVETCTQENDILLTT 700
             +++  T+ G  +R+   ++ +            +   +   + +     + +D+LL T
Sbjct: 807 EQFILTVTETGFGKRSSAYEYRRTGRGGQGLTAHGLGGRAGTRLAAAFPVEETDDLLLVT 866

Query: 701 KLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSA 760
             GQ +R  +  +R   GR+S GV      K ++V+S+  +  +    +  +   +   A
Sbjct: 867 SGGQMIRTRMDQVR-IVGRSSQGVTIFRTGKDEKVVSVERLPESGGSDEADVASEEGGEA 925

Query: 761 QR 762
           + 
Sbjct: 926 EA 927


>gi|262274466|ref|ZP_06052277.1| DNA gyrase subunit A [Grimontia hollisae CIP 101886]
 gi|262221029|gb|EEY72343.1| DNA gyrase subunit A [Grimontia hollisae CIP 101886]
          Length = 875

 Score =  942 bits (2435), Expect = 0.0,   Method: Composition-based stats.
 Identities = 413/892 (46%), Positives = 570/892 (63%), Gaps = 67/892 (7%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
           K IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK Y K
Sbjct: 6   KEITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNVLGNDWNKAYKK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGS+DGD  AA RYTE 
Sbjct: 66  SARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEV 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K AH LL DL K+TVD+ PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP H
Sbjct: 126 RMAKIAHELLADLDKETVDYVPNYDGTEQIPEVMPTRIPNLLVNGASGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NL EVV+GC+A I+N DI ++ LM  I GPDFPT A+I GR GI++AY TGRG I +R  
Sbjct: 186 NLTEVVNGCLAYIENEDITIEELMTHIPGPDFPTAAMINGRKGIEDAYRTGRGKIYLRSK 245

Query: 254 SHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
           + IE     +E IVVTEIPYQVNKA ++EKIAELV++K+I  I+ LRDESD+ G R+VIE
Sbjct: 246 ADIETDKNGKETIVVTEIPYQVNKARLIEKIAELVKDKKIEGISALRDESDKDGMRIVIE 305

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
            KR A A+VILN LY  T LQ+ F +NMVAL+  +P  F L  +LK FV  R EVV RRT
Sbjct: 306 CKRDAVAEVILNNLYAQTQLQTSFGINMVALDNNQPRLFNLKDMLKCFVNHRREVVTRRT 365

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L GLAIA+AN+DE++ +IR +  P  AR  L  R W+   +  +++ 
Sbjct: 366 IFELRKARDRAHILEGLAIALANIDEIIELIRNAQTPAVAREALQNRGWDLGTVAVMLEA 425

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
               +             DG  YL+E Q +AIL+LRL +LTGL  + I +E   L   I 
Sbjct: 426 TGVDAARPEWLEDEFGVRDGKYYLTEQQAQAILDLRLHKLTGLEHEKILDEYKELLTLIG 485

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + ILSS  RL+ +I++EL +V+D     RRT I     D++ ED I +ED+VVT+SH 
Sbjct: 486 ELMFILSSPERLMEVIREELEAVRDGFGDERRTEITAASADIDIEDLINQEDVVVTLSHE 545

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PL+ Y AQRRGGKG+S   M++EDF+  L + +TH ++L FS+ G +Y  KV++
Sbjct: 546 GYVKYQPLTDYEAQRRGGKGKSATRMKEEDFIERLLVANTHDTILCFSTRGRMYWLKVYQ 605

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP+ S  ARGK ++N+L L Q ERIT I+P  E E   ++ +V  AT  G V++  L+DF
Sbjct: 606 LPLASRTARGKPIVNLLPLEQDERITAILPVKEYE---DDKFVFMATSDGTVKKTPLTDF 662

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L   D ++ V+    +ND++L +K G+ VRF  S +R   GR + GVR
Sbjct: 663 SRPRSAGIIAVNLREGDSLIGVDITWGDNDVMLFSKSGKVVRFHESQVRAM-GRTAAGVR 721

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI LA+GD+V+S+ +                                             
Sbjct: 722 GIKLAEGDKVVSLIV--------------------------------------------- 736

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      E  +LTV+E G+GKRT   ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 737 --------PHNEGDVLTVTENGYGKRTELCEYPAKSRATQGVVSIKVSERN--GCVVGAV 786

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERI 897
            V+   + +++++ GTL+R  V E+    R T+GV +  T++ ERVV ++RI
Sbjct: 787 QVDTGYEFMMITNGGTLVRTRVAEVSQVGRNTQGVRLIRTSEGERVVGLQRI 838



 Score = 71.4 bits (173), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 41/249 (16%), Positives = 99/249 (39%), Gaps = 15/249 (6%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  V   +  G VK+ PL+ +   R  G     V +R+ D +  + I      V+ F
Sbjct: 639 YEDDKFVFMATSDGTVKKTPLTDFSRPRSAG--IIAVNLREGDSLIGVDITWGDNDVMLF 696

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           S  G V +    ++      A   A +  + L +G+++ +++         N   V+  T
Sbjct: 697 SKSGKVVRFHESQVRAMGRTA---AGVRGIKLAEGDKVVSLI------VPHNEGDVLTVT 747

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVRFP 709
           ++G  +R +L ++   +R+ +  + +   +     +         + ++ T  G  VR  
Sbjct: 748 ENGYGKRTELCEYPAKSRATQGVVSIKVSERNGCVVGAVQVDTGYEFMMITNGGTLVRTR 807

Query: 710 ISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT 769
           ++ +    GRN+ GVR I  ++G++V+ +  +   + +        +  +     +  + 
Sbjct: 808 VAEV-SQVGRNTQGVRLIRTSEGERVVGLQRIEEPEEELLPSEEGGELATQTVSEVPAED 866

Query: 770 EEITSLKND 778
                  ++
Sbjct: 867 AANDEASDE 875


>gi|157828149|ref|YP_001494391.1| DNA gyrase subunit A [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165932848|ref|YP_001649637.1| DNA gyrase subunit A [Rickettsia rickettsii str. Iowa]
 gi|157800630|gb|ABV75883.1| DNA gyrase subunit A [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165907935|gb|ABY72231.1| DNA gyrase subunit A [Rickettsia rickettsii str. Iowa]
          Length = 905

 Score =  942 bits (2435), Expect = 0.0,   Method: Composition-based stats.
 Identities = 460/891 (51%), Positives = 634/891 (71%), Gaps = 8/891 (0%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++    +  V+I DEM+ SYL YA++VI+ RAIPD+RDGLKPVHRRI++ M + G   NK
Sbjct: 3   DKSSSNLVPVNIEDEMKVSYLDYAMSVIVSRAIPDVRDGLKPVHRRIIYSMHEAGNHANK 62

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+VMGKYHPHG++AIYDAL RMAQD+SLRL L++GQGNFGS+DGD  AA R
Sbjct: 63  PYRKSARIVGDVMGKYHPHGDSAIYDALVRMAQDFSLRLPLVDGQGNFGSMDGDAAAAMR 122

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE R+ K A+ L++D+ K+TV F PNYDGS +EP VL A +PN+LVNG GGIAVGMATN
Sbjct: 123 YTESRMAKVAYKLVEDIDKETVSFNPNYDGSEEEPSVLPAMFPNLLVNGSGGIAVGMATN 182

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNLGEV+D C   IDN DI++  L+E+++GPDFPTG++ILG +GI++AY TGRGSI+
Sbjct: 183 IPPHNLGEVIDACCLYIDNNDIEILDLLEVVKGPDFPTGSMILGISGIRSAYLTGRGSII 242

Query: 250 IRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYR 309
           IRG + IE     R+ I++TEIPY VNKA ++EKIA++V+EKRI  I+DLRDES++ G R
Sbjct: 243 IRGRAEIENIGNSRQAIIITEIPYMVNKARLVEKIAQMVKEKRIEGISDLRDESNKNGVR 302

Query: 310 VVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVV 369
           + IELK+   A+V+LNQ+Y  T LQ+ F V M+AL    P+   L  ++ AFV+FRE VV
Sbjct: 303 IFIELKKDVVAEVVLNQIYACTQLQTSFGVIMLALKDGLPKVMNLKEVIAAFVSFREVVV 362

Query: 370 VRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKD 429
             RT YLLNKARDRAH+L+GL IAV+N+DE++RII+ S +P  A++ELM R W A +I  
Sbjct: 363 TNRTIYLLNKARDRAHILLGLTIAVSNIDEIIRIIKASNDPNAAKQELMARQWEALNILP 422

Query: 430 LIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLD 489
           L+ L+DD +  +   G    +EVQ +AILE+RL RLT + ++ +  +L +L  EI E L+
Sbjct: 423 LVKLVDDKAM-LNEQGKCNFTEVQAKAILEMRLQRLTAMEKNKLEEDLKNLTTEITEYLN 481

Query: 490 ILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVK 549
           IL SR+RLL I+K+EL+ VK+E  TPR T I  G  D + ED I RE+MVVTV+  GY+K
Sbjct: 482 ILGSRTRLLEILKEELIKVKEEFATPRLTSIEFGEFDQDIEDLIQREEMVVTVTLGGYIK 541

Query: 550 RVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIG 609
           RVPLS YRAQ+RGGKGRSG+ MRDED  T +F+ STHT +LFFS++G VY  K+++LP+ 
Sbjct: 542 RVPLSSYRAQKRGGKGRSGLSMRDEDITTQVFVGSTHTPMLFFSNIGQVYSLKLYKLPLS 601

Query: 610 SPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQIN 669
           +PQ +G+ ++NIL L   E IT IMP PE++   +NL ++FAT  GN+RR+ L DF ++ 
Sbjct: 602 NPQGKGRPMVNILPLKANEHITNIMPLPENQDERDNLNIMFATAKGNIRRSDLLDFKKLQ 661

Query: 670 RSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISL 729
            +GKIA++LD  D+++ V+ C ++  ILL TK G+ +RFP+ ++RV   R S GVRG+ L
Sbjct: 662 SNGKIAIRLDEDDKLIDVKPCKEDEHILLATKAGKALRFPVESLRVIKSRTSDGVRGMKL 721

Query: 730 AKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEER 789
           AK D VISM ++    +  ++R  Y+     QR  I+   E      N   +  +++   
Sbjct: 722 AKEDSVISMTVLKGISSTKEDRDAYLSVPWEQRLEIAKGEE-----FNPEELGVSLTAPA 776

Query: 790 CQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVND 849
             E+   E+FILTV+E GFGKR+S+Y +RI++R G GI   D++  ++ G +V V PV  
Sbjct: 777 IVEMANSEEFILTVTENGFGKRSSAYGYRITDRGGSGIINMDIN--DKTGLVVGVMPVKM 834

Query: 850 NDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900
           +D+++L+++ G LIR  +  IRI  R T GV++F     E+VVSV  I E+
Sbjct: 835 DDELMLITNSGKLIRCKLESIRITGRNTSGVILFKLDDGEKVVSVSLIAET 885


>gi|293390066|ref|ZP_06634400.1| DNA gyrase A [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290950600|gb|EFE00719.1| DNA gyrase A [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 887

 Score =  942 bits (2435), Expect = 0.0,   Method: Composition-based stats.
 Identities = 421/905 (46%), Positives = 584/905 (64%), Gaps = 39/905 (4%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
           + IT VS+ +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M + G  +NK Y K
Sbjct: 6   QDITPVSLEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHEGGNLYNKPYRK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            ARI G+V+GKYHPHG++A+YD L RMAQ +SLR +L++GQGNFGSVDGD PAA RYTE 
Sbjct: 66  SARIVGDVIGKYHPHGDSAVYDTLVRMAQPFSLRYMLVDGQGNFGSVDGDAPAAMRYTEA 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K AH LL DL K+TV+F PNYDGS   P VL  + P +LVNG  GIAVGMATNIP H
Sbjct: 126 RMTKIAHELLADLDKETVNFVPNYDGSEMIPEVLPTKVPALLVNGSSGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NLGEV+DGC+A I+N DI +D LM  I GPDFPT A+I GR GI+ AY TGRG I +R  
Sbjct: 186 NLGEVLDGCLAYIENNDITIDELMSHIPGPDFPTAALINGRKGIEEAYKTGRGKIYVRAR 245

Query: 254 SHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
           + IE     RE I+V EIPYQVNKA ++EKIAE V++K+I  I+ LRDESD+ G R+VIE
Sbjct: 246 AEIETDEKGRESIIVNEIPYQVNKAKLIEKIAEFVKDKKIEGISGLRDESDKDGMRIVIE 305

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T +Q  F +N+VAL+  +P+   L  +++AFV  R EVV RRT
Sbjct: 306 IKRDAVGEVVLNNLYALTQMQVTFGINIVALDHGQPKLLNLKQLIEAFVLHRREVVTRRT 365

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KAR+R H+L GLAIA+AN+D ++ +IR +PNPE A+REL+ R W    + D++  
Sbjct: 366 IFELRKARERTHILEGLAIALANVDPIIELIRKAPNPENAKRELLARPWQLGHVADMLAA 425

Query: 434 IDDSSYTIGS--------DGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
               +             DG  YL+EVQ +AIL+LRL +LT LG D+I +E   L   I 
Sbjct: 426 SGVDAARPEDLDEQYGIRDGLYYLTEVQAQAILDLRLQKLTNLGHDEILDEYKKLLDAIG 485

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           + L IL S  RL+ +I++EL  ++++ + PRRT I     D+  ED I +ED+VVT+SH 
Sbjct: 486 KLLYILRSPERLMEVIREELEQIREQFNDPRRTEITAASGDINLEDLIAQEDVVVTLSHE 545

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  P++ Y AQRRGGKG+S   M++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 546 GYVKYQPITDYEAQRRGGKGKSATKMKEEDFIEKLLVANTHDTILCFSSRGRLYWLKVYQ 605

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++NIL LN+ ERIT I+P    E    + +VV AT  G V++  L++F
Sbjct: 606 LPQASRGARGRPIVNILPLNENERITAILPVAAYE---EDKFVVMATAGGIVKKIALTEF 662

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   SG IA+ L   DE++ V+     N+I+L +  G+ VRF  SA+R   GR + GVR
Sbjct: 663 SRPRSSGIIALNLRDEDELIGVDITDGSNEIMLFSSQGRVVRFSESAVRAM-GRLATGVR 721

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI LA                                   + + E+++    + +++ NI
Sbjct: 722 GIKLA-------------------------LTNDLSDDESAVEIEDVSDDNAEETLDLNI 756

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
            +     +      ILT ++ G+GKRT   ++   +R+ KG+ +  VS+ N  G +VA  
Sbjct: 757 DKVVSLVIPKNNGEILTATQNGYGKRTKLDEYPTKSRNTKGVISIKVSERN--GKVVAAA 814

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V +NDQI+L++D GTL+R  V+E+ I  R T+GV +  T++ E VVS+ERI E +  + 
Sbjct: 815 QVEENDQIMLITDAGTLVRTRVSEVSIVGRNTQGVRLIRTSEAEHVVSLERICEVDDEES 874

Query: 906 AESTE 910
              TE
Sbjct: 875 ENPTE 879



 Score = 70.2 bits (170), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 51/252 (20%), Positives = 100/252 (39%), Gaps = 25/252 (9%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  VV  +  G VK++ L+ +   R  G     + +RDED +  + I      ++ F
Sbjct: 639 YEEDKFVVMATAGGIVKKIALTEFSRPRSSG--IIALNLRDEDELIGVDITDGSNEIMLF 696

Query: 593 SSLGFVYKEKVWRLPIGSP-----QARGKALINILSLNQGERITTIMP------------ 635
           SS G V +     +          +    AL N LS ++       +             
Sbjct: 697 SSQGRVVRFSESAVRAMGRLATGVRGIKLALTNDLSDDESAVEIEDVSDDNAEETLDLNI 756

Query: 636 --FPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLD---SRDEILSVETC 690
                     NN  ++ AT++G  +R KL ++   +R+ K  + +       ++++    
Sbjct: 757 DKVVSLVIPKNNGEILTATQNGYGKRTKLDEYPTKSRNTKGVISIKVSERNGKVVAAAQV 816

Query: 691 TQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDE 750
            + + I+L T  G  VR  +S +    GRN+ GVR I  ++ + V+S+  +   D +  E
Sbjct: 817 EENDQIMLITDAGTLVRTRVSEV-SIVGRNTQGVRLIRTSEAEHVVSLERICEVDDEESE 875

Query: 751 RICYMKHMSAQR 762
                   +++ 
Sbjct: 876 NPTESAVENSEE 887


>gi|238761953|ref|ZP_04622926.1| DNA gyrase subunit A [Yersinia kristensenii ATCC 33638]
 gi|238699681|gb|EEP92425.1| DNA gyrase subunit A [Yersinia kristensenii ATCC 33638]
          Length = 888

 Score =  942 bits (2435), Expect = 0.0,   Method: Composition-based stats.
 Identities = 409/905 (45%), Positives = 571/905 (63%), Gaps = 68/905 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL KDTVDF PNYDG+ Q P V+  + PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKDTVDFVPNYDGTEQIPAVMPTKIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A I++ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG I +R  +
Sbjct: 187 LSEVIDGCLAYIEDENITIEGLMEYIPGPDFPTAAIINGRRGIEEAYRTGRGKIYVRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVALSQGQPKLLNLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +  P  A+  L+   W   ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRRAATPAEAKAGLIASPWELGNVASMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGDDAARPEWLEEEFGIRDGKYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTVIG 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + IL +  RL+ +I++EL+++K+  +  RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELIFILENPERLMEVIREELVAIKELYNDARRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PL+ Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      ++  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYE---EGRHIFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L + LG+ VRFP S +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGSNEVMLFSALGKVVRFPESQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+VIS+ I                                             
Sbjct: 723 GINLNGDDRVISLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV+E G+GKRT+  ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 738 --------PRGDGEILTVTENGYGKRTAVEEYPTKSRATQGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V   DQI++++D GTL+R  V+E+ +  R T+GV +  TA+DE VV ++R+ E E  DE
Sbjct: 788 QVAPTDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDE 847

Query: 906 AESTE 910
               E
Sbjct: 848 ILDGE 852



 Score = 74.4 bits (181), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 65/439 (14%), Positives = 140/439 (31%), Gaps = 38/439 (8%)

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
            L K     H    L      L  +  +I    NPE     + +      ++ +     +
Sbjct: 462 RLQKLTGLEHE-KLLDEYKELLTVIGELIFILENPERLMEVIREELVAIKELYNDARRTE 520

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTG---LGRDDIRNELNSLGIEIKECLDI-- 490
            ++ T   +    +++      L  +               R         IKE   I  
Sbjct: 521 ITANTSDINIEDLINQEDVVVTLSHQGYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDR 580

Query: 491 ---LSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTV----- 542
               ++   +L    +  L        P  +R   G   +        E +   +     
Sbjct: 581 LLVANTHDTILCFSSRGRLYWMKVYQLPEASRGARGRPIVNLLPLEPNERITAILPVREY 640

Query: 543 ---------SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
                    +  G VK+  L+ +   R  G     +   DE    DL        V+ FS
Sbjct: 641 EEGRHIFMATASGTVKKTALTEFSRPRSAGIIAVNLNEGDELIGVDL--TDGSNEVMLFS 698

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           +LG V +    ++      A G   +  ++LN  +R+ +++          +  ++  T+
Sbjct: 699 ALGKVVRFPESQVRSMGRTATG---VRGINLNGDDRVISLI------IPRGDGEILTVTE 749

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLD---SRDEILSVETCTQENDILLTTKLGQCVRFPI 710
           +G  +R  + ++   +R+ +  + +       +++        + I++ T  G  VR  +
Sbjct: 750 NGYGKRTAVEEYPTKSRATQGVISIKVSERNGKVVGAVQVAPTDQIMMITDAGTLVRTRV 809

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTE 770
           S +    GRN+ GV  I  A+ + V+ +  V   + D +                +    
Sbjct: 810 SEV-SVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDEILDGESLDGEEGSEEKTALNT 868

Query: 771 EITSLKNDSSVEGNISEER 789
                  D + +G+  +  
Sbjct: 869 PEDEDAADEAKDGDDEDNN 887


>gi|300704758|ref|YP_003746361.1| DNA gyrase subunit A [Ralstonia solanacearum CFBP2957]
 gi|299072422|emb|CBJ43767.1| DNA gyrase, subunit A, type II topoisomerase [Ralstonia
           solanacearum CFBP2957]
          Length = 885

 Score =  942 bits (2434), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/916 (41%), Positives = 565/916 (61%), Gaps = 65/916 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++  K    VS+ +EM++SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M ++  +WN+
Sbjct: 2   DQFAKETLPVSLEEEMRSSYLAYAMSVIVGRALPDVRDGLKPVHRRVLYAMHELNNDWNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG++A+YD + RMAQD+SLR +L++GQGNFGSVDGD  AA R
Sbjct: 62  PYKKSARIVGDVIGKYHPHGDSAVYDTIVRMAQDFSLRYMLVDGQGNFGSVDGDNAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE RL K AH LL D+ K+TVDF PNYDGS  EP +L AR PN+L+NG  GIAVGMATN
Sbjct: 122 YTEIRLSKIAHELLADIDKETVDFEPNYDGSETEPSILPARIPNLLINGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL EVVDGC+ ++ NP+  +D L+E+I  PDFPT  +I G +G++  Y TGRG +V
Sbjct: 182 IPPHNLREVVDGCLHLLRNPEATVDELIELIPAPDFPTAGIIYGISGVREGYRTGRGRVV 241

Query: 250 IRGVSHIEKTSGDR-EQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R  +H E     + + I+V E+PYQVNK  +LE+IAELV EKR+  I+D+RDESD+ G 
Sbjct: 242 MRAKTHFEDIDRGQRQAIIVDELPYQVNKRTLLERIAELVTEKRVEGISDIRDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVIELKRG   +V+LN LY+ T LQ  F +NMVAL   +P    L  +L+ F+  R EV
Sbjct: 302 RVVIELKRGEVPEVVLNNLYKNTQLQDTFGMNMVALVDGQPRLLNLRQMLECFLLHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KAR+R H+L GLA+A+AN+DE + II+ +P P  A++ELM RSW++  ++
Sbjct: 362 VTRRTVFDLRKARERGHILEGLAVALANIDEFIAIIKAAPTPPIAKQELMGRSWDSGLVR 421

Query: 429 DLIDLIDDSS---------------YTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDI 473
           D++   +  +               + +  DG   LS+ Q + IL++RL RLTGL +D I
Sbjct: 422 DMLSRAESDTVGGRTAYRPEGLLPVFGMQGDGLYKLSDTQAQEILQMRLQRLTGLEQDKI 481

Query: 474 RNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCI 533
             E   +  +I + LDIL+   R+  II +EL  ++ E    RR++I     +++ ED I
Sbjct: 482 VQEYREVMAQIADLLDILARPERITAIIVEELTLIRSEFGDERRSQIEHNATELDTEDLI 541

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
             +D+VVT+SH GY+K  P+S YRAQ+RGG+G+     +++D++  LF+ +TH  +L FS
Sbjct: 542 TPQDLVVTLSHSGYMKSQPISEYRAQKRGGRGKQAAATKEDDWIDTLFVANTHDYILCFS 601

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           + G +Y  KVW +P GS  +RG+ ++N+  L+ GE+I  I+P  + +      +V  AT 
Sbjct: 602 NRGRLYWLKVWEVPQGSRNSRGRPIVNMFPLSPGEKINVILPVKQFD---EQHFVFMATS 658

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAI 713
            G V++  L++F    ++G IA+ LD  D ++  +    ++D++L +  G+ VRF  + +
Sbjct: 659 KGTVKKTALTEFSNPRKAGIIAVDLDEGDFLIGADITDGQHDVMLFSDAGKAVRFDENDV 718

Query: 714 RVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEIT 773
           R   GR + GVRG++L  G QVI+M +     A   E+                      
Sbjct: 719 RPM-GRQARGVRGMNLEDGQQVIAMLVAPAETAGEGEQAVAGS----------------- 760

Query: 774 SLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVS 833
                                     +LT +E G+GKRT   ++    R  KG+ A   S
Sbjct: 761 --------------------------VLTATENGYGKRTPISEYTRHGRGTKGMIAIQTS 794

Query: 834 KINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVS 893
           + N  G +VA   V   D+I+L++  G LIR  V+EIR   RAT+GV + +  +  ++  
Sbjct: 795 ERN--GKVVAAALVAPEDEIMLITTGGVLIRTRVDEIREMGRATQGVTLIAVGEGNKLSG 852

Query: 894 VERIRESEIVDEAEST 909
           ++R+ ES+   E  + 
Sbjct: 853 LQRVVESDAEGEDAAD 868



 Score = 75.2 bits (183), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 49/244 (20%), Positives = 102/244 (41%), Gaps = 13/244 (5%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  V   +  G VK+  L+ +   R+ G     +   + DF+    I      V+ F
Sbjct: 647 FDEQHFVFMATSKGTVKKTALTEFSNPRKAGIIAVDLD--EGDFLIGADITDGQHDVMLF 704

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNL----YV 648
           S  G   +     +     QARG   +N   L  G+++  ++  P + +          V
Sbjct: 705 SDAGKAVRFDENDVRPMGRQARGVRGMN---LEDGQQVIAMLVAPAETAGEGEQAVAGSV 761

Query: 649 VFATKHGNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQC 705
           + AT++G  +R  +S++ +  R   G IA++      ++++      E++I+L T  G  
Sbjct: 762 LTATENGYGKRTPISEYTRHGRGTKGMIAIQTSERNGKVVAAALVAPEDEIMLITTGGVL 821

Query: 706 VRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLI 765
           +R  +  IR   GR + GV  I++ +G+++  +  V+ +DA+ ++          +    
Sbjct: 822 IRTRVDEIREM-GRATQGVTLIAVGEGNKLSGLQRVVESDAEGEDAADGATESDGEAPSA 880

Query: 766 SGDT 769
               
Sbjct: 881 DTTE 884


>gi|1835202|emb|CAA70294.1| DNA gyrase subunit A [Rhodobacter sphaeroides]
          Length = 907

 Score =  942 bits (2434), Expect = 0.0,   Method: Composition-based stats.
 Identities = 474/901 (52%), Positives = 626/901 (69%), Gaps = 9/901 (0%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
            G+  VSI +EM+ +YL YA++VI+ RAIPDLRDGLKPVHRRIL+ M + G   +K Y K
Sbjct: 6   SGLPQVSIAEEMKTAYLDYAMSVIVSRAIPDLRDGLKPVHRRILYAMHETGNTHDKPYRK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            AR  G+ MGKYHPHG+ AIYDAL RMAQ +S+ L L++GQGNFGS+DGD  AA RYTE 
Sbjct: 66  SARPVGDTMGKYHPHGDGAIYDALVRMAQPFSMGLKLLDGQGNFGSMDGDNAAAMRYTEV 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K A FLL D+ KDTVDF+ NYDG  +EP VL AR+PN+LVNG GGIAVGMATNIP H
Sbjct: 126 RMDKPAAFLLADIDKDTVDFQDNYDGKDREPTVLPARFPNMLVNGAGGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NLGEVVD  +A+I+NPDI  + LMEII GPDFPTG VILGR+G + AY  GRGS+++R  
Sbjct: 186 NLGEVVDATLAMIENPDISTERLMEIIPGPDFPTGGVILGRSGARKAYLEGRGSVIMRAK 245

Query: 254 SHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
           + +E+   DR  IV+ EIPYQVNKA M+EKIA++VREK+I  IA ++DESDR G RVVIE
Sbjct: 246 ARVEEIRKDRYAIVLDEIPYQVNKATMIEKIADMVREKKIEGIAHVQDESDRVGVRVVIE 305

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           LKR A+ +V+LNQL+R+T +Q+ F  NM+ALNG +PE+ TL   L  F+ FRE+VV RRT
Sbjct: 306 LKRDATPEVVLNQLWRFTPMQTTFGCNMLALNGGRPEQLTLRDFLSHFLTFREDVVARRT 365

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            Y L KAR+R+H+L GLA+AV+N+DEVV  IR   +P  AR  LM R   ++DI D I L
Sbjct: 366 AYELRKARERSHILCGLAVAVSNVDEVVATIRSLADPAQARERLMTRRLPSADIADYIRL 425

Query: 434 IDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSS 493
           IDD S+TI  DGT  LSE+Q RAIL+LRL+ LT +G  ++ +EL  L  +I++ LDIL S
Sbjct: 426 IDDPSHTINEDGTYNLSEIQARAILDLRLSSLTAMGVKEVTDELAELAAKIRDYLDILGS 485

Query: 494 RSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPL 553
           R R++ II  EL  VKD    PRRT I E   D+EDED I REDMVVT++  GY+KR PL
Sbjct: 486 RERIMAIISDELREVKDLFAVPRRTEISEWAGDLEDEDLIEREDMVVTITSGGYIKRTPL 545

Query: 554 SVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQA 613
           + +R+QRRGGKG + +  +++D VT LF+ +THT +LFF++ G VY  K WRLP+G   A
Sbjct: 546 AEFRSQRRGGKGLASMATKEDDVVTTLFVANTHTQLLFFTTDGMVYDLKCWRLPLGGRTA 605

Query: 614 RGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGK 673
           +GKA++NIL +  G  I  +M     E  W+ L VVFAT  G+VRRN+LSDF  + R+GK
Sbjct: 606 KGKAIVNILPIATGISIAALMKIDGPEEEWDRLQVVFATSEGDVRRNRLSDFTNVKRNGK 665

Query: 674 IAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGD 733
           IAMKL     +++V  C +++D+++ T LG+ +RF  + +RVF+GR+S GVRGI LA GD
Sbjct: 666 IAMKLPEGVSLVNVSICDEQDDVMMVTALGRAIRFSTTDVRVFSGRDSTGVRGIRLASGD 725

Query: 734 QVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQEL 793
           +V+SM+++ H +AD  ER  Y+K     R +     E     + D+   G +S  R  E+
Sbjct: 726 RVVSMSVIRHFEADPAERAAYLKQR---RLMAGVTQEAEADEEEDAVEAGQLSPTRYAEM 782

Query: 794 KLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQI 853
              E  ILT++ +G GK +SS+D+ +  R G+G+ A    K    G LVA FPV  +DQ+
Sbjct: 783 SAAEDLILTITARGLGKISSSHDYPVRGRGGQGVTA--FEKSMRGGQLVASFPVEMSDQV 840

Query: 854 ILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE----SEIVDEAEST 909
           +L +  G  IRVPV +I   SR+  GV +F T   E VVSV RI +    ++ V++AE  
Sbjct: 841 MLATSGGQSIRVPVEQISFRSRSAGGVRVFDTGASEEVVSVARIADAGETADGVEDAEPG 900

Query: 910 E 910
           E
Sbjct: 901 E 901


>gi|300692121|ref|YP_003753116.1| DNA gyrase, subunit A, type II topoisomerase [Ralstonia
           solanacearum PSI07]
 gi|299079181|emb|CBJ51849.1| DNA gyrase, subunit A, type II topoisomerase [Ralstonia
           solanacearum PSI07]
          Length = 885

 Score =  942 bits (2434), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/916 (41%), Positives = 566/916 (61%), Gaps = 65/916 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++  K    VS+ +EM++SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M ++  +WN+
Sbjct: 2   DQFAKETLPVSLEEEMRSSYLAYAMSVIVGRALPDVRDGLKPVHRRVLYAMHELNNDWNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG++A+YD + RMAQD+SLR +L++GQGNFGSVDGD  AA R
Sbjct: 62  PYKKSARIVGDVIGKYHPHGDSAVYDTIVRMAQDFSLRYMLVDGQGNFGSVDGDNAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE RL K AH LL D+ K+TV+F PNYDGS  EP +L AR PN+L+NG  GIAVGMATN
Sbjct: 122 YTEIRLSKIAHELLADIDKETVNFEPNYDGSETEPSILPARIPNLLINGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL EVVDGC+ ++ NPD  +D L+E+I  PDFPT  +I G +G++  Y TGRG +V
Sbjct: 182 IPPHNLREVVDGCLHLLRNPDATVDELIELIPAPDFPTAGIIYGISGVREGYRTGRGRVV 241

Query: 250 IRGVSHIEKTSGDR-EQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R  +H E     + + I+V E+PYQVNK  +LE+IAELV EKR+  I+D+RDESD+ G 
Sbjct: 242 MRAKTHFEDIDRGQRQAIIVDELPYQVNKRTLLERIAELVTEKRVEGISDIRDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVIELKRG   +V+LN LY+ T LQ  F +NMVAL   +P    L  +L+ F+  R EV
Sbjct: 302 RVVIELKRGEVPEVVLNNLYKNTQLQDTFGMNMVALVDGQPRLLNLRQMLECFLLHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KAR+R H+L GLA+A+AN+DE + II+ +P P  A++ELM RSW++  ++
Sbjct: 362 VTRRTVFDLRKARERGHILEGLAVALANIDEFIAIIKAAPTPPIAKQELMGRSWDSGLVR 421

Query: 429 DLIDLIDDSS---------------YTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDI 473
           +++   +  +               + +  DG   LS+ Q + IL++RL RLTGL +D I
Sbjct: 422 EMLSRAESDTAGGRAAYRPEGLLPVFGMQDDGLYKLSDTQAQEILQMRLQRLTGLEQDKI 481

Query: 474 RNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCI 533
             E   +  +I + LDIL+   R+  II +EL  ++ E    RR++I     +++ ED I
Sbjct: 482 VQEYREVMEQIADLLDILARPERITAIIVEELTLIRAEFGDERRSQIEHNATELDTEDLI 541

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
             +D+VVT+SH GY+K  P+S YRAQ+RGG+G+     +++D++  LF+ +TH  +L FS
Sbjct: 542 TPQDLVVTLSHSGYMKSQPISEYRAQKRGGRGKQAAATKEDDWIDTLFVANTHDYILCFS 601

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           + G +Y  KVW +P GS  +RG+ ++N+  L+ GE+I  I+P  + +      +V  AT 
Sbjct: 602 NRGRLYWLKVWEVPQGSRNSRGRPIVNMFPLSPGEKINVILPVKQFD---EQHFVFMATS 658

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAI 713
            G V++  L++F    ++G IA+ LD  D ++  +    ++D++L +  G+ VRF  + +
Sbjct: 659 KGTVKKTALTEFSNPRKAGIIAVDLDEGDFLIGADITDGQHDVMLFSDAGKAVRFDENDV 718

Query: 714 RVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEIT 773
           R   GR + GVRG++L +G QVI+M +     A   E+                      
Sbjct: 719 RPM-GRQARGVRGMNLEEGQQVIAMLVAPAETAGEGEQAVAGS----------------- 760

Query: 774 SLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVS 833
                                     +LT +E G+GKRT   ++    R  KG+ A   S
Sbjct: 761 --------------------------VLTATENGYGKRTPISEYTRHGRGTKGMIAIQTS 794

Query: 834 KINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVS 893
           + N  G +VA   V   D+I+L++  G LIR  V+EIR   RAT+GV + +  +  ++  
Sbjct: 795 ERN--GKVVAAALVAPEDEIMLITTGGVLIRTRVDEIREMGRATQGVTLIAVGEGNKLSG 852

Query: 894 VERIRESEIVDEAEST 909
           ++R+ ES+   E  + 
Sbjct: 853 LQRVVESDAEGEDAAD 868



 Score = 74.8 bits (182), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 49/244 (20%), Positives = 102/244 (41%), Gaps = 13/244 (5%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  V   +  G VK+  L+ +   R+ G     +   + DF+    I      V+ F
Sbjct: 647 FDEQHFVFMATSKGTVKKTALTEFSNPRKAGIIAVDLD--EGDFLIGADITDGQHDVMLF 704

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNL----YV 648
           S  G   +     +     QARG   +N   L +G+++  ++  P + +          V
Sbjct: 705 SDAGKAVRFDENDVRPMGRQARGVRGMN---LEEGQQVIAMLVAPAETAGEGEQAVAGSV 761

Query: 649 VFATKHGNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQC 705
           + AT++G  +R  +S++ +  R   G IA++      ++++      E++I+L T  G  
Sbjct: 762 LTATENGYGKRTPISEYTRHGRGTKGMIAIQTSERNGKVVAAALVAPEDEIMLITTGGVL 821

Query: 706 VRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLI 765
           +R  +  IR   GR + GV  I++ +G+++  +  V+ +DA+ ++               
Sbjct: 822 IRTRVDEIREM-GRATQGVTLIAVGEGNKLSGLQRVVESDAEGEDAADSGAESDGDAPGA 880

Query: 766 SGDT 769
               
Sbjct: 881 DTAE 884


>gi|17545620|ref|NP_519022.1| DNA gyrase subunit A [Ralstonia solanacearum GMI1000]
 gi|17427913|emb|CAD14603.1| probable dna gyrase (subunit a)(type II topoisomerase) protein
           [Ralstonia solanacearum GMI1000]
          Length = 885

 Score =  941 bits (2433), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/916 (41%), Positives = 565/916 (61%), Gaps = 65/916 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++  K    VS+ +EM++SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M ++  +WN+
Sbjct: 2   DQFAKETLPVSLEEEMRSSYLAYAMSVIVGRALPDVRDGLKPVHRRVLYAMHELNNDWNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG++A+YD + RMAQD+SLR +L++GQGNFGSVDGD  AA R
Sbjct: 62  PYKKSARIVGDVIGKYHPHGDSAVYDTIVRMAQDFSLRYMLVDGQGNFGSVDGDNAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE RL K AH LL D+ K+TVDF PNYDGS  EP +L AR PN+L+NG  GIAVGMATN
Sbjct: 122 YTEIRLSKIAHELLADIDKETVDFEPNYDGSETEPSILPARIPNLLINGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL EVVDGC+ ++ NPD  +D L+E+I  PDFPT  +I G +G++  Y TGRG +V
Sbjct: 182 IPPHNLREVVDGCLHLLRNPDATVDELIELIPAPDFPTAGIIYGISGVREGYRTGRGRVV 241

Query: 250 IRGVSHIEKTSGDR-EQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R  +H E     + + I+V E+PYQVNK  +LE+IAELV EKRI  I+D+RDESD+ G 
Sbjct: 242 MRAKTHFEDIDRGQRQAIIVDELPYQVNKRTLLERIAELVTEKRIEGISDIRDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVIELKRG   +V+LN LY+ T LQ  F +NMVAL   +P    L  +L+ F+  R EV
Sbjct: 302 RVVIELKRGEVPEVVLNNLYKNTQLQDTFGMNMVALVDGQPRLLNLRQMLECFLLHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KAR+R H+L GLA+A+AN+DE + II+ +P P  A++ELM R+W++  ++
Sbjct: 362 VTRRTVFDLRKARERGHILEGLAVALANIDEFIAIIKAAPTPPIAKQELMGRNWDSGLVR 421

Query: 429 DLIDLIDDSS---------------YTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDI 473
           +++   +  +               + +   G   LS+ Q + IL++RL RLTGL +D I
Sbjct: 422 EMLSRAESDTVGGRAAYRPEGLLPVFGMQEGGLYKLSDTQAQEILQMRLQRLTGLEQDKI 481

Query: 474 RNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCI 533
             E   +  +I + LDIL+   R+  II +EL  ++ E    RR++I     +++ ED I
Sbjct: 482 VQEYREVMAQIADLLDILARPERITAIIVEELTLIRAEFGDERRSQIEHNATELDTEDLI 541

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
             +D+VVT+SH GY+K  P+S YRAQ+RGG+G+     +++D++  LF+ +TH  +L FS
Sbjct: 542 TPQDLVVTLSHSGYMKSQPISEYRAQKRGGRGKQAAATKEDDWIDTLFVANTHDYILCFS 601

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           + G +Y  KVW +P GS  +RG+ ++N+  L+ GE+I  I+P  + +      +V  AT 
Sbjct: 602 NRGRLYWLKVWEVPQGSRNSRGRPIVNMFPLSPGEKINVILPVKQFD---EQHFVFMATS 658

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAI 713
            G V++  L++F    ++G IA+ LD  D ++  +    ++D++L +  G+ VRF  + +
Sbjct: 659 KGTVKKTALTEFSNPRKAGIIAVDLDDGDFLIGADITDGQHDVMLFSDAGKAVRFDENDV 718

Query: 714 RVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEIT 773
           R   GR + GVRG++L +G QVI+M +     A   E+                      
Sbjct: 719 RPM-GRQARGVRGMNLEEGQQVIAMLVAPAETAGEGEQAVAGS----------------- 760

Query: 774 SLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVS 833
                                     +LT +E G+GKRT   ++    R  KG+ A   S
Sbjct: 761 --------------------------VLTATENGYGKRTPISEYTRHGRGTKGMIAIQTS 794

Query: 834 KINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVS 893
           + N  G +VA   V   D+I+L++  G LIR  V+EIR   RAT+GV + +  +  ++  
Sbjct: 795 ERN--GKVVAAALVAPEDEIMLITTGGVLIRTRVDEIREMGRATQGVTLIAVGEGNKLSG 852

Query: 894 VERIRESEIVDEAEST 909
           ++R+ ES+   E  + 
Sbjct: 853 LQRVVESDAEGEDAAD 868



 Score = 74.8 bits (182), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 50/244 (20%), Positives = 103/244 (42%), Gaps = 13/244 (5%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  V   +  G VK+  L+ +   R+ G     +   D DF+    I      V+ F
Sbjct: 647 FDEQHFVFMATSKGTVKKTALTEFSNPRKAGIIAVDLD--DGDFLIGADITDGQHDVMLF 704

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNL----YV 648
           S  G   +     +     QARG   +N   L +G+++  ++  P + +          V
Sbjct: 705 SDAGKAVRFDENDVRPMGRQARGVRGMN---LEEGQQVIAMLVAPAETAGEGEQAVAGSV 761

Query: 649 VFATKHGNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQC 705
           + AT++G  +R  +S++ +  R   G IA++      ++++      E++I+L T  G  
Sbjct: 762 LTATENGYGKRTPISEYTRHGRGTKGMIAIQTSERNGKVVAAALVAPEDEIMLITTGGVL 821

Query: 706 VRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLI 765
           +R  +  IR   GR + GV  I++ +G+++  +  V+ +DA+ ++          +    
Sbjct: 822 IRTRVDEIREM-GRATQGVTLIAVGEGNKLSGLQRVVESDAEGEDAADGGPESDGEAPDA 880

Query: 766 SGDT 769
               
Sbjct: 881 DTAE 884


>gi|302383735|ref|YP_003819558.1| DNA gyrase subunit alpha [Brevundimonas subvibrioides ATCC 15264]
 gi|302194363|gb|ADL01935.1| DNA gyrase, A subunit [Brevundimonas subvibrioides ATCC 15264]
          Length = 933

 Score =  941 bits (2433), Expect = 0.0,   Method: Composition-based stats.
 Identities = 489/908 (53%), Positives = 646/908 (71%), Gaps = 6/908 (0%)

Query: 7   SSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVE 66
                    I  +SI DE++ SYL YA++VI+ RA+PD RDGLKPVHRRIL+ M  + + 
Sbjct: 22  PLPPSSGGDIAVISIEDELKRSYLDYAMSVIVSRALPDARDGLKPVHRRILYSMHDLNMT 81

Query: 67  WNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPA 126
             + Y KCAR+ G+V+G++HPHG+A++Y AL RMAQ +S+ L+LI+GQGNFGSVDGD PA
Sbjct: 82  PERSYSKCARVVGDVLGRFHPHGDASVYMALVRMAQPFSMGLMLIDGQGNFGSVDGDMPA 141

Query: 127 AERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGM 186
           + RYTE R+  AA  LL D+ KDTVDF+PNYD    EPVVL AR PN+LVNG GGIAVGM
Sbjct: 142 SMRYTEARMAPAASALLTDIDKDTVDFQPNYDEKELEPVVLPARIPNLLVNGAGGIAVGM 201

Query: 187 ATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRG 246
           ATNIP HNLGE+VD C+A++D+P++  DAL++I+ GPDFPTG  ILGRT  +NA   GRG
Sbjct: 202 ATNIPPHNLGEIVDACIALLDDPEVSDDALLDIVPGPDFPTGGEILGRTAPRNALRDGRG 261

Query: 247 SIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQ 306
           S+V+RGV+ +E    DRE IVVTE+P+QVNK  ++E+IAE+VREKR+  I+D+RDESDR 
Sbjct: 262 SVVVRGVASVETIRKDREAIVVTELPFQVNKQTLIERIAEMVREKRLEGISDVRDESDRA 321

Query: 307 GYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFRE 366
           G R+VIELKR AS DVILNQL+RYT++QS F VNM+ALN  +PE+  L  +L+ F+ FRE
Sbjct: 322 GMRIVIELKRDASGDVILNQLWRYTAMQSSFGVNMLALNHGRPEQMGLRKLLEVFLDFRE 381

Query: 367 EVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASD 426
           EVVVRR K+ L KARDR HVLVGLA+AVAN+DEV+ IIR S +P  AR  L  ++W   D
Sbjct: 382 EVVVRRVKFELAKARDRGHVLVGLAVAVANIDEVIHIIRSSADPAEARERLQAKAWPVGD 441

Query: 427 IKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKE 486
           +  L++LI D    +    ++ L++ Q RAIL L L+RLTGLGRDDI  E   L   I+ 
Sbjct: 442 MIALVELIADPRSVLIDGNSLKLTDEQARAILGLTLSRLTGLGRDDIFGEARGLADTIQG 501

Query: 487 CLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLG 546
            L ILS R  +L II+++LL V+++   PRRT I EG  ++EDED I REDMVVTV+H G
Sbjct: 502 HLTILSDRKNILAIIREDLLDVRNQFAVPRRTLIGEGDFELEDEDLIPREDMVVTVTHGG 561

Query: 547 YVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRL 606
           YVKRV L+ YR Q RGGKG+SG+ M+DED +T +F  STHT VLFF++ G  YK KVWRL
Sbjct: 562 YVKRVALNAYRTQHRGGKGKSGMTMKDEDAITGVFSASTHTPVLFFATNGKAYKLKVWRL 621

Query: 607 PIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFI 666
           P+G+P +RGKA +N+L +  G+ I  ++P PEDE++W +  ++FAT+ G+VRRNKLSDF 
Sbjct: 622 PLGAPTSRGKAFVNLLPIEPGDSIMNVLPLPEDETTWGDYDIMFATRSGDVRRNKLSDFA 681

Query: 667 QINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRG 726
            +NR+GKIAMKL+  D ++ V  CT E+D+LLTT  G+ +RF    +RVF GR+S GVRG
Sbjct: 682 TVNRAGKIAMKLEDGDHMVGVALCTAEDDVLLTTAGGRAIRFKADDVRVFKGRDSTGVRG 741

Query: 727 ISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSS-----V 781
           + L   D VISMA++   DA  DER  Y+KH +A R+      +E T ++ D        
Sbjct: 742 VRLQGDDAVISMAVLGRVDATPDERAAYVKHANAMRKATGESDDETTGVEADDEGAEEGG 801

Query: 782 EGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGAL 841
           +  IS ER   L   EQFILTV+E GFGKR+S+Y++R + R G+G+ A  +        L
Sbjct: 802 DAPISPERIAALGAAEQFILTVTETGFGKRSSAYEYRRTGRGGQGLTAHGLGGRAGK-RL 860

Query: 842 VAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESE 901
            A FPV ++D ++LV+  G +IR  V ++RI  R+++GV IF TA+ ERVVSVER+ E+ 
Sbjct: 861 AAAFPVEESDDLLLVTSSGQMIRTRVGQVRIVGRSSQGVTIFRTAEGERVVSVERLAETG 920

Query: 902 IVDEAEST 909
             DE E  
Sbjct: 921 GGDEPEVE 928


>gi|15602706|ref|NP_245778.1| DNA gyrase subunit A [Pasteurella multocida subsp. multocida str.
           Pm70]
 gi|12721149|gb|AAK02925.1| GyrA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 899

 Score =  941 bits (2433), Expect = 0.0,   Method: Composition-based stats.
 Identities = 413/919 (44%), Positives = 591/919 (64%), Gaps = 43/919 (4%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+ +    +   + I+ +SI +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M
Sbjct: 7   MTDLV---QDTMHQDISPISIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAM 63

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            + G  +NK Y K ARI G+V+GKYHPHG++A+YD L RMAQ +SLR +L++GQGNFGS+
Sbjct: 64  HEGGNAYNKPYRKSARIVGDVIGKYHPHGDSAVYDTLVRMAQPFSLRYMLVDGQGNFGSI 123

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGD  AA RYTE R+ K AH LL DL K+TV+F PNYDGS Q P VL  + P +LVNG  
Sbjct: 124 DGDAAAAMRYTEARMTKIAHELLADLDKETVNFVPNYDGSEQIPEVLPTKVPALLVNGSS 183

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEV+DGC+A I+N +I +D LM  I GPDFPT A+I GR GI+ A
Sbjct: 184 GIAVGMATNIPPHNLGEVLDGCLAYIENNEISIDELMTYIPGPDFPTAALINGRKGIEEA 243

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRG I +R  + +E      E IVV EIPYQVNKA ++EKIA+LV+EK++  I+ + 
Sbjct: 244 YKTGRGKIYVRAKAEVETDEKGGETIVVHEIPYQVNKAKLIEKIADLVKEKKVEGISAIT 303

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           D SD+ G R+ I++KR A  +V+LN LY  T LQ  F +N+VAL+  +P+   L  +++A
Sbjct: 304 DLSDKDGMRIEIKIKRDAVGEVVLNNLYALTQLQVTFGINIVALDKGQPKLLNLKQLIEA 363

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV  R EVV RRT Y L KAR+RAH+L GLAIA+AN+D ++ +IR +PNPE+A+R L+ +
Sbjct: 364 FVLHRREVVTRRTVYELRKARERAHILEGLAIALANVDPIIELIRNAPNPESAKRALLAQ 423

Query: 421 SWNASDIKDLIDLIDDSSYTIGS--------DGTMYLSEVQTRAILELRLARLTGLGRDD 472
           +W    +  ++      +             DG  YL+EVQ +AIL+LRL +LT LG D+
Sbjct: 424 AWELGHVSQMLAATGVDAARPEDLEEQYGIRDGMYYLTEVQAQAILDLRLQKLTNLGHDE 483

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDC 532
           I +E   L   I E L IL S  RL+ +I++EL  ++++ + PRRT I     D+  ED 
Sbjct: 484 ILDEYKKLLDVIGELLHILRSPERLMEVIREELEQIREQFNDPRRTEITASSADINLEDL 543

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
           I +ED+VVT+SH GYVK  PL+ Y AQRRGGKG+S    ++EDF+  L + +TH ++L F
Sbjct: 544 IAQEDVVVTLSHEGYVKYQPLTDYEAQRRGGKGKSAAKTKEEDFIERLLVANTHDTILCF 603

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           SS G +Y  KV++LP  S  ARG+ ++NIL L++ ERIT I+P    E    + +VV AT
Sbjct: 604 SSRGRLYWLKVYQLPQASRGARGRPIVNILPLDENERITAILPVTAYE---EDKFVVMAT 660

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISA 712
             G V++  L++F +   +G IA+ L   DE++ V+    +N+I+L +  G+ VRF  +A
Sbjct: 661 AGGIVKKIALTEFSRPRSTGIIALNLRDEDELIGVDITDGQNEIMLFSAQGRVVRFSENA 720

Query: 713 IRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEI 772
           +R   GR + GVRGI LA                                   + D EEI
Sbjct: 721 VRAM-GRAATGVRGIKLA-------------------------LTNDLSDDESAVDMEEI 754

Query: 773 TSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDV 832
           +    + +++ NI +     +   E  ILT ++ G+GKRT   ++   +R+ KG+ +  V
Sbjct: 755 SDENTNDALDLNIDKVVSLVIPKNEGAILTATQNGYGKRTELAEYPTKSRNTKGVISIKV 814

Query: 833 SKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVV 892
           S+ N  G +VA   V ++DQI+L++D GTL+R  VNEI I  R T+GV +  T++ E +V
Sbjct: 815 SERN--GKVVAATQVEESDQIMLITDAGTLVRTRVNEINIIGRNTQGVRLIRTSESETLV 872

Query: 893 SVERIRESEIVD-EAESTE 910
            ++R+ + +  D E++++E
Sbjct: 873 GLQRVCDVDEEDIESDASE 891


>gi|238751208|ref|ZP_04612702.1| DNA gyrase subunit A [Yersinia rohdei ATCC 43380]
 gi|238710482|gb|EEQ02706.1| DNA gyrase subunit A [Yersinia rohdei ATCC 43380]
          Length = 888

 Score =  941 bits (2432), Expect = 0.0,   Method: Composition-based stats.
 Identities = 409/905 (45%), Positives = 570/905 (62%), Gaps = 68/905 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL KDTVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKDTVDFVPNYDGTEQIPAVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A I++ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG + IR  +
Sbjct: 187 LSEVIDGCLAYIEDENITIEGLMEYIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVALSQGQPKLLNLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +  P  A+  L+   W   ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRRAATPAEAKAGLIANPWELGNVASMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGDDAARPEWLEAEFGIRDGKYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTIIG 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + IL +  RL+ +I++EL+++K++ + PRRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELIFILENPERLMEVIREELMAIKEQYNDPRRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PL+ Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      ++  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYE---EGRHIFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L + LG+ VRFP   +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGSNEVMLFSALGKVVRFPEGQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+V+S+ I                                             
Sbjct: 723 GINLNGDDKVVSLIIPRGDGD--------------------------------------- 743

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                         ILTV+E G+GKRT   ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 744 --------------ILTVTENGYGKRTEVTEYPTKSRATQGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V   DQI++++D GTL+R  V+E+ I  R T+GV +  TA+DE VV ++R+ E E  D+
Sbjct: 788 QVATTDQIMMITDAGTLVRTRVSEVSIVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDD 847

Query: 906 AESTE 910
               E
Sbjct: 848 ILDGE 852


>gi|162421768|ref|YP_001605843.1| DNA gyrase subunit A [Yersinia pestis Angola]
 gi|162354583|gb|ABX88531.1| DNA gyrase, A subunit [Yersinia pestis Angola]
          Length = 885

 Score =  941 bits (2432), Expect = 0.0,   Method: Composition-based stats.
 Identities = 409/900 (45%), Positives = 570/900 (63%), Gaps = 68/900 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL KDTVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKDTVDFVPNYDGTEQIPAVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A I++ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG + IR  +
Sbjct: 187 LSEVIDGCLAYIEDENISIEGLMEYIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVALSQGQPKLLNLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +  P  A+  L+   W   ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRRASTPAEAKAGLIASPWELGNVASMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGDDAARPEWLEAEFGIRDGKYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTLIG 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + IL +  RL+ +I++EL+++K++ +  RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELIFILENPDRLMEVIREELVAIKEQYNDLRRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PLS Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      +V  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYEEGC---HVFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L + LG+ VRFP   +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGSNEVMLFSALGKVVRFPEGQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+VIS+ I                                             
Sbjct: 723 GINLNGDDRVISLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV+E G+GKRT+  ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 738 --------PRGDGEILTVTENGYGKRTAVAEYPTKSRATQGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V   DQI++++D GTL+R  V+E+ +  R T+GV +  TA+DE VV ++R+ E E  D+
Sbjct: 788 QVAPTDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDD 847


>gi|251792152|ref|YP_003006872.1| DNA gyrase subunit A [Aggregatibacter aphrophilus NJ8700]
 gi|247533539|gb|ACS96785.1| DNA gyrase, A subunit [Aggregatibacter aphrophilus NJ8700]
          Length = 885

 Score =  941 bits (2431), Expect = 0.0,   Method: Composition-based stats.
 Identities = 420/904 (46%), Positives = 585/904 (64%), Gaps = 39/904 (4%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
           + IT VSI +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M + G  +NK Y K
Sbjct: 6   QDITPVSIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHEGGNAYNKPYRK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            ARI G+V+GKYHPHG++A+YD L RMAQ +SLR +L++GQGNFGSVDGD PAA RYTE 
Sbjct: 66  SARIVGDVIGKYHPHGDSAVYDTLVRMAQPFSLRYMLVDGQGNFGSVDGDAPAAMRYTEA 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K AH LL DL K+TV+F PNYDGS Q P VL  + P +LVNG  GIAVGMATNIP H
Sbjct: 126 RMTKIAHELLADLDKETVNFVPNYDGSEQIPEVLPTKVPALLVNGSSGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NLGEV+DGC+A I+N DI +D LM  I GPDFPT A+I GR GI+ AY TGRG I +R  
Sbjct: 186 NLGEVLDGCLAYIENNDITIDELMSHIPGPDFPTAALINGRKGIEEAYKTGRGKIYVRAK 245

Query: 254 SHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
           + IE     RE I+V EIPYQVNKA ++EKIAE V+EK+I  I+ LRDESD+ G R+VIE
Sbjct: 246 AEIETDEKGRETIIVNEIPYQVNKAKLIEKIAEFVKEKKIEGISGLRDESDKDGMRIVIE 305

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T +Q  F +N+VAL+  +P+   L  +++AFV  R EVV RRT
Sbjct: 306 IKRDAVGEVVLNNLYALTQMQVTFGINIVALDHGQPKLLNLKQLIEAFVLHRREVVTRRT 365

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KAR+R H+L GLAIA+AN+D ++ +IR +PNPETA+REL+ R W    + D++  
Sbjct: 366 IFELRKARERTHILEGLAIALANVDPIIELIRQAPNPETAKRELIARPWQLGHVADMLAA 425

Query: 434 IDDSSYTIGS--------DGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
               +             DG  YL+EVQ +AIL+LRL +LT LG D+I +E   L   I 
Sbjct: 426 AGVDAARPEDLDEQYGIRDGLYYLTEVQAQAILDLRLQKLTNLGHDEILDEYKKLLEAIG 485

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E L IL S  RL+ +I++EL  ++++ + PRRT I     D+  ED I +ED+VVT+SH 
Sbjct: 486 ELLHILRSPERLMEVIREELEQIREQFNDPRRTEITAASGDINLEDLIAQEDVVVTLSHE 545

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  P++ Y AQRRGGKG+S   M++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 546 GYVKYQPITDYEAQRRGGKGKSATKMKEEDFIEKLLVANTHDTILCFSSRGRLYWLKVYQ 605

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  +RG+ ++NIL L + ERIT I+P    E    + +V+ AT  G V++  L++F
Sbjct: 606 LPQASRGSRGRPIVNILPLGENERITAILPVTAYE---EDKFVIMATAGGVVKKIALTEF 662

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   SG IA+ L   DE++ V+     N+I+L +  G+ VRF  +A+R   GR + GVR
Sbjct: 663 SRPRSSGIIALNLRDEDELIGVDITDGSNEIMLFSSQGRVVRFSETAVRAM-GRLATGVR 721

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI LA                                   + + E+++    + +++ NI
Sbjct: 722 GIKLA-------------------------LTNDLSDDESAVEIEDVSDDNAEETLDLNI 756

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
            +     +      ILT ++ G+GKRT   ++   +R+ KG+ +  VS+ N  G +VA  
Sbjct: 757 DKVVSLVVPKNNGEILTATQNGYGKRTKLEEYPTKSRNTKGVISIKVSERN--GKVVAAT 814

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V D DQI+L++D GTL+R  V+E+ I  R T+GV +  T++DE VVS+ERI + +  + 
Sbjct: 815 QVIDTDQIMLITDAGTLVRTRVSEVSIIGRNTQGVRLIRTSEDEHVVSLERICDVDDEEG 874

Query: 906 AEST 909
            + +
Sbjct: 875 EQES 878


>gi|126729838|ref|ZP_01745651.1| DNA gyrase subunit A [Sagittula stellata E-37]
 gi|126709957|gb|EBA09010.1| DNA gyrase subunit A [Sagittula stellata E-37]
          Length = 911

 Score =  940 bits (2430), Expect = 0.0,   Method: Composition-based stats.
 Identities = 474/895 (52%), Positives = 636/895 (71%), Gaps = 11/895 (1%)

Query: 18  SVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARI 77
           S+SI +EM++SYL YA++VI+ RAIPDLRDGLKPVHRRILF M + G   +K Y K A+ 
Sbjct: 22  SISIENEMKSSYLDYAMSVIVSRAIPDLRDGLKPVHRRILFAMHEGGYTPDKSYRKSAKS 81

Query: 78  SGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQK 137
            GEVMG YHPHG++AIYDAL RMAQD+S+ L LI+GQGNFGS+DGDPPAA RYTE RL K
Sbjct: 82  VGEVMGNYHPHGDSAIYDALVRMAQDFSMSLPLIDGQGNFGSMDGDPPAAMRYTESRLAK 141

Query: 138 AAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGE 197
           +A  LL D+ KDTVDF+ NYDG  +EP VL AR+PNVLVNG  GIAVGMAT IP HNLGE
Sbjct: 142 SALQLLSDIDKDTVDFQDNYDGKEREPTVLPARFPNVLVNGAEGIAVGMATRIPPHNLGE 201

Query: 198 VVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIE 257
           V+D  +A++DNPD+  + LME ++GPDFPTG ++LGR+G + AY  GRGS++IR  + +E
Sbjct: 202 VIDATLALMDNPDLSSEDLMEWVKGPDFPTGGLMLGRSGARKAYLEGRGSVIIRAATTVE 261

Query: 258 KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRG 317
           +   DR  IV++ IPYQVNKA M+E+IAE  R+K+I  IA ++DESDR G RVV+ELKR 
Sbjct: 262 EIRKDRYAIVISAIPYQVNKATMIERIAEAARDKKIEGIAHVQDESDRDGVRVVVELKRD 321

Query: 318 ASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLL 377
           A+A+V+LNQLYR+T +Q+ F  NM+ALNG KPE+ TL G L AF+ FRE+V+ RRT YLL
Sbjct: 322 ATAEVVLNQLYRFTPMQTSFGCNMLALNGGKPEQLTLRGFLSAFLDFREDVIARRTAYLL 381

Query: 378 NKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDS 437
            KAR+R+HVL GLA+AV+N+DEVV  IR S +   AR+ LM+R W A DI   I LIDD 
Sbjct: 382 RKARERSHVLCGLAVAVSNVDEVVATIRSSADAPEARQRLMERRWPAQDILPYIALIDDP 441

Query: 438 SYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRL 497
           ++    DGT  LSE Q RAIL+LRL RLT +G  ++ +EL  L  +IK+ L+ILSSR R+
Sbjct: 442 THKANEDGTYNLSETQARAILDLRLQRLTQIGVKEVTDELEDLAAKIKDYLEILSSRERI 501

Query: 498 LGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYR 557
           +GII++E+ ++++E   PRRT IV+   DM+DED I REDMVVTV+  GY+KR  L+ +R
Sbjct: 502 MGIIREEMTAIREEFAVPRRTEIVDWAGDMDDEDLIEREDMVVTVTAGGYIKRTALADFR 561

Query: 558 AQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKA 617
           AQ+RGGKG SG  ++++D VT LF+ +THT +LFF++ G VYK K WRLP+G   ++GKA
Sbjct: 562 AQKRGGKGLSGGGLKEDDVVTTLFVANTHTQLLFFTTDGMVYKLKTWRLPLGGRTSKGKA 621

Query: 618 LINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMK 677
           ++NIL +  G  I  IMP   DE  W++L +VFAT  G+VRRN+LSDF  + R+GKIAMK
Sbjct: 622 IVNILPIPTGVSIAAIMPVDRDEDEWDDLQIVFATSKGSVRRNRLSDFTNVMRNGKIAMK 681

Query: 678 LDSRDEI---LSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQ 734
            +  DE    ++   C++E+D++L T  G+ +RFP+  +RVF  RNS GVRGI L  GD+
Sbjct: 682 FEGEDENTRLINARICSEEDDVMLVTNSGRAIRFPVPEVRVFNSRNSTGVRGIRLKNGDE 741

Query: 735 VISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELK 794
           V+SM+++ H +A+ DER  Y+K      R +     E      D + +  + +ER  E+ 
Sbjct: 742 VVSMSVIRHFEAESDERASYLKM-----RRLMAGVTEDEGSDEDGNADAPLEQERYAEMS 796

Query: 795 LKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQII 854
             E  ILT++ +G GK +SS+D+ +  R G+G+ A + S     G +VA FPV   DQI+
Sbjct: 797 AAENLILTITARGLGKLSSSHDYPVRGRGGQGVTAWEKSMR--GGDIVASFPVEQGDQIM 854

Query: 855 LVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAEST 909
           L +  G  IRVPV+ I   SR+  GV +F+T  +E VVSV  I +    +E E++
Sbjct: 855 LATSTGQSIRVPVDGISFRSRSAGGVRVFNTGAEETVVSVAWIADQ-ADEEPEAS 908


>gi|317492550|ref|ZP_07950977.1| DNA gyrase, subunit A [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919300|gb|EFV40632.1| DNA gyrase, subunit A [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 882

 Score =  940 bits (2430), Expect = 0.0,   Method: Composition-based stats.
 Identities = 415/905 (45%), Positives = 575/905 (63%), Gaps = 68/905 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E++NSYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKNSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNVLGNDWNKAYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           ARI G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARIVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL K+TVDF PNYDG+ Q P VL  + PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKETVDFVPNYDGTEQIPAVLPTKVPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV++GC+A ID+ +I ++ LM+ I GPDFPT A+I GR GI+ AY TGRG + IR  +
Sbjct: 187 LNEVINGCLAYIDDENITVEGLMQHIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRAKA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADEKSGRETIIVHEIPYQVNKARLIEKIAELVKEKRLEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T +Q  F +NMVAL+  +P+  TL   L+AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNHLYSLTQMQVTFGINMVALHQGQPKLLTLKDCLQAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L GLAIA++N+D ++ +IR +PNP  A+  L+ R W    +  +++ 
Sbjct: 367 IFELRKARDRAHILEGLAIALSNIDPIIELIRHAPNPAEAKALLVARGWALGTVAAMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D++             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L  +I 
Sbjct: 427 AGDNAARPEWLEPQFGIRDGHYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLEQIA 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
             + IL S  RL+ +I++EL++V+D+    RRT I E   D+  ED I +ED+VVT+SH 
Sbjct: 487 ALIFILESPDRLMEVIREELIAVRDQFGDARRTEITENTADINIEDLISQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PL+ Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ +IN+L L   ERIT I+P  E E      +V  AT  G V++  L+DF
Sbjct: 607 LPEASRGARGRPIINLLPLEANERITAILPVREYE---EGRHVFMATASGTVKKTALTDF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L +  G+ VRFP S +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGSNEVMLFSAAGKVVRFPESQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+V+S+ I                                             
Sbjct: 723 GINLNGEDRVVSLIIPRGEGD--------------------------------------- 743

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                         ILTV+E G+GKRT   ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 744 --------------ILTVTENGYGKRTGVAEYPTKSRATQGVISIKVSERN--GNVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V+  DQI++++D GTL+R  V+E+ +  R T+GV +  TA+DE VV ++R+ E E  DE
Sbjct: 788 QVDACDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDE 847

Query: 906 AESTE 910
               E
Sbjct: 848 VLDGE 852



 Score = 72.5 bits (176), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 66/430 (15%), Positives = 146/430 (33%), Gaps = 38/430 (8%)

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFS-----PNPETARRELMQRSWNASDIK 428
           + LL++ ++    +  L   + + D ++ +IR            ARR  +  +    +I+
Sbjct: 472 EKLLDEYKELLEQIAALIFILESPDRLMEVIREELIAVRDQFGDARRTEITENTADINIE 531

Query: 429 DLIDLIDDSSYTIGSDGTMY--LSEVQTRAILELRLARLTGLGRDDIRNELNSLGIE--- 483
           DLI   D            Y  L++ + +       +       D I   L +   +   
Sbjct: 532 DLISQEDVVVTLSHQGYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTIL 591

Query: 484 ------IKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVRED 537
                     + +        G   + ++++       R T I+      E         
Sbjct: 592 CFSSRGRLYWMKVYQLPEASRGARGRPIINLLPLEANERITAILPVREYEEGRH------ 645

Query: 538 MVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGF 597
            V   +  G VK+  L+ +   R  G     +   DE    DL        V+ FS+ G 
Sbjct: 646 -VFMATASGTVKKTALTDFSRPRSAGIIAVNLNEGDELIGVDL--TDGSNEVMLFSAAGK 702

Query: 598 VYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNV 657
           V +    ++      A G   +  ++LN  +R+ +++             ++  T++G  
Sbjct: 703 VVRFPESQVRSMGRTATG---VRGINLNGEDRVVSLI------IPRGEGDILTVTENGYG 753

Query: 658 RRNKLSDFIQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVRFPISAIR 714
           +R  ++++   +R+ +  + +   +     +        + I++ T  G  VR  +S + 
Sbjct: 754 KRTGVAEYPTKSRATQGVISIKVSERNGNVVGAVQVDACDQIMMITDAGTLVRTRVSEV- 812

Query: 715 VFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITS 774
              GRN+ GV  I  A+ + V+ +  V   + D +                  +      
Sbjct: 813 SVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDEVLDGEEGAAVEGDVADVAEDANDAP 872

Query: 775 LKNDSSVEGN 784
            +++   E  
Sbjct: 873 EQDEEGDENA 882


>gi|260752815|ref|YP_003225708.1| DNA gyrase subunit A [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258552178|gb|ACV75124.1| DNA gyrase, A subunit [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 925

 Score =  940 bits (2430), Expect = 0.0,   Method: Composition-based stats.
 Identities = 463/904 (51%), Positives = 626/904 (69%), Gaps = 21/904 (2%)

Query: 9   DEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWN 68
              +   I+ VSI DEM++SYL YA++VI+ RA+PD+RDGLKPVHRRILF   + G    
Sbjct: 35  PSTDTNDISPVSIIDEMKSSYLDYAMSVIVSRALPDVRDGLKPVHRRILFASQEGGFVPG 94

Query: 69  KKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAE 128
             Y K A+I GEVMG +HPHG++AIY ALAR+ QDWS+R+ LI+GQGNFGS+D D PAA 
Sbjct: 95  HPYRKSAKIVGEVMGNFHPHGDSAIYMALARLTQDWSMRVPLIDGQGNFGSMDPDGPAAM 154

Query: 129 RYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMAT 188
           RYTE RL  AA  LL D+ +DTVDF PNYDGS QEP VL AR+PN+LVNG GGIAVGMAT
Sbjct: 155 RYTEARLSPAAMMLLADIDRDTVDFSPNYDGSRQEPQVLPARFPNLLVNGAGGIAVGMAT 214

Query: 189 NIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSI 248
           NIP HNLGEV+  C A I +P I ++ L+ ++ GPDFPTG V+LG+ G ++AY  GRGSI
Sbjct: 215 NIPPHNLGEVLAACRAYIADPAISIEDLIHLVPGPDFPTGGVMLGQGGARSAYQNGRGSI 274

Query: 249 VIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +IR   +IE+  GDR  IV+TEIPYQ+ K+A++EKIAE  ++KR+  I+D+RDES+R+G 
Sbjct: 275 IIRSRYNIEEKHGDRRSIVLTEIPYQIGKSALVEKIAEAAKDKRVEGISDIRDESNREGV 334

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVI+LKR A+ DV+LNQL+R+T  QS F  NM+ALNG +PE  +L  I+ AFV FREEV
Sbjct: 335 RVVIDLKRDATPDVVLNQLWRHTPAQSSFPANMLALNGGRPETMSLKDIIAAFVQFREEV 394

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           + RR+KY L KAR+RAH+L+G+ IAV NLDEVVRIIR +P+P  A  EL  R W  +D+ 
Sbjct: 395 ITRRSKYDLFKARERAHLLLGMVIAVTNLDEVVRIIRNAPSPAEAHSELSARKWPVNDVL 454

Query: 429 DLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECL 488
             I LI ++       G   LS+ Q  AIL LRL+RLT +GRD I  EL  L I I E L
Sbjct: 455 PYIKLI-EAVEDFEESGLYTLSKAQVDAILALRLSRLTAMGRDQIGEELKKLAISISELL 513

Query: 489 DILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYV 548
           ++L +R RL  I+ +E  +V+ +  TPRRT+IV     +EDED I RE+MVVTV+H GY+
Sbjct: 514 EVLRNRERLYEIMVEEFDAVEAQFATPRRTQIVAASDAIEDEDLIEREEMVVTVTHGGYI 573

Query: 549 KRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPI 608
           KR PL  +R Q RGGKGRSG+  +DED VT+LF+  THT VLFFS+ G VY+ KVWRLP 
Sbjct: 574 KRTPLDTFRTQNRGGKGRSGMATKDEDAVTNLFVTCTHTPVLFFSNHGKVYRLKVWRLPE 633

Query: 609 GSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQI 668
           G+PQARG+ ++N+L L +GE ++T++P PEDE+ W NL+V+FAT  G+VRRN +  F  +
Sbjct: 634 GAPQARGRPMVNLLPLAEGEVVSTVLPLPEDEAEWGNLHVLFATAKGSVRRNSMDAFTNV 693

Query: 669 NRSGKIAMKLDSR--DEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRG 726
             +GK A++ +    D ++ V   ++ +D+LL T+ G+ +RF  + +RVF  R S GVRG
Sbjct: 694 PSNGKFAIRFEEGDNDRLIGVTLLSENDDVLLATRNGKAIRFAATDVRVFQSRTSTGVRG 753

Query: 727 ISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNIS 786
           I+L  GD+VIS++ +   +   ++R  Y++  + +                       + 
Sbjct: 754 ITLKDGDEVISLSTLRGFETTVEDRDKYLRSAAWK----------------TDPAPAELP 797

Query: 787 EERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFP 846
            E+ +  +  E FILTV+  G+GKRTSS+++R SNR G+GI   + S+ N  G++VA FP
Sbjct: 798 PEKIKAFEEAEDFILTVTANGYGKRTSSHEYRRSNRGGQGITNIETSERN--GSVVASFP 855

Query: 847 VNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEA 906
            +D DQ++LV+D+  LIR  VN+IRIA R T+GV IF+ A+ E+VVS  RI +    +E 
Sbjct: 856 AHDGDQLMLVTDQAKLIRTTVNDIRIAGRNTQGVTIFNVAEGEQVVSAARITDDGDDEEE 915

Query: 907 ESTE 910
            + E
Sbjct: 916 GTVE 919



 Score = 63.7 bits (153), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 45/256 (17%), Positives = 98/256 (38%), Gaps = 37/256 (14%)

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           V+  +  G V+R  +  +      GK        D D +  + ++S +  VL  +  G  
Sbjct: 673 VLFATAKGSVRRNSMDAFTNVPSNGKFAIRFEEGDNDRLIGVTLLSENDDVLLATRNGKA 732

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNL------------ 646
            +     +     Q+R    +  ++L  G+ + ++      E++  +             
Sbjct: 733 IRFAATDVR--VFQSRTSTGVRGITLKDGDEVISLSTLRGFETTVEDRDKYLRSAAWKTD 790

Query: 647 -------------------YVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSV 687
                              +++  T +G  +R    ++ + NR G+    +++ +   SV
Sbjct: 791 PAPAELPPEKIKAFEEAEDFILTVTANGYGKRTSSHEYRRSNRGGQGITNIETSERNGSV 850

Query: 688 ---ETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHA 744
                    + ++L T   + +R  ++ IR  AGRN+ GV   ++A+G+QV+S A +   
Sbjct: 851 VASFPAHDGDQLMLVTDQAKLIRTTVNDIR-IAGRNTQGVTIFNVAEGEQVVSAARITDD 909

Query: 745 DADYDERICYMKHMSA 760
             D +E     +   A
Sbjct: 910 GDDEEEGTVENQSGEA 925


>gi|170025070|ref|YP_001721575.1| DNA gyrase subunit A [Yersinia pseudotuberculosis YPIII]
 gi|169751604|gb|ACA69122.1| DNA gyrase, A subunit [Yersinia pseudotuberculosis YPIII]
          Length = 897

 Score =  940 bits (2430), Expect = 0.0,   Method: Composition-based stats.
 Identities = 409/900 (45%), Positives = 570/900 (63%), Gaps = 68/900 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL KDTVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKDTVDFVPNYDGTEQIPAVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A I++ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG + IR  +
Sbjct: 187 LSEVIDGCLAYIEDENISIEGLMEYIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVALSQGQPKLLNLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +  P  A+  L+   W   ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRRASTPAEAKAGLIASPWELGNVASMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGDDAARPEWLEAEFGIRDGKYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTLIG 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + IL +  RL+ +I++EL+++K++ +  RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELIFILENPDRLMEVIREELVAIKEQYNDLRRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PLS Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      +V  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYEEGC---HVFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L + LG+ VRFP   +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGSNEVMLFSALGKVVRFPEGQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+VIS+ I                                             
Sbjct: 723 GINLNGDDRVISLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV+E G+GKRT+  ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 738 --------PRGDGEILTVTENGYGKRTAVAEYPTKSRATQGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V   DQI++++D GTL+R  V+E+ +  R T+GV +  TA+DE VV ++R+ E E  D+
Sbjct: 788 QVAPTDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDD 847



 Score = 72.5 bits (176), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 63/448 (14%), Positives = 143/448 (31%), Gaps = 38/448 (8%)

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
            L K     H    L      L  +  +I    NP+     + +      +  + +   +
Sbjct: 462 RLQKLTGLEHE-KLLDEYKELLTLIGELIFILENPDRLMEVIREELVAIKEQYNDLRRTE 520

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTG---LGRDDIRNELNSLGIEIKECLDI-- 490
            ++ T   +    +++      L  +               R         IKE   I  
Sbjct: 521 ITANTSDINIEDLINQEDVVVTLSHQGYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDR 580

Query: 491 ---LSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTV----- 542
               ++   +L    +  L        P  +R   G   +        E +   +     
Sbjct: 581 LLVANTHDTILCFSSRGRLYWMKVYQLPEASRGARGRPIVNLLPLEPNERITAILPVREY 640

Query: 543 ---------SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
                    +  G VK+  L+ +   R  G     +   DE    DL        V+ FS
Sbjct: 641 EEGCHVFMATASGTVKKTALTEFSRPRSAGIIAVNLNEGDELIGVDL--TDGSNEVMLFS 698

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           +LG V +    ++      A G   +  ++LN  +R+ +++          +  ++  T+
Sbjct: 699 ALGKVVRFPEGQVRSMGRTATG---VRGINLNGDDRVISLI------IPRGDGEILTVTE 749

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLD---SRDEILSVETCTQENDILLTTKLGQCVRFPI 710
           +G  +R  ++++   +R+ +  + +       +++        + I++ T  G  VR  +
Sbjct: 750 NGYGKRTAVAEYPTKSRATQGVISIKVSERNGKVVGAVQVAPTDQIMMITDAGTLVRTRV 809

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTE 770
           S +    GRN+ GV  I  A+ + V+ +  V   + D D                +    
Sbjct: 810 SEV-SVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDDILDGESSEGEEGSEENAALNA 868

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQ 798
               + ++ +   + ++         + 
Sbjct: 869 PSDDVADEDTDAEDDTDAEDDTDVEDDN 896


>gi|22126849|ref|NP_670272.1| DNA gyrase subunit A [Yersinia pestis KIM 10]
 gi|45440760|ref|NP_992299.1| DNA gyrase subunit A [Yersinia pestis biovar Microtus str. 91001]
 gi|108806927|ref|YP_650843.1| DNA gyrase subunit A [Yersinia pestis Antiqua]
 gi|108812921|ref|YP_648688.1| DNA gyrase subunit A [Yersinia pestis Nepal516]
 gi|145599746|ref|YP_001163822.1| DNA gyrase subunit A [Yersinia pestis Pestoides F]
 gi|149366793|ref|ZP_01888827.1| DNA gyrase subunit A [Yersinia pestis CA88-4125]
 gi|165924567|ref|ZP_02220399.1| DNA gyrase, A subunit [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165938316|ref|ZP_02226874.1| DNA gyrase, A subunit [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166009847|ref|ZP_02230745.1| DNA gyrase, A subunit [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211545|ref|ZP_02237580.1| DNA gyrase, A subunit [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167400296|ref|ZP_02305809.1| DNA gyrase, A subunit [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419713|ref|ZP_02311466.1| DNA gyrase, A subunit [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167424281|ref|ZP_02316034.1| DNA gyrase, A subunit [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|218928375|ref|YP_002346250.1| DNA gyrase subunit A [Yersinia pestis CO92]
 gi|229841160|ref|ZP_04461319.1| DNA gyrase subunit A [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229843265|ref|ZP_04463411.1| DNA gyrase subunit A [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229894119|ref|ZP_04509305.1| DNA gyrase subunit A [Yersinia pestis Pestoides A]
 gi|229903351|ref|ZP_04518464.1| DNA gyrase subunit A [Yersinia pestis Nepal516]
 gi|270487161|ref|ZP_06204235.1| DNA gyrase, A subunit [Yersinia pestis KIM D27]
 gi|294503230|ref|YP_003567292.1| DNA gyrase subunit A [Yersinia pestis Z176003]
 gi|21959880|gb|AAM86523.1|AE013898_6 DNA gyrase, subunit A, type II topoisomerase [Yersinia pestis KIM
           10]
 gi|45435618|gb|AAS61176.1| DNA gyrase subunit A [Yersinia pestis biovar Microtus str. 91001]
 gi|108776569|gb|ABG19088.1| DNA gyrase subunit A [Yersinia pestis Nepal516]
 gi|108778840|gb|ABG12898.1| DNA gyrase subunit A [Yersinia pestis Antiqua]
 gi|115346986|emb|CAL19877.1| DNA gyrase subunit A [Yersinia pestis CO92]
 gi|145211442|gb|ABP40849.1| DNA gyrase subunit A [Yersinia pestis Pestoides F]
 gi|149291167|gb|EDM41242.1| DNA gyrase subunit A [Yersinia pestis CA88-4125]
 gi|165913694|gb|EDR32313.1| DNA gyrase, A subunit [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165923627|gb|EDR40759.1| DNA gyrase, A subunit [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165991243|gb|EDR43544.1| DNA gyrase, A subunit [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207316|gb|EDR51796.1| DNA gyrase, A subunit [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962454|gb|EDR58475.1| DNA gyrase, A subunit [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167050245|gb|EDR61653.1| DNA gyrase, A subunit [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167057130|gb|EDR66893.1| DNA gyrase, A subunit [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229679121|gb|EEO75224.1| DNA gyrase subunit A [Yersinia pestis Nepal516]
 gi|229689612|gb|EEO81673.1| DNA gyrase subunit A [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229697526|gb|EEO87573.1| DNA gyrase subunit A [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229704004|gb|EEO91017.1| DNA gyrase subunit A [Yersinia pestis Pestoides A]
 gi|262361269|gb|ACY57990.1| DNA gyrase subunit A [Yersinia pestis D106004]
 gi|262365194|gb|ACY61751.1| DNA gyrase subunit A [Yersinia pestis D182038]
 gi|270335665|gb|EFA46442.1| DNA gyrase, A subunit [Yersinia pestis KIM D27]
 gi|294353689|gb|ADE64030.1| DNA gyrase subunit A [Yersinia pestis Z176003]
 gi|320015942|gb|ADV99513.1| DNA gyrase subunit A [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 891

 Score =  940 bits (2430), Expect = 0.0,   Method: Composition-based stats.
 Identities = 409/900 (45%), Positives = 570/900 (63%), Gaps = 68/900 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL KDTVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKDTVDFVPNYDGTEQIPAVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A I++ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG + IR  +
Sbjct: 187 LSEVIDGCLAYIEDENISIEGLMEYIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVALSQGQPKLLNLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +  P  A+  L+   W   ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRRASTPAEAKAGLIASPWELGNVASMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGDDAARPEWLEAEFGIRDGKYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTLIG 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + IL +  RL+ +I++EL+++K++ +  RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELIFILENPDRLMEVIREELVAIKEQYNDLRRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PLS Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      +V  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYEEGC---HVFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L + LG+ VRFP   +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGSNEVMLFSALGKVVRFPEGQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+VIS+ I                                             
Sbjct: 723 GINLNGDDRVISLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV+E G+GKRT+  ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 738 --------PRGDGEILTVTENGYGKRTAVAEYPTKSRATQGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V   DQI++++D GTL+R  V+E+ +  R T+GV +  TA+DE VV ++R+ E E  D+
Sbjct: 788 QVAPTDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDD 847


>gi|238797460|ref|ZP_04640959.1| DNA gyrase subunit A [Yersinia mollaretii ATCC 43969]
 gi|238718731|gb|EEQ10548.1| DNA gyrase subunit A [Yersinia mollaretii ATCC 43969]
          Length = 892

 Score =  940 bits (2429), Expect = 0.0,   Method: Composition-based stats.
 Identities = 405/900 (45%), Positives = 569/900 (63%), Gaps = 68/900 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL KDTVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKDTVDFVPNYDGTEQIPAVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A I++ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG + IR   
Sbjct: 187 LSEVIDGCLAYIEDENISIEGLMEYIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARG 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I++ EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIIHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVALSQGQPKLLNLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +  P  A+  L+   W   ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRRAATPAEAKAGLIASPWELGNVAAMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
               +             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGGDAARPEWLEAEFGIRDGKYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTAIA 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + IL +  RL+ +I++EL+++K++ +  RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELIFILENPERLMEVIREELVAIKEQYNDARRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PL+ Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      ++  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYE---EGRHIFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L + LG+ VRFP + +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGSNEVMLFSALGKVVRFPETQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+VIS+ I                                             
Sbjct: 723 GINLNGDDRVISLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV+E G+GKRT+  ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 738 --------PRGDGEILTVTENGYGKRTAVEEYPTKSRATQGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V   DQI++++D GTL+R  V+E+ +  R T+GV +  TA+DE VV ++R+ E E  D+
Sbjct: 788 QVAPTDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDD 847


>gi|226940755|ref|YP_002795829.1| DNA gyrase subunit A [Laribacter hongkongensis HLHK9]
 gi|226715682|gb|ACO74820.1| GyrA [Laribacter hongkongensis HLHK9]
          Length = 859

 Score =  940 bits (2429), Expect = 0.0,   Method: Composition-based stats.
 Identities = 399/918 (43%), Positives = 559/918 (60%), Gaps = 73/918 (7%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT+H+ + +         VS+ +EM+ SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M
Sbjct: 1   MTDHLFAKET------IPVSLEEEMRRSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAM 54

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            ++  +WN+ Y K AR+ G+V+GKYHPHG+ A+YD + RMAQD+SLR  L++GQGNFGS+
Sbjct: 55  HELSNDWNRPYKKSARVVGDVIGKYHPHGDTAVYDTIVRMAQDFSLRYPLVDGQGNFGSI 114

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGD  AA RYTE R+ K AH LL D+ K+TVDF PNYDGS  EP+VL A+ PN+L+NG  
Sbjct: 115 DGDNAAAMRYTEIRMAKIAHELLADIEKETVDFGPNYDGSEHEPLVLPAKIPNLLINGSS 174

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNL EVVD  +A++ N D+ +D L++II  PDFPT  +I G  G++  
Sbjct: 175 GIAVGMATNIPPHNLNEVVDALLALLANSDMTIDELIDIIPAPDFPTAGIIYGLAGVREG 234

Query: 241 YATGRGSIVIRGVSHIEKTSGD-REQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           Y +GRG +VIR  +H+E      R+ +++ E+PYQVNKA +L KI ELVREK I  I+DL
Sbjct: 235 YRSGRGRVVIRARTHVEDIGRGDRQALIIDELPYQVNKANLLIKIGELVREKAIDGISDL 294

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDESD+ G RVVIELKRG   DV+LN LY+ T LQ  F +NMVAL   +P    L  IL+
Sbjct: 295 RDESDKSGMRVVIELKRGEVPDVVLNNLYKQTQLQDSFGMNMVALVDGQPRLLNLKQILE 354

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
            F+  R EVV RRT + L KAR+R HVL GLA+A++N+DE++ +I+ +P P  A+ ELM 
Sbjct: 355 EFLRHRREVVTRRTIFELRKARERGHVLEGLAVALSNVDEIIALIKAAPTPPVAKAELMA 414

Query: 420 RSWNASDIKDLIDLIDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRD 471
           R W +  +++++  ++                     LSE Q +AILELRL RLTGL +D
Sbjct: 415 RQWRSPLVEEMLARVELDKARPDGLLPEFGLQANGYRLSETQAQAILELRLQRLTGLEQD 474

Query: 472 DIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDED 531
            I  E   +   I + LDIL+   R+  II  EL  +K +    RR+ I     D+  ED
Sbjct: 475 KIVAEYRDVMDTIMDLLDILARPERVSQIIADELNQIKTQFGDTRRSEIEPFGGDINLED 534

Query: 532 CIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLF 591
            I  +DMVVT+SH GY+K  P++ Y+AQRRGG+G+     +DEDF+ +LF+ +TH  +L 
Sbjct: 535 LITPQDMVVTLSHTGYMKTQPVTDYQAQRRGGRGKQAAATKDEDFIENLFVANTHDFLLC 594

Query: 592 FSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFA 651
           FSS G +Y  KV+ LP GS Q+RGK ++N+L L +GE+I  I+P        +  YV  A
Sbjct: 595 FSSAGRMYWLKVYELPQGSRQSRGKPIVNLLPLVEGEKINAILPVKGFS---DTEYVFMA 651

Query: 652 TKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPIS 711
           T  G V++  LS F     +G IA+ LD  D ++     +  ++++L +  G+ VRF  +
Sbjct: 652 TARGTVKKTPLSAFSNRRSAGIIAVDLDEGDYLIGAAVTSGNSEVMLFSDAGKAVRFDEA 711

Query: 712 AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEE 771
            +R   GRN+ GVRG+ L    QVI M +                               
Sbjct: 712 DVRPM-GRNARGVRGMELGDAQQVIGMLV------------------------------- 739

Query: 772 ITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATD 831
                                   +   +LT +  G+GKRT   D+R S R  +G+ A D
Sbjct: 740 ---------------------SNEETSQVLTATANGYGKRTPIGDYRKSRRGTQGVIAID 778

Query: 832 VSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERV 891
             + N  GALVAV  V D+D+++L++  G LIR  V+E+R   RA +GV + +    E++
Sbjct: 779 TGERN--GALVAVALVADSDELMLMTTGGVLIRTRVSEVRETGRAAQGVRLINLDAGEQL 836

Query: 892 VSVERIRESEIVDEAEST 909
           VS+E+I ES+  D+ + T
Sbjct: 837 VSLEKIAESDEPDDTDET 854


>gi|56551588|ref|YP_162427.1| DNA gyrase subunit A [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56543162|gb|AAV89316.1| DNA gyrase, A subunit [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 925

 Score =  940 bits (2429), Expect = 0.0,   Method: Composition-based stats.
 Identities = 464/904 (51%), Positives = 626/904 (69%), Gaps = 21/904 (2%)

Query: 9   DEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWN 68
              +   I+ VSI DEM++SYL YA++VI+ RA+PD+RDGLKPVHRRILF   + G    
Sbjct: 35  PSTDTNDISPVSIIDEMKSSYLDYAMSVIVSRALPDVRDGLKPVHRRILFASQEGGFVPG 94

Query: 69  KKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAE 128
             Y K A+I GEVMG +HPHG++AIY ALAR+ QDWS+R+ LI+GQGNFGS+D D PAA 
Sbjct: 95  HPYRKSAKIVGEVMGNFHPHGDSAIYMALARLTQDWSMRVPLIDGQGNFGSMDPDGPAAM 154

Query: 129 RYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMAT 188
           RYTE RL  AA  LL D+ +DTVDF PNYDGS QEP VL AR+PN+LVNG GGIAVGMAT
Sbjct: 155 RYTEARLSPAAMMLLADIDRDTVDFSPNYDGSRQEPQVLPARFPNLLVNGAGGIAVGMAT 214

Query: 189 NIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSI 248
           NIP HNLGEV+  C A I +P I ++ L+ ++ GPDFPTG V+LG+ G ++AY  GRGSI
Sbjct: 215 NIPPHNLGEVLTACRAYIADPAISIEDLIRLVPGPDFPTGGVMLGQGGARSAYQNGRGSI 274

Query: 249 VIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +IR   +IE+  GDR  IV+TEIPYQ+ K+A++EKIAE  ++KR+  I+D+RDES+R+G 
Sbjct: 275 IIRSRYNIEEKHGDRRSIVLTEIPYQIGKSALVEKIAEAAKDKRVEGISDIRDESNREGV 334

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVI+LKR A+ DV+LNQL+R+T  QS F  NM+ALNG +PE  +L  I+ AFV FREEV
Sbjct: 335 RVVIDLKRDATPDVVLNQLWRHTPAQSSFPANMLALNGGRPETMSLKDIIAAFVQFREEV 394

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           + RR+KY L KAR+RAH+L+G+ IAV NLDEVVRIIR +P+P  A  EL  R W  +D+ 
Sbjct: 395 ITRRSKYDLFKARERAHLLLGMVIAVTNLDEVVRIIRNAPSPAEAHSELSARKWPVNDVL 454

Query: 429 DLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECL 488
             I LI ++       G   LS+ Q  AIL LRL+RLT +GRD I  EL  L I I E L
Sbjct: 455 PYIKLI-EAVEDFEESGLYTLSKAQVDAILALRLSRLTAMGRDQIGEELKKLAISISELL 513

Query: 489 DILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYV 548
           ++L +R RL  I+ +E  +V+ +  TPRRT+IV     +EDED I RE+MVVTV+H GY+
Sbjct: 514 EVLRNRERLYEIMVEEFDAVEAQFATPRRTQIVAASDAIEDEDLIEREEMVVTVTHGGYI 573

Query: 549 KRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPI 608
           KR PL  +R Q RGGKGRSG+  +DED VT+LF+  THT VLFFS+ G VY+ KVWRLP 
Sbjct: 574 KRTPLDTFRTQNRGGKGRSGMATKDEDAVTNLFVTCTHTPVLFFSNHGKVYRLKVWRLPE 633

Query: 609 GSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQI 668
           G+PQARG+ ++N+L L +GE ++T++P PEDE+ W NL+V+FAT  G+VRRN +  F  +
Sbjct: 634 GAPQARGRPMVNLLPLAEGEVVSTVLPLPEDEAEWGNLHVLFATAKGSVRRNSMDAFTNV 693

Query: 669 NRSGKIAMKLDSR--DEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRG 726
             +GK A++ D    D ++ V   ++ +D+LL T+ G+ +RF  + +RVF  R S GVRG
Sbjct: 694 PSNGKFAIRFDEGDDDRLIGVTLLSENDDVLLATRNGKAIRFAATDVRVFQSRTSTGVRG 753

Query: 727 ISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNIS 786
           I+L  GD+VIS++ +   +   ++R  Y++  + +                       + 
Sbjct: 754 ITLKDGDEVISLSTLRGFETTVEDRDKYLRSAAWK----------------TDPAPAELP 797

Query: 787 EERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFP 846
            E+ +  +  E FILTV+  G+GKRTSS+++R SNR G+GI   + S+ N  G++VA FP
Sbjct: 798 PEKIKAFEEAEDFILTVTANGYGKRTSSHEYRRSNRGGQGITNIETSERN--GSVVASFP 855

Query: 847 VNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEA 906
            +D DQ++LV+D+  LIR  VN+IRIA R T+GV IF+ A+ E+VVS  RI +    +E 
Sbjct: 856 AHDGDQLMLVTDQAKLIRTTVNDIRIAGRNTQGVTIFNVAEGEQVVSAARITDDGDDEEE 915

Query: 907 ESTE 910
            + E
Sbjct: 916 GTVE 919



 Score = 64.8 bits (156), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 45/256 (17%), Positives = 99/256 (38%), Gaps = 37/256 (14%)

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           V+  +  G V+R  +  +      GK        D+D +  + ++S +  VL  +  G  
Sbjct: 673 VLFATAKGSVRRNSMDAFTNVPSNGKFAIRFDEGDDDRLIGVTLLSENDDVLLATRNGKA 732

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNL------------ 646
            +     +     Q+R    +  ++L  G+ + ++      E++  +             
Sbjct: 733 IRFAATDVR--VFQSRTSTGVRGITLKDGDEVISLSTLRGFETTVEDRDKYLRSAAWKTD 790

Query: 647 -------------------YVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSV 687
                              +++  T +G  +R    ++ + NR G+    +++ +   SV
Sbjct: 791 PAPAELPPEKIKAFEEAEDFILTVTANGYGKRTSSHEYRRSNRGGQGITNIETSERNGSV 850

Query: 688 ---ETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHA 744
                    + ++L T   + +R  ++ IR  AGRN+ GV   ++A+G+QV+S A +   
Sbjct: 851 VASFPAHDGDQLMLVTDQAKLIRTTVNDIR-IAGRNTQGVTIFNVAEGEQVVSAARITDD 909

Query: 745 DADYDERICYMKHMSA 760
             D +E     +   A
Sbjct: 910 GDDEEEGTVENQSGEA 925


>gi|332162346|ref|YP_004298923.1| DNA gyrase subunit A [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|325666576|gb|ADZ43220.1| DNA gyrase subunit A [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 885

 Score =  940 bits (2429), Expect = 0.0,   Method: Composition-based stats.
 Identities = 405/900 (45%), Positives = 567/900 (63%), Gaps = 68/900 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL KDTVDF PNYDG+ Q P V+  + PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKDTVDFVPNYDGTEQIPAVMPTKIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A I++ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG + IR  +
Sbjct: 187 LSEVIDGCLAYIEDENITIEGLMEYIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVALSQGQPKLLNLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +  P  A+  L+   W   ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRRAATPAEAKAGLIASPWELGNVAAMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
               +             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGGDAARPEWLEAEFGIRDGKYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTVIA 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + IL +  RL+ +I++EL+++K+  +  RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELIFILENPERLMEVIREELVAIKELYNDARRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PLS Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      ++  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYE---EGRHIFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L + LG+ VRFP S +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGTNEVMLFSALGKVVRFPESQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+VIS+ I                                             
Sbjct: 723 GINLNGDDRVISLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV+E G+GKRT+  ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 738 --------PRGDGEILTVTENGYGKRTAVEEYPTKSRATQGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V   DQI++++D GTL+R  V+E+ +  R T+GV +  T +DE VV ++R+ E E  D 
Sbjct: 788 QVAPTDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTTEDEHVVGLQRVAEPEEDDN 847


>gi|332111969|gb|EGJ11946.1| DNA gyrase subunit A [Rubrivivax benzoatilyticus JA2]
          Length = 894

 Score =  940 bits (2429), Expect = 0.0,   Method: Composition-based stats.
 Identities = 390/921 (42%), Positives = 553/921 (60%), Gaps = 65/921 (7%)

Query: 11  EEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKK 70
           +  K    +S+ +EM+ SYL YA++VI+GRA+PD RDGLKPVHRR+L+ M ++   WN+ 
Sbjct: 3   QFAKETLPISLEEEMRRSYLDYAMSVIVGRALPDARDGLKPVHRRVLYAMHELSNHWNRP 62

Query: 71  YVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERY 130
           Y K ARI G+V+GKYHPHG+ A+YD + RMAQD+SLR +L++GQGNFGSVDGD  AA RY
Sbjct: 63  YKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQDFSLRHMLVDGQGNFGSVDGDSAAAMRY 122

Query: 131 TECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNI 190
           TE RL K AH +L+D+ K+TVDF PNYDGS +EP VL AR PN+LVNG  GIAVGMATNI
Sbjct: 123 TEIRLAKIAHEMLEDIDKETVDFAPNYDGSEKEPTVLPARLPNLLVNGSAGIAVGMATNI 182

Query: 191 PTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVI 250
           P HNL E+VD C+ ++  P+  ++ LMEI+  PDFPT  +I G  G++  Y TGRG +V+
Sbjct: 183 PPHNLNEIVDACLHLLKVPEATIEELMEIVPAPDFPTAGIIYGLEGVREGYRTGRGRVVM 242

Query: 251 RGVSHIEKTSGDR-EQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYR 309
           R   H E     + + I+V EIPYQVNK  +LE+IAELV EK+I  I+ ++DESD+ G R
Sbjct: 243 RAKCHFEDIDRGQRQAIIVDEIPYQVNKKTLLERIAELVNEKKIEGISHIQDESDKSGMR 302

Query: 310 VVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVV 369
           VVIELKRG   +V+LN LY+ T LQ  F +NMVAL   +P    L  +L  F+  R EVV
Sbjct: 303 VVIELKRGEVPEVVLNNLYKQTQLQDSFGINMVALVDGQPRLCNLKQLLDIFLEHRREVV 362

Query: 370 VRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKD 429
            RRT Y L KAR+R HVL GLA+A+AN+DE +  I+ SP P  A+  LM ++W++S +++
Sbjct: 363 TRRTVYELRKARERGHVLEGLAVALANIDEFIETIKTSPTPPVAKAALMSKAWDSSMVRE 422

Query: 430 LIDLIDDS---------------SYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIR 474
           ++   ++S                Y + +DG   LSE Q + IL++RL RLTGL +D I 
Sbjct: 423 MLARAEESTAGGRAAYRPEGLPAGYGLQADGLYRLSEDQAQEILQMRLQRLTGLEQDKII 482

Query: 475 NELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDT----PRRTRIVEGLLDMEDE 530
            E   +  +I + LDIL+   R+  I+ +EL +++ E        RR+ I    L++  E
Sbjct: 483 GEYREVMSQIADLLDILARPERVTAILVEELNALRQEFGQAKVGARRSVIERNALELGTE 542

Query: 531 DCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVL 590
           D I   DMVVT+SH GY+K  PL+ YRAQRRGG+G+     +D+D++  LFI +TH  +L
Sbjct: 543 DLITPTDMVVTLSHTGYIKSQPLTEYRAQRRGGRGKQATQTKDDDWIDQLFIANTHDWIL 602

Query: 591 FFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFP-EDESSWNNLYVV 649
            FS  G VY  KVW +P GS  +RGK ++N+  L  GE+IT ++P   E  S   + YV 
Sbjct: 603 CFSDRGRVYWLKVWEVPQGSRNSRGKPIVNMFPLQPGEKITVVLPLTGEFRSFPADHYVF 662

Query: 650 FATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFP 709
            +T  G V++  L +F    ++G IA+ LD  D ++        +D++L +  G+ VRF 
Sbjct: 663 MSTALGTVKKTPLDEFSNPRKAGIIAVGLDEGDYLIGAALTDGRHDVMLFSDGGKAVRFD 722

Query: 710 ISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT 769
              +R   GRN+ GVRG++L  G  VI+M +    D   D      +             
Sbjct: 723 EDDVRPM-GRNARGVRGMALEPGQNVIAMLVSDRGDEARDVGEDSTRVS----------- 770

Query: 770 EEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRA 829
                                         +LT +E GFGKRT   ++    R  KG+ A
Sbjct: 771 ------------------------------VLTATENGFGKRTPIGEYTRHGRGTKGMIA 800

Query: 830 TDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDE 889
              S+ N  G +VA   V + D+I+L++D+G L+R  V EIR   RAT+GV + +     
Sbjct: 801 IQQSERN--GKVVAATLVRETDEIMLITDRGVLVRTRVAEIREMGRATQGVTLIALDDGA 858

Query: 890 RVVSVERIRESEIVDEAESTE 910
           ++  ++RI E++   +  + +
Sbjct: 859 KLSGLQRIVENDAQTDVAAGD 879



 Score = 76.0 bits (185), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 49/246 (19%), Positives = 100/246 (40%), Gaps = 15/246 (6%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  V   + LG VK+ PL  +   R+ G     V + + D++    +      V+ F
Sbjct: 655 FPADHYVFMSTALGTVKKTPLDEFSNPRKAG--IIAVGLDEGDYLIGAALTDGRHDVMLF 712

Query: 593 SSLGFVYKEKVWRLPIGSPQARG------KALINILSLNQGERITTIMPFPEDESSWNNL 646
           S  G   +     +      ARG      +   N++++   +R        ED +  +  
Sbjct: 713 SDGGKAVRFDEDDVRPMGRNARGVRGMALEPGQNVIAMLVSDRGDEARDVGEDSTRVS-- 770

Query: 647 YVVFATKHGNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTKLG 703
            V+ AT++G  +R  + ++ +  R   G IA++      ++++     + ++I+L T  G
Sbjct: 771 -VLTATENGFGKRTPIGEYTRHGRGTKGMIAIQQSERNGKVVAATLVRETDEIMLITDRG 829

Query: 704 QCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRR 763
             VR  ++ IR   GR + GV  I+L  G ++  +  ++  DA  D          +   
Sbjct: 830 VLVRTRVAEIREM-GRATQGVTLIALDDGAKLSGLQRIVENDAQTDVAAGDDTANDSAGD 888

Query: 764 LISGDT 769
             + + 
Sbjct: 889 AGTENA 894


>gi|91205609|ref|YP_537964.1| DNA gyrase subunit A [Rickettsia bellii RML369-C]
 gi|123084566|sp|Q1RID9|GYRA_RICBR RecName: Full=DNA gyrase subunit A
 gi|91069153|gb|ABE04875.1| DNA gyrase subunit A [Rickettsia bellii RML369-C]
          Length = 905

 Score =  940 bits (2429), Expect = 0.0,   Method: Composition-based stats.
 Identities = 459/900 (51%), Positives = 633/900 (70%), Gaps = 15/900 (1%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT++           +  V+I DEM+ SYL YA++VI+ RAIPD+RDGLKPVHRRI++ M
Sbjct: 1   MTDN-------NSSNLVPVNIEDEMKVSYLDYAMSVIVSRAIPDVRDGLKPVHRRIIYSM 53

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            + G   N+ Y K ARI G+VMGKYHPHG++AIYD+L RMAQD+SLRL L++GQGNFGS+
Sbjct: 54  HEAGNHANRAYRKSARIVGDVMGKYHPHGDSAIYDSLVRMAQDFSLRLPLVDGQGNFGSL 113

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGD  AA RYTE R+ K AH L++D+ K+TV F PNYDGS +EP VL + +PN+LVNG G
Sbjct: 114 DGDAAAAMRYTESRMAKVAHKLIEDIDKETVSFNPNYDGSEEEPSVLPSMFPNLLVNGSG 173

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEV+D C   +DN DI++  L+E+++GPDFPT  +ILG  GIK+A
Sbjct: 174 GIAVGMATNIPPHNLGEVIDACCLYVDNNDIEILDLLEVVKGPDFPTSGIILGVNGIKSA 233

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGSI IRG + IE     R+ I++TEIPY VNKA ++EKIAE+V+EKRI  I+DLR
Sbjct: 234 YLTGRGSIAIRGRAEIENLGNGRQAIIITEIPYMVNKARLVEKIAEMVKEKRIEGISDLR 293

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DES++ G R+ IELK+   A+V+LNQ+Y  T LQ+ F V M+AL    P+   L  ++ A
Sbjct: 294 DESNKNGIRIYIELKKDIVAEVVLNQIYSCTQLQTSFGVIMLALKDGLPKVMNLKEVIAA 353

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FRE V+  RT YLLNKARD+AH+L+GL IAV+N+DE++RII+ + +P  A++ELM R
Sbjct: 354 FVSFREVVITNRTIYLLNKARDKAHILLGLTIAVSNIDEIIRIIKAASDPNAAKQELMAR 413

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
           SW+A +I  L+ L+DD +  +  +G    +E Q +AILE+RL RLT + ++ +  +L +L
Sbjct: 414 SWDALNILPLVKLVDDKAM-LNEEGKCSFTEAQAKAILEMRLQRLTAMEKNKLEEDLKNL 472

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
             EI E L+IL SR RLL I+K+EL+ VK+E  TPR T I  G  D + ED I RE+MVV
Sbjct: 473 ATEITEYLNILGSRERLLEILKEELIKVKEEFATPRLTSIEFGEFDQDIEDLIQREEMVV 532

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TV+  GY+KRVPLS YRAQ+RGGKGRSG+ MRDED  T +F+ STHT +LFFS++G VY 
Sbjct: 533 TVTLGGYIKRVPLSSYRAQKRGGKGRSGLSMRDEDITTQVFVGSTHTPMLFFSNIGQVYS 592

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
            K+++LP+ +PQ +G+ ++NIL L   E IT IMP PE++  W+NL ++FAT  GN+RR+
Sbjct: 593 LKLYKLPLSNPQGKGRPMVNILPLKGDEHITNIMPLPENQDEWDNLNIMFATAKGNIRRS 652

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
            L DF +I  +GKIA++LD  D+++ V+ C ++  ILL TK G+ +RFP+ ++RV   R 
Sbjct: 653 DLLDFKKIQSNGKIAIRLDEDDKLIDVKPCKEDEHILLATKSGKALRFPVESLRVIKSRT 712

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSS 780
           S GVRG+ LA+ D VISM ++    A  +ER  Y+     +R  I+   E      N   
Sbjct: 713 SDGVRGMRLAEDDSVISMTVLKGIKATREERDAYLSVSWEKRLEIAKGEE-----FNSEE 767

Query: 781 VEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGA 840
           +  +++ E   E+   E+FILTV+E GFGKR+S+Y +RI++R G GI   D++  ++ G 
Sbjct: 768 LGVDLTAESILEMANSEEFILTVTENGFGKRSSAYGYRITDRGGSGIINMDIN--DKTGL 825

Query: 841 LVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900
           +V V PV  +D+++L+++ G LIR  +  +RI  R T GV +F     E+VVS   I ES
Sbjct: 826 VVGVMPVKMDDELMLITNSGKLIRCKLETVRITGRNTSGVTLFRLDDGEKVVSASLIAES 885


>gi|186894663|ref|YP_001871775.1| DNA gyrase subunit A [Yersinia pseudotuberculosis PB1/+]
 gi|186697689|gb|ACC88318.1| DNA gyrase, A subunit [Yersinia pseudotuberculosis PB1/+]
          Length = 891

 Score =  940 bits (2429), Expect = 0.0,   Method: Composition-based stats.
 Identities = 409/900 (45%), Positives = 570/900 (63%), Gaps = 68/900 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL KDTVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKDTVDFVPNYDGTEQIPAVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A I++ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG + IR  +
Sbjct: 187 LSEVIDGCLAYIEDENISIEGLMEYIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVALSQGQPKLLNLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +  P  A+  L+   W   ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRRASTPAEAKAGLIASPWELGNVASMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGDDAARPEWLEAEFGIRDGKYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTLIG 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + IL +  RL+ +I++EL+++K++ +  RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELIFILENPDRLMEVIREELVAIKEQYNDLRRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PLS Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      +V  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYE---EGRHVFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L + LG+ VRFP   +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGSNEVMLFSALGKVVRFPEGQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+VIS+ I                                             
Sbjct: 723 GINLNGDDRVISLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV+E G+GKRT+  ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 738 --------PRGDGEILTVTENGYGKRTAVAEYPTKSRATQGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V   DQI++++D GTL+R  V+E+ +  R T+GV +  TA+DE VV ++R+ E E  D+
Sbjct: 788 QVAPTDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDD 847


>gi|51595600|ref|YP_069791.1| DNA gyrase subunit A [Yersinia pseudotuberculosis IP 32953]
 gi|51588882|emb|CAH20496.1| DNA gyrase subunit A [Yersinia pseudotuberculosis IP 32953]
          Length = 897

 Score =  940 bits (2429), Expect = 0.0,   Method: Composition-based stats.
 Identities = 409/900 (45%), Positives = 570/900 (63%), Gaps = 68/900 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL KDTVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKDTVDFVPNYDGTEQIPAVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A I++ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG + IR  +
Sbjct: 187 LSEVIDGCLAYIEDENISIEGLMEYIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVALSQGQPKLLNLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +  P  A+  L+   W   ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRRASTPAEAKAGLIASPWELGNVASMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGDDAARPEWLEAEFGIRDGKYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTLIG 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + IL +  RL+ +I++EL+++K++ +  RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELIFILENPDRLMEVIREELVAIKEQYNDLRRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PLS Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      +V  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYE---EGRHVFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L + LG+ VRFP   +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGSNEVMLFSALGKVVRFPEGQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+VIS+ I                                             
Sbjct: 723 GINLNGDDRVISLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV+E G+GKRT+  ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 738 --------PRGDGEILTVTENGYGKRTAVAEYPTKSRATQGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V   DQI++++D GTL+R  V+E+ +  R T+GV +  TA+DE VV ++R+ E E  D+
Sbjct: 788 QVAPTDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDD 847



 Score = 72.5 bits (176), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 63/448 (14%), Positives = 144/448 (32%), Gaps = 38/448 (8%)

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
            L K     H    L      L  +  +I    NP+     + +      +  + +   +
Sbjct: 462 RLQKLTGLEHE-KLLDEYKELLTLIGELIFILENPDRLMEVIREELVAIKEQYNDLRRTE 520

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTG---LGRDDIRNELNSLGIEIKECLDI-- 490
            ++ T   +    +++      L  +               R         IKE   I  
Sbjct: 521 ITANTSDINIEDLINQEDVVVTLSHQGYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDR 580

Query: 491 ---LSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTV----- 542
               ++   +L    +  L        P  +R   G   +        E +   +     
Sbjct: 581 LLVANTHDTILCFSSRGRLYWMKVYQLPEASRGARGRPIVNLLPLEPNERITAILPVREY 640

Query: 543 ---------SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
                    +  G VK+  L+ +   R  G     +   DE    DL        V+ FS
Sbjct: 641 EEGRHVFMATASGTVKKTALTEFSRPRSAGIIAVNLNEGDELIGVDL--TDGSNEVMLFS 698

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           +LG V +    ++      A G   +  ++LN  +R+ +++          +  ++  T+
Sbjct: 699 ALGKVVRFPEGQVRSMGRTATG---VRGINLNGDDRVISLI------IPRGDGEILTVTE 749

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLD---SRDEILSVETCTQENDILLTTKLGQCVRFPI 710
           +G  +R  ++++   +R+ +  + +       +++        + I++ T  G  VR  +
Sbjct: 750 NGYGKRTAVAEYPTKSRATQGVISIKVSERNGKVVGAVQVAPTDQIMMITDAGTLVRTRV 809

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTE 770
           S +    GRN+ GV  I  A+ + V+ +  V   + D D                +    
Sbjct: 810 SEV-SVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDDILDGESSEGEEGSEENAALNA 868

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQ 798
               + ++ +   + ++   +     + 
Sbjct: 869 PSDDVADEDTDAEDDTDAEDETDVEDDN 896


>gi|153949955|ref|YP_001401731.1| DNA gyrase subunit A [Yersinia pseudotuberculosis IP 31758]
 gi|152961450|gb|ABS48911.1| DNA gyrase, A subunit [Yersinia pseudotuberculosis IP 31758]
          Length = 897

 Score =  940 bits (2429), Expect = 0.0,   Method: Composition-based stats.
 Identities = 409/900 (45%), Positives = 570/900 (63%), Gaps = 68/900 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL KDTVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKDTVDFVPNYDGTEQIPAVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A I++ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG + IR  +
Sbjct: 187 LSEVIDGCLAYIEDENISIEGLMEYIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVALSQGQPKLLNLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +  P  A+  L+   W   ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRRASTPAEAKAGLIASPWELGNVASMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGDDAARPEWLEAEFGIRDGKYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTLIG 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + IL +  RL+ +I++EL+++K++ +  RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELIFILENPDRLMEVIREELVAIKEQYNDLRRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PLS Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      +V  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYE---EGRHVFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L + LG+ VRFP   +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGSNEVMLFSALGKVVRFPEGQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+VIS+ I                                             
Sbjct: 723 GINLNGDDRVISLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV+E G+GKRT+  ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 738 --------PRGDGEILTVTENGYGKRTAVAEYPTKSRATQGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V   DQI++++D GTL+R  V+E+ +  R T+GV +  TA+DE VV ++R+ E E  D+
Sbjct: 788 QVAPTDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDD 847



 Score = 72.5 bits (176), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 63/448 (14%), Positives = 143/448 (31%), Gaps = 38/448 (8%)

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
            L K     H    L      L  +  +I    NP+     + +      +  + +   +
Sbjct: 462 RLQKLTGLEHE-KLLDEYKELLTLIGELIFILENPDRLMEVIREELVAIKEQYNDLRRTE 520

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTG---LGRDDIRNELNSLGIEIKECLDI-- 490
            ++ T   +    +++      L  +               R         IKE   I  
Sbjct: 521 ITANTSDINIEDLINQEDVVVTLSHQGYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDR 580

Query: 491 ---LSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTV----- 542
               ++   +L    +  L        P  +R   G   +        E +   +     
Sbjct: 581 LLVANTHDTILCFSSRGRLYWMKVYQLPEASRGARGRPIVNLLPLEPNERITAILPVREY 640

Query: 543 ---------SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
                    +  G VK+  L+ +   R  G     +   DE    DL        V+ FS
Sbjct: 641 EEGRHVFMATASGTVKKTALTEFSRPRSAGIIAVNLNEGDELIGVDL--TDGSNEVMLFS 698

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           +LG V +    ++      A G   +  ++LN  +R+ +++          +  ++  T+
Sbjct: 699 ALGKVVRFPEGQVRSMGRTATG---VRGINLNGDDRVISLI------IPRGDGEILTVTE 749

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLD---SRDEILSVETCTQENDILLTTKLGQCVRFPI 710
           +G  +R  ++++   +R+ +  + +       +++        + I++ T  G  VR  +
Sbjct: 750 NGYGKRTAVAEYPTKSRATQGVISIKVSERNGKVVGAVQVAPTDQIMMITDAGTLVRTRV 809

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTE 770
           S +    GRN+ GV  I  A+ + V+ +  V   + D D                +    
Sbjct: 810 SEV-SVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDDILDGESSEGEEGSEENAALNA 868

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQ 798
               + ++ +   + ++         + 
Sbjct: 869 PSDDVADEDTDAEDDTDAEDDTDVEDDN 896


>gi|260576780|ref|ZP_05844765.1| DNA gyrase, A subunit [Rhodobacter sp. SW2]
 gi|259021032|gb|EEW24343.1| DNA gyrase, A subunit [Rhodobacter sp. SW2]
          Length = 907

 Score =  940 bits (2429), Expect = 0.0,   Method: Composition-based stats.
 Identities = 475/912 (52%), Positives = 615/912 (67%), Gaps = 14/912 (1%)

Query: 1   MTEHIISSDEEEEKGITS--------VSITDEMQNSYLTYAINVILGRAIPDLRDGLKPV 52
           MT+H    D E    I          VSI+ EM+ +YL YA++VI+ RAIPDLRDGLKPV
Sbjct: 1   MTDH--PEDTETPSEIPERPVFHGPQVSISAEMKTAYLDYAMSVIVSRAIPDLRDGLKPV 58

Query: 53  HRRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIE 112
           HRR+LF M + G   +K Y K AR  G+ MGKYHPHG+A+IYDAL RMAQ +S+ L L++
Sbjct: 59  HRRVLFAMHETGNTSDKPYRKSARPVGDTMGKYHPHGDASIYDALVRMAQPFSMSLKLLD 118

Query: 113 GQGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYP 172
           GQGNFGS+DGD  AA RYTE R+ K A FLL D+ KDTVDF+ NYDG  +EP VL AR+P
Sbjct: 119 GQGNFGSMDGDGAAAMRYTEVRMDKPAAFLLADIDKDTVDFQDNYDGKDREPTVLPARFP 178

Query: 173 NVLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVIL 232
           N+LVNG  GIAVGMAT IP HNLGEV+DG +A+I NPD+  +ALMEII  PDFPTGA IL
Sbjct: 179 NMLVNGAEGIAVGMATRIPPHNLGEVIDGTLALIANPDLSTEALMEIIPAPDFPTGATIL 238

Query: 233 GRTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKR 292
           GR+G + AY  GRGSI++R  + IE+   DR  I++ EIPYQVNKA M+E IAE VREK+
Sbjct: 239 GRSGARKAYLEGRGSIIVRAKTRIEEIRKDRFAIIIDEIPYQVNKARMIEIIAEQVREKK 298

Query: 293 IVDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERF 352
           I  IA ++DESDR G RVVIELKR A+ADV+LNQLYR+T +Q  F+ NM+ALNG +PE+ 
Sbjct: 299 IEGIAHVQDESDRIGVRVVIELKRDATADVVLNQLYRFTPMQISFACNMLALNGGRPEQL 358

Query: 353 TLIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPET 412
            L   L  F+ FREEVV RRT + L KAR+R+H+L GLA+AVAN+DEVV  IR S +P  
Sbjct: 359 ALRDFLTHFITFREEVVARRTAFELRKARERSHILCGLAVAVANVDEVVATIRSSADPAE 418

Query: 413 ARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDD 472
           AR  LM R W A +I   I LIDD ++ +  DGT  LSE+Q RAIL+LRL RLT +G  +
Sbjct: 419 ARERLMTRRWPAGEIIPFIKLIDDPTHKVNEDGTYNLSEIQARAILDLRLQRLTAMGVKE 478

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDC 532
           I +EL  L  +I++ L+IL SR R++ II  EL  ++     PRRT IV+   DMEDED 
Sbjct: 479 ITDELLDLAGKIRDYLEILGSRDRIMAIISTELAEMRALFAVPRRTEIVDWSGDMEDEDL 538

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
           I REDMVVT++  GY+KR PL+ +R+Q RGGKG + +  +++D VT LF+ +THT +LFF
Sbjct: 539 IEREDMVVTITSGGYIKRTPLAEFRSQNRGGKGLASMSTKEDDVVTTLFVANTHTQLLFF 598

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           ++ G VYK K WRLP+   QA+GKA++NIL + QG  I  +MP    E  W +L +VFAT
Sbjct: 599 TTDGMVYKLKTWRLPLAGRQAKGKAIVNILPIAQGVSIAALMPVDVPEEEWESLQIVFAT 658

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISA 712
             G+VR+N LSDF  + R+GKIAMKL     +++     + +D++L T  G+ +RFP + 
Sbjct: 659 SDGDVRQNDLSDFTNVMRNGKIAMKLPEGVSLVNAAIADENDDVMLVTSGGRAIRFPTTE 718

Query: 713 IRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEI 772
           IRVF  R S GVRGI L   D+V+SMAI+ H +AD  ER  Y+K        +  +TE  
Sbjct: 719 IRVFKSRGSTGVRGIRLGAEDRVVSMAIIRHFEADPAEREAYLKQRRLMAGAVDDETEAD 778

Query: 773 TSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDV 832
                 +   G +S ER  E+   E  ILT++  G GK TSS+D+ +  R G G++A D 
Sbjct: 779 EDEV--AVAAGQLSTERYAEMSAAEDLILTITTSGSGKLTSSHDYPVRGRGGMGVKAMD- 835

Query: 833 SKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVV 892
                 G LVA FPV  +DQI+L +  G  IRVPV +I   SR+  GV +F+T  DE+VV
Sbjct: 836 -GAMRGGPLVASFPVEMSDQIMLATSTGQSIRVPVAQISFRSRSAGGVKVFNTGGDEQVV 894

Query: 893 SVERIRESEIVD 904
           SV R+ E    +
Sbjct: 895 SVARVAEQGDDE 906


>gi|241761282|ref|ZP_04759370.1| DNA gyrase, A subunit [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241374189|gb|EER63686.1| DNA gyrase, A subunit [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 925

 Score =  939 bits (2428), Expect = 0.0,   Method: Composition-based stats.
 Identities = 463/904 (51%), Positives = 626/904 (69%), Gaps = 21/904 (2%)

Query: 9   DEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWN 68
              +   I+ VSI DEM++SYL YA++VI+ RA+PD+RDGLKPVHRRILF   + G    
Sbjct: 35  PSTDTNDISPVSIIDEMKSSYLDYAMSVIVSRALPDVRDGLKPVHRRILFASQEGGFVPG 94

Query: 69  KKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAE 128
             Y K A+I GEVMG +HPHG++AIY ALAR+ QDWS+R+ LI+GQGNFGS+D D PAA 
Sbjct: 95  HPYRKSAKIVGEVMGNFHPHGDSAIYMALARLTQDWSMRVPLIDGQGNFGSMDPDGPAAM 154

Query: 129 RYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMAT 188
           RYTE RL  AA  LL D+ +DTVDF PNYDGS QEP VL AR+PN+LVNG GGIAVGMAT
Sbjct: 155 RYTEARLSPAAMMLLADIDRDTVDFSPNYDGSRQEPQVLPARFPNLLVNGAGGIAVGMAT 214

Query: 189 NIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSI 248
           NIP HNLGEV+  C A I +P I ++ L+ ++ GPDFPTG V+LG+ G ++AY  GRGSI
Sbjct: 215 NIPPHNLGEVLAACRAYIADPAISIEDLIRLVPGPDFPTGGVMLGQGGARSAYQNGRGSI 274

Query: 249 VIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +IR   +IE+  GDR  IV+TEIPYQ+ K+A++EKIAE  ++KR+  I+D+RDES+R+G 
Sbjct: 275 IIRSRYNIEEKHGDRRSIVLTEIPYQIGKSALVEKIAEAAKDKRVEGISDIRDESNREGV 334

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVI+LKR A+ DV+LNQL+R+T  QS F  NM+ALNG +PE  +L  I+ AFV FREEV
Sbjct: 335 RVVIDLKRDATPDVVLNQLWRHTPAQSSFPANMLALNGGRPETMSLKDIIAAFVQFREEV 394

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           + RR+KY L KAR+RAH+L+G+ IAV NLDEVVRIIR +P+P  A  EL  R W  +D+ 
Sbjct: 395 ITRRSKYDLFKARERAHLLLGMVIAVTNLDEVVRIIRNAPSPAEAHSELSARKWPVNDVL 454

Query: 429 DLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECL 488
             I LI ++       G   LS+ Q  AIL LRL+RLT +GRD I  EL  L I I E L
Sbjct: 455 PYIKLI-EAVEDFEESGLYTLSKAQVDAILALRLSRLTAMGRDQIGEELKKLAISISELL 513

Query: 489 DILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYV 548
           ++L +R RL  I+ +E  +V+ +  TPRRT+IV     +EDED I RE+MVVTV+H GY+
Sbjct: 514 EVLRNRERLYEIMVEEFDAVEAQFATPRRTQIVAASDAIEDEDLIEREEMVVTVTHGGYI 573

Query: 549 KRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPI 608
           KR PL  +R Q RGGKGRSG+  +DED VT+LF+  THT VLFFS+ G VY+ KVWRLP 
Sbjct: 574 KRTPLDTFRTQNRGGKGRSGMATKDEDAVTNLFVTCTHTPVLFFSNHGKVYRLKVWRLPE 633

Query: 609 GSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQI 668
           G+PQARG+ ++N+L L +GE ++T++P PEDE+ W NL+V+FAT  G+VRRN +  F  +
Sbjct: 634 GAPQARGRPMVNLLPLAEGEVVSTVLPLPEDEAEWGNLHVLFATAKGSVRRNSMDAFTNV 693

Query: 669 NRSGKIAMKLDSR--DEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRG 726
             +GK A++ +    D ++ V   ++ +D+LL T+ G+ +RF  + +RVF  R S GVRG
Sbjct: 694 PSNGKFAIRFEEGDDDRLIGVTLLSENDDVLLATRNGKAIRFAATDVRVFQSRTSTGVRG 753

Query: 727 ISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNIS 786
           I+L  GD+VIS++ +   +   ++R  Y++  + +                       + 
Sbjct: 754 ITLKDGDEVISLSTLRGFETTVEDRDKYLRSAAWK----------------TDPAPAELP 797

Query: 787 EERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFP 846
            E+ +  +  E FILTV+  G+GKRTSS+++R SNR G+GI   + S+ N  G++VA FP
Sbjct: 798 PEKIKAFEEAEDFILTVTANGYGKRTSSHEYRRSNRGGQGITNIETSERN--GSVVASFP 855

Query: 847 VNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEA 906
            +D DQ++LV+D+  LIR  VN+IRIA R T+GV IF+ A+ E+VVS  RI +    +E 
Sbjct: 856 AHDGDQLMLVTDQAKLIRTTVNDIRIAGRNTQGVTIFNVAEGEQVVSAARITDDGDDEEE 915

Query: 907 ESTE 910
            + E
Sbjct: 916 GTVE 919



 Score = 64.8 bits (156), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 45/256 (17%), Positives = 99/256 (38%), Gaps = 37/256 (14%)

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           V+  +  G V+R  +  +      GK        D+D +  + ++S +  VL  +  G  
Sbjct: 673 VLFATAKGSVRRNSMDAFTNVPSNGKFAIRFEEGDDDRLIGVTLLSENDDVLLATRNGKA 732

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNL------------ 646
            +     +     Q+R    +  ++L  G+ + ++      E++  +             
Sbjct: 733 IRFAATDVR--VFQSRTSTGVRGITLKDGDEVISLSTLRGFETTVEDRDKYLRSAAWKTD 790

Query: 647 -------------------YVVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSV 687
                              +++  T +G  +R    ++ + NR G+    +++ +   SV
Sbjct: 791 PAPAELPPEKIKAFEEAEDFILTVTANGYGKRTSSHEYRRSNRGGQGITNIETSERNGSV 850

Query: 688 ---ETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHA 744
                    + ++L T   + +R  ++ IR  AGRN+ GV   ++A+G+QV+S A +   
Sbjct: 851 VASFPAHDGDQLMLVTDQAKLIRTTVNDIR-IAGRNTQGVTIFNVAEGEQVVSAARITDD 909

Query: 745 DADYDERICYMKHMSA 760
             D +E     +   A
Sbjct: 910 GDDEEEGTVENQSGEA 925


>gi|318606419|emb|CBY27917.1| DNA gyrase subunit A [Yersinia enterocolitica subsp. palearctica
           Y11]
          Length = 885

 Score =  939 bits (2428), Expect = 0.0,   Method: Composition-based stats.
 Identities = 404/900 (44%), Positives = 566/900 (62%), Gaps = 68/900 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL KDTVDF PNYDG+ Q P V+  + PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKDTVDFVPNYDGTEQIPAVMPTKIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A I++ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG + IR  +
Sbjct: 187 LSEVIDGCLAYIEDENITIEGLMEYIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMV L+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVGLSQGQPKLLNLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +  P  A+  L+   W   ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRRAATPAEAKAGLIASPWELGNVAAMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
               +             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGGDAARPEWLEAEFGIRDGKYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTVIA 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + IL +  RL+ +I++EL+++K+  +  RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELIFILENPERLMEVIREELVAIKELYNDARRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PLS Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      ++  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYE---EGRHIFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L + LG+ VRFP S +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGTNEVMLFSALGKVVRFPESQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+VIS+ I                                             
Sbjct: 723 GINLNGDDRVISLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV+E G+GKRT+  ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 738 --------PRGDGEILTVTENGYGKRTAVEEYPTKSRATQGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V   DQI++++D GTL+R  V+E+ +  R T+GV +  T +DE VV ++R+ E E  D 
Sbjct: 788 QVAPTDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTTEDEHVVGLQRVAEPEEDDN 847


>gi|238785705|ref|ZP_04629680.1| DNA gyrase subunit A [Yersinia bercovieri ATCC 43970]
 gi|238713390|gb|EEQ05427.1| DNA gyrase subunit A [Yersinia bercovieri ATCC 43970]
          Length = 892

 Score =  939 bits (2427), Expect = 0.0,   Method: Composition-based stats.
 Identities = 406/905 (44%), Positives = 569/905 (62%), Gaps = 68/905 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL KDTVD+ PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKDTVDYVPNYDGTEQIPAVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A I++ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG + IR   
Sbjct: 187 LSEVIDGCLAYIEDENISIEGLMEYIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARG 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I++ EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIIHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVALSQGQPKLLNLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +  P  A+  L+   W   ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRRAATPAEAKAGLIASPWELGNVSAMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
               +             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGGDAARPEWLEAEFGIRDGKYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTAIA 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + IL +  RL+ +I++EL+++K++    RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELIFILENPERLMEVIREELVAIKEQYSDARRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PL+ Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      +V  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYE---EGRHVFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L + LG+ VRFP + +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGSNEVMLFSALGKVVRFPETQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+VIS+ I                                             
Sbjct: 723 GINLNGDDRVISLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV+E G+GKRT+  ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 738 --------PRGDGEILTVTENGYGKRTAVEEYPTKSRATQGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V   DQI++++D GTL+R  V+E+ +  R T+GV +  TA+DE VV ++R+ E E  D+
Sbjct: 788 QVAPTDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDD 847

Query: 906 AESTE 910
               E
Sbjct: 848 ILDGE 852


>gi|254293784|ref|YP_003059807.1| DNA gyrase subunit alpha [Hirschia baltica ATCC 49814]
 gi|254042315|gb|ACT59110.1| DNA gyrase, A subunit [Hirschia baltica ATCC 49814]
          Length = 981

 Score =  939 bits (2427), Expect = 0.0,   Method: Composition-based stats.
 Identities = 515/911 (56%), Positives = 675/911 (74%), Gaps = 16/911 (1%)

Query: 13  EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYV 72
           E G++ ++I+DEM+ SYL YA++VI+ RA+PD+RDGLKPVHRRILF M + G  ++K Y 
Sbjct: 40  EDGVSPINISDEMKKSYLDYAMSVIVSRALPDVRDGLKPVHRRILFSMSEQGYTFDKAYK 99

Query: 73  KCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTE 132
           K AR+ G+V+GKYHPHG+ ++YDAL RMAQ++S+ L L++GQGNFGS+DGDP AA RYTE
Sbjct: 100 KSARVVGDVIGKYHPHGDQSVYDALVRMAQNFSMGLPLLDGQGNFGSMDGDPAAAMRYTE 159

Query: 133 CRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPT 192
            +L+K A+ LL D+ KDTV+F+ NYDGS +EP+VL AR+PN+LVNGGGGIAVGMATNIP 
Sbjct: 160 VKLKKVANHLLADIDKDTVNFQENYDGSEKEPIVLPARFPNLLVNGGGGIAVGMATNIPP 219

Query: 193 HNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRG 252
           HNLGEV+D  +A+I++P+ID +AL+EI+ GPDFPTGA+I+GR G ++   TGRGS+++R 
Sbjct: 220 HNLGEVIDATIAMIEDPNIDDEALLEIVPGPDFPTGALIIGRAGSRSGLMTGRGSVIMRS 279

Query: 253 VSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVI 312
            S IE+    RE +V TEIPYQVNKA+M+EKIAELVR+KRI  IAD+RDESDR G RVV+
Sbjct: 280 KSSIEELKNGREALVFTEIPYQVNKASMIEKIAELVRDKRIEGIADMRDESDRDGVRVVV 339

Query: 313 ELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRR 372
           E+KR AS +V+LNQL+RYT LQ+ F +NM+ALN  +PE  +L  IL+AF+ FREEVV RR
Sbjct: 340 EVKRDASPEVVLNQLFRYTQLQTSFGMNMLALNSGRPELLSLKAILQAFIIFREEVVARR 399

Query: 373 TKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLID 432
           TK+ LNKAR RAH+LVGLA+AVAN+DEV++IIR SP+P TAR +LM R+W A D+  LI+
Sbjct: 400 TKFELNKARARAHLLVGLALAVANIDEVIKIIRHSPDPSTAREKLMDRAWPAQDMLSLIN 459

Query: 433 LIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILS 492
           LI D        G + LSE Q RAIL+LRL RLTGLGRD+I +E   L   I + LDILS
Sbjct: 460 LIADRRTVANEVGEIRLSEEQARAILDLRLQRLTGLGRDEIGDEARGLADRIADYLDILS 519

Query: 493 SRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVP 552
           SR R++ II +EL  V++E   PRR++ +E  LDM+DE  I +EDMVV  +H GY KR  
Sbjct: 520 SRPRVMEIITEELRVVREEFAIPRRSQFIEAELDMDDEAFIEKEDMVVMFTHGGYAKRTA 579

Query: 553 LSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQ 612
           LS+YR Q RGG+GRSG+  ++ED VT  F+ +THT VLFFSS G VYK KVWR+P+G+PQ
Sbjct: 580 LSIYRTQHRGGRGRSGMGTKEEDAVTRFFVANTHTEVLFFSSTGMVYKTKVWRMPLGTPQ 639

Query: 613 ARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSG 672
           +RGKAL+N+L L++GE IT++MP PEDE    N+ ++FAT+ G VRRNKLSDF Q+NR+G
Sbjct: 640 SRGKALVNLLPLDKGETITSVMPLPEDEEERANMNILFATRSGGVRRNKLSDFTQVNRNG 699

Query: 673 KIAMKLDS------RDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRG 726
           KIAMKLD        D I+ V+ C+ ++D++LTT LGQC+RF +  +RVF GR S GVRG
Sbjct: 700 KIAMKLDEAQVAGSDDGIVGVQICSPDDDVMLTTALGQCIRFKVEDVRVFTGRTSTGVRG 759

Query: 727 ISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEI------TSLKNDSS 780
           I LA GD+VISM ++ H D    E   Y+KH SA RR +  +  +           +D  
Sbjct: 760 IRLANGDEVISMLVLRHMDITSPEARAYLKHASAMRRALGEEEGDTEIDVVSEPDADDEG 819

Query: 781 VEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGA 840
            E  +S ER  EL   E+F+LT++E G GKR S+YD+R++ R GKG+ A  +   N    
Sbjct: 820 DEAALSPERIAELGAAEEFLLTITEDGMGKRASAYDYRVTGRGGKGLIAHKL---NAGRR 876

Query: 841 LVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900
           L A FP+ D D+I+LV+D G LIR P  +IRIA RAT+GV +  T+ +ERVVSVER+ E 
Sbjct: 877 LAAAFPIEDGDEIMLVTDAGQLIRTPAKQIRIAGRATQGVKVLRTSGEERVVSVERLAEQ 936

Query: 901 EIV-DEAESTE 910
           E   DE E+ E
Sbjct: 937 ESDVDENETEE 947



 Score = 67.1 bits (162), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 44/261 (16%), Positives = 95/261 (36%), Gaps = 8/261 (3%)

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
             +D V+  + LG   R  +   R     G+  +GV         ++  +     +   S
Sbjct: 724 SPDDDVMLTTALGQCIRFKVEDVRV--FTGRTSTGVRGIRLANGDEVISMLVLRHMDITS 781

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSW---NNLYVVF 650
                Y +    +     +  G   I+++S    +          +  +       +++ 
Sbjct: 782 PEARAYLKHASAMRRALGEEEGDTEIDVVSEPDADDEGDEAALSPERIAELGAAEEFLLT 841

Query: 651 ATKHGNVRRNKLSDFIQINR--SGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRF 708
            T+ G  +R    D+    R   G IA KL++   + +       ++I+L T  GQ +R 
Sbjct: 842 ITEDGMGKRASAYDYRVTGRGGKGLIAHKLNAGRRLAAAFPIEDGDEIMLVTDAGQLIRT 901

Query: 709 PISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGD 768
           P   IR  AGR + GV+ +  +  ++V+S+  +   ++D DE         +   +    
Sbjct: 902 PAKQIR-IAGRATQGVKVLRTSGEERVVSVERLAEQESDVDENETEENVDGSAEIVDVAI 960

Query: 769 TEEITSLKNDSSVEGNISEER 789
                   N  + + +  ++ 
Sbjct: 961 DGAPEGEPNSETNDSSNDQQE 981


>gi|94309658|ref|YP_582868.1| DNA gyrase subunit A [Cupriavidus metallidurans CH34]
 gi|93353510|gb|ABF07599.1| DNA gyrase (type II topoisomerase), subunit A [Cupriavidus
           metallidurans CH34]
          Length = 897

 Score =  939 bits (2427), Expect = 0.0,   Method: Composition-based stats.
 Identities = 377/910 (41%), Positives = 558/910 (61%), Gaps = 59/910 (6%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++  K    VS+ +EM+ SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++  +WN+
Sbjct: 2   DQFAKETLPVSLEEEMRRSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHELNNDWNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG+ A+YD + RMAQ++SLR +L++GQGNFGSVDGD  AA R
Sbjct: 62  PYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQNFSLRYMLVDGQGNFGSVDGDNAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE RL K AH +L D+ K+TVDF PNYDGS +EP +L AR PN+L+NG  GIAVGMATN
Sbjct: 122 YTEIRLSKIAHEMLQDIDKETVDFEPNYDGSEKEPGILPARIPNLLINGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL EVVD C+ ++ NPD  +D L+E++  PDFPT  +I G  G++  Y TGRG +V
Sbjct: 182 IPPHNLNEVVDACLHLLRNPDATVDELIELVPAPDFPTAGIIYGIQGVREGYRTGRGRVV 241

Query: 250 IRGVSHIEKTSGDR-EQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R  +H E     + + I+V E+PYQVNK  +LE+IAELV EK++  I+D+RDESD+ G 
Sbjct: 242 MRARTHFEDIDRGQRQAIIVDELPYQVNKRTLLERIAELVTEKKVEGISDIRDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVIELKR    +V+LN LY+ T LQ  F +NMVAL   +P    L  +L AF++ R EV
Sbjct: 302 RVVIELKRNEVPEVVLNNLYKNTQLQDTFGMNMVALVDGQPRLLNLRQMLDAFLSHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KAR+R HVL GLA+A+AN+DE + II+ +P P  A++ELM + W++  ++
Sbjct: 362 VTRRTVFELRKARERGHVLEGLAVALANIDEFIAIIKAAPTPPIAKQELMSKPWDSGLVR 421

Query: 429 DLIDLIDDSS---------------YTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDI 473
           +++   +  +               + +  DG   LS+ Q + IL++RL RLTGL +D I
Sbjct: 422 EMLARAESDTAGGRASYRPDGLPAVFGMQPDGLYRLSDGQAQEILQMRLQRLTGLEQDKI 481

Query: 474 RNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCI 533
             E   +   I + LDIL+   R+  II +EL +++ E    RR++I     +++ ED I
Sbjct: 482 VQEYREVMGLIADLLDILARPERITTIITEELGAIRAEFGDERRSQIELNATELDTEDLI 541

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
             +DMVVT+SH GY+K  P+S YRAQ+RGG+G+     +++D++  LF+ +TH  +L FS
Sbjct: 542 TPQDMVVTLSHSGYMKSQPISEYRAQKRGGRGKLATATKEDDWIDTLFVANTHDYILCFS 601

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           + G +Y  KV+ +P GS  +RG+ ++N+  L  GE+I  I+P  + +      ++  AT 
Sbjct: 602 NRGRLYWLKVYEVPQGSRNSRGRPIVNMFPLADGEKINVILPVRQFD---AEHFIFMATA 658

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAI 713
            G V++  L+DF    ++G IA+ LD  D ++       ++D++L +  G+ VRF  + +
Sbjct: 659 RGTVKKTVLTDFSNPRKAGIIAVDLDEGDFLIGAAVTDGQHDVMLFSDAGKAVRFDENDV 718

Query: 714 RVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEIT 773
           R   GR + GVRG++L +G  VI+M +     A+ +  +                     
Sbjct: 719 RPM-GRQARGVRGMNLDEGQAVIAMLVAPAESAETESSVAEGDVSPVGS----------- 766

Query: 774 SLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVS 833
                                     +LT +E G+GKRT   ++    R  KG+ A   S
Sbjct: 767 --------------------------VLTATENGYGKRTPISEYTRHGRGTKGMIAIQTS 800

Query: 834 KINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVS 893
           + N  G +VA   V+  D+I+L++  G LIR  V EIR   RAT+GV + +  +  ++  
Sbjct: 801 ERN--GRVVAAALVSPEDEIMLITTGGVLIRTRVAEIREMGRATQGVTLINVDEGTKLSG 858

Query: 894 VERIRESEIV 903
           ++RI ES+  
Sbjct: 859 LQRIVESDAD 868



 Score = 73.3 bits (178), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 47/223 (21%), Positives = 92/223 (41%), Gaps = 13/223 (5%)

Query: 536 EDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSL 595
           E  +   +  G VK+  L+ +   R+ G     +   + DF+    +      V+ FS  
Sbjct: 650 EHFIFMATARGTVKKTVLTDFSNPRKAGIIAVDLD--EGDFLIGAAVTDGQHDVMLFSDA 707

Query: 596 GFVYKEKVWRLPIGSPQARGKALIN-------ILSLNQGERITTIMPFPEDESSWNNLYV 648
           G   +     +     QARG   +N       I  L              +        V
Sbjct: 708 GKAVRFDENDVRPMGRQARGVRGMNLDEGQAVIAMLVAPAESAETESSVAEGDVSPVGSV 767

Query: 649 VFATKHGNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQC 705
           + AT++G  +R  +S++ +  R   G IA++       +++    + E++I+L T  G  
Sbjct: 768 LTATENGYGKRTPISEYTRHGRGTKGMIAIQTSERNGRVVAAALVSPEDEIMLITTGGVL 827

Query: 706 VRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADY 748
           +R  ++ IR   GR + GV  I++ +G ++  +  ++ +DAD 
Sbjct: 828 IRTRVAEIREM-GRATQGVTLINVDEGTKLSGLQRIVESDADN 869


>gi|291614526|ref|YP_003524683.1| DNA gyrase, A subunit [Sideroxydans lithotrophicus ES-1]
 gi|291584638|gb|ADE12296.1| DNA gyrase, A subunit [Sideroxydans lithotrophicus ES-1]
          Length = 849

 Score =  939 bits (2427), Expect = 0.0,   Method: Composition-based stats.
 Identities = 398/906 (43%), Positives = 571/906 (63%), Gaps = 67/906 (7%)

Query: 9   DEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWN 68
           +++  K    VS+ +EM+ SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++  +WN
Sbjct: 2   EQQFAKETLPVSLEEEMRKSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHELSNDWN 61

Query: 69  KKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAE 128
           + Y K ARI G+V+GKYHPHG+ A+YD + RMAQD+SLR  L++GQGNFGSVDGD  AA 
Sbjct: 62  RAYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQDFSLRYTLVDGQGNFGSVDGDNAAAM 121

Query: 129 RYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMAT 188
           RYTE R+ K AH LL DL K+TVDF PNYDGS  EP+V  AR+PN+LVNG  GIAVGMAT
Sbjct: 122 RYTEIRMAKIAHELLADLDKETVDFGPNYDGSEHEPLVFPARFPNLLVNGSSGIAVGMAT 181

Query: 189 NIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSI 248
           NIP HN+ EVVD C+A++ NPD+D++ L+E++  PDFPT   I G  G+K  Y TGRG +
Sbjct: 182 NIPPHNMTEVVDACLALLKNPDMDIEQLIELVPAPDFPTAGFIYGLAGVKEGYRTGRGRV 241

Query: 249 VIRGVSHIEKT-SGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQG 307
           V+R  +H E    GDR+ I++ E+PYQVNKA +L KI E+VREKRI  ++++RDESD+ G
Sbjct: 242 VMRARTHFEDIGKGDRQAIIIDELPYQVNKANLLMKIGEMVREKRIEGVSEIRDESDKSG 301

Query: 308 YRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREE 367
            R VIELKRG +ADVILNQLY+ T +Q  F +NMVA+   +P+   L  +++AF+  R E
Sbjct: 302 MRAVIELKRGENADVILNQLYKDTQMQDSFGINMVAIVDGQPKLCNLKDVIEAFLRHRRE 361

Query: 368 VVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDI 427
           VV RRT + L KAR+R H+L GLA+A++N+DE++ +I+ +P P  A+RELM R W +S +
Sbjct: 362 VVTRRTIFELRKARERGHILEGLAVALSNVDEIIALIKAAPTPPDAKRELMARGWRSSLV 421

Query: 428 KDLIDLIDD--------SSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           +D++  +D+          + +      +LS+ Q +AILELRL RLTGL +D I  E   
Sbjct: 422 EDMLSRVDEASRPEGLAPEFGLVKGTGYFLSDAQAQAILELRLQRLTGLEQDKIVGEYRE 481

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           +  +I + LDIL+  +R+  II  EL++++ +    RR+ IV    DM  ED I  ED+V
Sbjct: 482 VMDKITDLLDILAKPARVTQIIGDELITIRSQFGDKRRSEIVTHTQDMSMEDLIAPEDVV 541

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           VT+SH GY+K   L  YRAQ+RGG+G+     +++DF+ +LFI +TH  +L FS+ G VY
Sbjct: 542 VTMSHGGYMKAQKLDEYRAQKRGGRGKQATATKEDDFIDNLFIANTHDYILCFSNRGRVY 601

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
             KV+ +P G+  +RGK ++N+L L  GE+I  I+P  +      + ++ FAT  G V++
Sbjct: 602 WLKVYDVPQGTRISRGKPIVNLLPLEAGEKINAILPVKQFA---EDQFIFFATSEGTVKK 658

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
             LSDF    ++G IA+ LD  D ++ V     ++D++L +  G+ VRF    +R   GR
Sbjct: 659 TPLSDFANPRKAGIIAISLDEGDFLIGVAITDGKHDVMLFSDEGRAVRFDEDDVRGM-GR 717

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
            + GVRG++LAKG +VI++ +  + +                                  
Sbjct: 718 TARGVRGMNLAKGGKVIALLVAENEE---------------------------------- 743

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
                             Q +LT +E G+GKRT   ++    R  +G+ A   S+ N  G
Sbjct: 744 ------------------QSVLTATENGYGKRTPISEYTRHGRGTQGMIAIQTSERN--G 783

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            +VA   V   D+I+L+   G LIR  VNEIR   RAT+GV + +  + E++  + RI E
Sbjct: 784 KVVAATLVKPEDEIMLIGTSGVLIRTRVNEIREMGRATQGVTLMNVGEGEKLAGLSRIAE 843

Query: 900 SEIVDE 905
           +E   E
Sbjct: 844 TEEESE 849


>gi|300312989|ref|YP_003777081.1| DNA gyrase subunit A protein [Herbaspirillum seropedicae SmR1]
 gi|300075774|gb|ADJ65173.1| DNA gyrase subunit A protein [Herbaspirillum seropedicae SmR1]
          Length = 881

 Score =  939 bits (2426), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/921 (42%), Positives = 572/921 (62%), Gaps = 76/921 (8%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++  K    +S+ +EM+ SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M +M   WN+
Sbjct: 2   DQFAKETIPISLEEEMRKSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMHEMNNVWNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            +VKCAR+ GEVMGKYHPHG+A+IYD L RMAQD+SLR  L++GQGNFGS+DGD  AA R
Sbjct: 62  PFVKCARVVGEVMGKYHPHGDASIYDTLVRMAQDFSLRYTLVDGQGNFGSIDGDGAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTECRL K ++ LL D+ K+TVDF PNYDG  +EP VL  R PN+LVNG  GIAVGMATN
Sbjct: 122 YTECRLDKISNELLADIEKETVDFVPNYDGKEKEPSVLPTRIPNLLVNGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HN+ EV++G + ++ N    +D L+E++  PDFPTG +I G +G+++ Y TGRG +V
Sbjct: 182 IPPHNITEVINGALHLLANEQCTIDELIELVPAPDFPTGGIIYGVSGVRDGYRTGRGRVV 241

Query: 250 IRGVSHIEKT-SGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R  +H E+     R  I+V E+PYQVNK A+LE+IAELVR+K++  I+DLRDESD+ G 
Sbjct: 242 MRAKTHFEEYGREGRIAIIVDELPYQVNKKALLERIAELVRDKKLEGISDLRDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVIELKRG   +V+LN LY+ T LQ  F +NMVAL   +P    L  +L+ F++ R EV
Sbjct: 302 RVVIELKRGEVPEVVLNNLYKQTQLQDTFGMNMVALVDGQPRLLNLKQLLECFLSHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KAR+R HVL GLA+A+AN+D+ + IIR +P P  A+ ELM R+W++S ++
Sbjct: 362 VTRRTVFELRKARERGHVLEGLAVALANIDDFIAIIRAAPTPPIAKAELMSRAWDSSMVR 421

Query: 429 DLIDLIDDSS---------------YTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDI 473
           +++    +++               Y I SDG   LS+ Q + IL++RL RLTGL +D I
Sbjct: 422 EMLARAGEANEGGIEAFRPESLPAHYGIQSDGLYKLSDEQAQEILQMRLQRLTGLEQDKI 481

Query: 474 RNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDEL----DTPRRTRIVEGLLDMED 529
            NE   +  +I + LDIL+  +R+  II  EL + K++        RR+ I     D+  
Sbjct: 482 VNEYKDVMAQIADLLDILAKPARVTAIITDELNAAKNDFGIGAKDERRSTIEHNATDLAT 541

Query: 530 EDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSV 589
           ED I  +DMVVT+SH GY+K  P+S YRAQ+RGG+G+  +  +D+D++  LFI +TH  +
Sbjct: 542 EDLITPQDMVVTLSHTGYMKSQPVSEYRAQKRGGRGKQAMATKDDDWIDQLFIANTHDYI 601

Query: 590 LFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFP-EDESSWNNLYV 648
           L FS+ G +Y  KVW +P GS  +RGK ++N+  L  GE+IT I+P    + S  ++ YV
Sbjct: 602 LCFSNRGRLYWLKVWEVPQGSRNSRGKPIVNMFPLQDGEKITVILPVSGANRSFPDDRYV 661

Query: 649 VFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRF 708
             AT  G V++  LSDF    ++G IA+ LD  D ++       ++D++L +  G+ VRF
Sbjct: 662 FMATSLGTVKKTPLSDFSNPRKAGIIAVDLDEGDFLIGAALTDGQHDVMLFSDGGKAVRF 721

Query: 709 PISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGD 768
             + +R   GR + GVRG++L +  QVI++ +  +                         
Sbjct: 722 DENDVRPM-GRTARGVRGMNLEETQQVIALLVAEN------------------------- 755

Query: 769 TEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIR 828
                                      ++Q +LT +E GFGKRT   ++    R  KG+ 
Sbjct: 756 ---------------------------EQQSVLTATENGFGKRTPITEYTRHGRGTKGMI 788

Query: 829 ATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKD 888
           A   S+ N  G +VA   V+  D+I+L++  G LIR  V+EIR   RAT+GV + +    
Sbjct: 789 AIQTSERN--GKVVAATLVDSTDEIMLITTGGVLIRTRVSEIREMGRATQGVTLIAVEDG 846

Query: 889 ERVVSVERIRESEIVDEAEST 909
            ++  ++R+ ES++ D  E  
Sbjct: 847 TKLSGLQRVVESDVEDAVEGD 867



 Score = 74.1 bits (180), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 97/237 (40%), Gaps = 14/237 (5%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  V   + LG VK+ PLS +   R+ G     +   + DF+    +      V+ F
Sbjct: 655 FPDDRYVFMATSLGTVKKTPLSDFSNPRKAGIIAVDLD--EGDFLIGAALTDGQHDVMLF 712

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           S  G   +     +      ARG   +N   L + +++  ++             V+ AT
Sbjct: 713 SDGGKAVRFDENDVRPMGRTARGVRGMN---LEETQQVIALLVAEN-----EQQSVLTAT 764

Query: 653 KHGNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQCVRFP 709
           ++G  +R  ++++ +  R   G IA++      ++++       ++I+L T  G  +R  
Sbjct: 765 ENGFGKRTPITEYTRHGRGTKGMIAIQTSERNGKVVAATLVDSTDEIMLITTGGVLIRTR 824

Query: 710 ISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLIS 766
           +S IR   GR + GV  I++  G ++  +  V+ +D +        +   ++     
Sbjct: 825 VSEIREM-GRATQGVTLIAVEDGTKLSGLQRVVESDVEDAVEGDNAEGAGSEAPAAG 880


>gi|124267425|ref|YP_001021429.1| DNA gyrase subunit A [Methylibium petroleiphilum PM1]
 gi|124260200|gb|ABM95194.1| DNA gyrase subunit A [Methylibium petroleiphilum PM1]
          Length = 873

 Score =  939 bits (2426), Expect = 0.0,   Method: Composition-based stats.
 Identities = 393/922 (42%), Positives = 556/922 (60%), Gaps = 76/922 (8%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
            +  K    +S+ +EM+ SYL YA++VI+GRA+PD RDGLKPVHRR+LF M ++  +WN+
Sbjct: 2   TQFAKETLPISLEEEMRRSYLDYAMSVIVGRALPDARDGLKPVHRRVLFAMHELNNDWNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG+ A+YD + RMAQD+SLR +L++GQGNFGSVDGD  AA R
Sbjct: 62  PYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQDFSLRHMLVDGQGNFGSVDGDNAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE RL K AH +L DL K TVDF PNYDGS +EP+V+  R PN+LVNG  GIAVGMATN
Sbjct: 122 YTEIRLSKIAHEMLADLDKGTVDFGPNYDGSEKEPLVMPTRLPNLLVNGSAGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL E VD C+ ++ NP+  +D LMEII  PDFPT  +I G  G++  Y TGRG +V
Sbjct: 182 IPPHNLNETVDACLHLLKNPEASIDELMEIIPAPDFPTAGIIYGLNGVREGYRTGRGKVV 241

Query: 250 IRGVSHIEKTSGD-REQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R   H E      R+ I+V EIPYQVNK  +LE++AELV EK++  I+ ++DESD+ G 
Sbjct: 242 MRAKCHFEDIDKGARQSIIVDEIPYQVNKKTLLERMAELVHEKKLEGISHIQDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVIELKRG   +V+LN LY+ T LQ  F +NMVAL   +P+   L  +++ F+  R EV
Sbjct: 302 RVVIELKRGEVPEVVLNNLYKQTQLQDSFGINMVALVDGQPKLCNLRDLVEVFLEHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KAR+R HVL GLA+A+AN+DE + II+ SP P  A++ LM +SW++S ++
Sbjct: 362 VTRRTVFELRKARERGHVLEGLAVALANIDEFIEIIKNSPTPPLAKQGLMDKSWDSSLVR 421

Query: 429 DLIDLIDDSS---------------YTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDI 473
           +++      +               Y + +DG   LS+ Q + IL++RL RLTGL +D I
Sbjct: 422 EMLVRAASDTPGGRDAFRPEGLPAVYGMQADGLYRLSDDQAQEILQMRLQRLTGLEQDKI 481

Query: 474 RNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTP----RRTRIVEGLLDMED 529
             E   +   I + LDILS   R+  II +EL++VK E        RR+ I   + ++  
Sbjct: 482 IGEYKEVMAHIADLLDILSKPERVTTIIGEELVAVKQEFGQTKLGARRSVIEHNVQELGT 541

Query: 530 EDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSV 589
           ED I   DMVVT+SH GYVK  PL+ YRAQRRGG+G+     +D+D++  LFI +TH  +
Sbjct: 542 EDLITPTDMVVTLSHTGYVKSQPLAEYRAQRRGGRGKQATQTKDDDWIEQLFIANTHDWM 601

Query: 590 LFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFP-EDESSWNNLYV 648
           L FS+ G VY  KVW +P G   ARGK ++N+  L   E+IT ++P   E  +  ++ Y+
Sbjct: 602 LCFSNRGRVYWLKVWEVPQGGRAARGKPIVNMFPLQPNEKITVVLPLTGEFRTFPSDHYI 661

Query: 649 VFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRF 708
             +T  G V++  L +F    ++G IA+ LD  D ++       ++D++L +  G+ VRF
Sbjct: 662 FMSTALGTVKKTALDEFSNPRKAGIIAVDLDEGDHLIGAALTDGKHDVMLFSDGGKAVRF 721

Query: 709 PISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGD 768
               +R   GRN+ GVRG++L  G  VI+M +                            
Sbjct: 722 DEDDVRPM-GRNARGVRGMALEPGQNVIAMLVAED------------------------- 755

Query: 769 TEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIR 828
                                      + Q +LT +E G+GKRTS  ++    R  KG+ 
Sbjct: 756 ---------------------------ESQSVLTATENGYGKRTSITEYTRHGRGTKGMI 788

Query: 829 ATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKD 888
           A   ++ N  G +VA   V   D+I+L++D+G L+R  V+EIR   RAT+GV + S    
Sbjct: 789 AIQQTERN--GRVVAATLVRPEDEIMLITDRGVLVRTRVSEIRELGRATQGVTLISLDDG 846

Query: 889 ERVVSVERIRESEIVDEAESTE 910
            ++  ++RI E++   +A  TE
Sbjct: 847 SQLGGLQRIVENDAGSDAGDTE 868


>gi|157803418|ref|YP_001491967.1| DNA gyrase subunit A [Rickettsia canadensis str. McKiel]
 gi|157784681|gb|ABV73182.1| DNA gyrase subunit A [Rickettsia canadensis str. McKiel]
          Length = 894

 Score =  938 bits (2425), Expect = 0.0,   Method: Composition-based stats.
 Identities = 454/896 (50%), Positives = 636/896 (70%), Gaps = 8/896 (0%)

Query: 13  EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYV 72
              +  V+I DEM+ SYL YA++VI+ RAIPD+RDGLKPVHRRI++ M + G   +K Y 
Sbjct: 6   SSNLVPVNIEDEMKVSYLDYAMSVIVSRAIPDVRDGLKPVHRRIIYSMYEAGNHASKPYR 65

Query: 73  KCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTE 132
           K ARI G+VMGKYHPHG++AIYD+L RMAQD+SLRL L++GQGNFGS+DGD  AA RYTE
Sbjct: 66  KSARIVGDVMGKYHPHGDSAIYDSLVRMAQDFSLRLPLVDGQGNFGSMDGDAAAAMRYTE 125

Query: 133 CRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPT 192
            R+ K +H L++D+ K+TV F PNYDGS +EP VL A +PN+LVNG GGIAVGMATNIP 
Sbjct: 126 SRMAKVSHKLVEDIDKETVSFNPNYDGSEEEPSVLPAMFPNLLVNGSGGIAVGMATNIPP 185

Query: 193 HNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRG 252
           HNLGEV+D C   IDN DI++  L+E+++GPDFPTG++ILG +GI++AY TGRGSI++RG
Sbjct: 186 HNLGEVIDACCLYIDNNDIEILDLLEVVKGPDFPTGSMILGISGIRSAYLTGRGSIIMRG 245

Query: 253 VSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVI 312
            + IE     R+ I++TEIPY VNKA ++EKIAE+V+EKRI  I+DLRDES++ G R+ I
Sbjct: 246 RAEIENIGNSRQAIIITEIPYMVNKARLVEKIAEMVKEKRIEGISDLRDESNKNGVRIFI 305

Query: 313 ELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRR 372
           ELK+   A+V+LNQ+Y  T LQ+ F V M+AL    P+   L  ++ AFV+FRE V+  R
Sbjct: 306 ELKKDVEAEVVLNQIYACTQLQTSFGVIMLALKDGLPKVMNLKEVIAAFVSFREVVITNR 365

Query: 373 TKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLID 432
           T YLLNKARD+AH+L+GL IAV+N+DE++RII+ S +P TA++E+M R WNA +I  L+ 
Sbjct: 366 TVYLLNKARDKAHILLGLTIAVSNIDEIIRIIKASNDPNTAKQEVMARKWNALNILPLVK 425

Query: 433 LIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILS 492
           L+DD +  +   G    +EVQ +A+LE+RL RLT + ++ +  +L +L  EI E L+IL 
Sbjct: 426 LVDDKAM-LNEHGKCSFTEVQAKAVLEMRLQRLTAMEKNKLEEDLKTLATEISEYLNILG 484

Query: 493 SRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVP 552
           SR RLL I+K+EL+ VK+E  TPR T I  G  D + ED I RE+MVVTV+  GY+KRVP
Sbjct: 485 SRERLLKILKEELIKVKEEFATPRLTSIEFGEFDKDIEDLIQREEMVVTVTLGGYIKRVP 544

Query: 553 LSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQ 612
           LS YR+Q+RGGKGRSG+ MRDED  T +F+ STHT +LFFS++G VY  K+++LP+ +PQ
Sbjct: 545 LSSYRSQKRGGKGRSGLSMRDEDMTTQVFVGSTHTPMLFFSNIGKVYSLKLYKLPLSNPQ 604

Query: 613 ARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSG 672
            +G+ ++NIL L + E IT IMP PE++  W+NL ++FAT  GN+RR+ L DF +I  +G
Sbjct: 605 GKGRPMVNILPLKENEHITNIMPLPENQDEWDNLNIMFATAKGNIRRSDLLDFKKIQSNG 664

Query: 673 KIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKG 732
           KIA++LD  D+++ V+ C ++  ILL TK G+ +RFP+ ++RV   R S GVRG+ LA  
Sbjct: 665 KIAIRLDEDDKLIDVKPCKEDEHILLATKAGKALRFPVESLRVIKSRTSDGVRGMKLAGD 724

Query: 733 DQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQE 792
           D VISM ++    +  ++R  Y+     QR  I+          N   +  +++ +   E
Sbjct: 725 DSVISMTVLKGISSTKEDRDAYLSVSWEQRLEIAKGKS-----FNPEELGVSLTLDSILE 779

Query: 793 LKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQ 852
           +   E+FILTV+E GFGKR+S+Y +RI++R G GI   D++  ++ G +V V PV  +D+
Sbjct: 780 MANSEEFILTVTENGFGKRSSAYGYRITDRGGSGIINMDIN--DKTGLVVGVMPVKMDDE 837

Query: 853 IILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAES 908
           ++L+++ G LIR  +  +RI  R T GV++F     E+VVSV  I ++   +E   
Sbjct: 838 LMLITNNGKLIRCKLESVRITGRNTSGVILFKLDDGEKVVSVSLIADTSASEEDNE 893


>gi|254464123|ref|ZP_05077534.1| DNA gyrase, A subunit [Rhodobacterales bacterium Y4I]
 gi|206685031|gb|EDZ45513.1| DNA gyrase, A subunit [Rhodobacterales bacterium Y4I]
          Length = 901

 Score =  938 bits (2425), Expect = 0.0,   Method: Composition-based stats.
 Identities = 473/882 (53%), Positives = 620/882 (70%), Gaps = 8/882 (0%)

Query: 19  VSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARIS 78
           VSI  EM+NSYL YA++VI+ RAIPDLRDGLKPVHRRIL+ M + G   +K Y K AR  
Sbjct: 16  VSIEAEMRNSYLDYAMSVIVSRAIPDLRDGLKPVHRRILYAMHESGNTHDKAYRKSARPV 75

Query: 79  GEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQKA 138
           G+VMGKYHPHG++AIYDAL RMAQD+S+ L L++GQGNFGS+DGD PAA RYTE R+ K 
Sbjct: 76  GDVMGKYHPHGDSAIYDALVRMAQDFSMSLPLLDGQGNFGSMDGDNPAAMRYTEVRMDKP 135

Query: 139 AHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGEV 198
           A  LL D+ K+TVDF+ NYDG  +EP VL AR+PN+LVNG GGIAVGMATNIP HNLGEV
Sbjct: 136 AAALLADIEKETVDFQDNYDGKDREPTVLPARFPNMLVNGAGGIAVGMATNIPPHNLGEV 195

Query: 199 VDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIEK 258
           VD  +A+I++PD+  + L+E I GPDFPTGA++LGR+G + AY  GRGS++IR  + +E+
Sbjct: 196 VDATLALIEDPDLTSEQLIEYIPGPDFPTGALMLGRSGARKAYLEGRGSVIIRAKTRVEE 255

Query: 259 TSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRGA 318
              DR  IVV EIPYQVNKAAM+EKIAE VREK+I  +A ++DESDR G RVV+ELKR A
Sbjct: 256 IRKDRYAIVVDEIPYQVNKAAMIEKIAEQVREKKIEGVAHVQDESDRNGVRVVVELKRDA 315

Query: 319 SADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLLN 378
           + +V+LNQLYR+T +Q+ F  NM+ALNG +PE+ TL   L +F+ FRE+VV RRT +LL 
Sbjct: 316 TPEVVLNQLYRFTPMQTYFGCNMLALNGGRPEQLTLRRFLTSFIDFREDVVARRTAHLLR 375

Query: 379 KARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSS 438
           KAR+R+H+L GLA+AV N+DE+V  IR S +   AR +LM R W A  I + I LIDD +
Sbjct: 376 KARERSHILCGLAVAVTNIDEIVTTIRQSTDAAEAREKLMTRRWPAQPILEYIALIDDPT 435

Query: 439 YTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLL 498
           +T   DGT  LSE Q RAILELRL RLT +G  ++ +EL  L  +IK+ L+ILSSR R++
Sbjct: 436 HTANDDGTYNLSEAQARAILELRLQRLTQIGVKEVTDELEELAGKIKDYLEILSSRERIM 495

Query: 499 GIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYRA 558
           GII  EL  V+D    PRRT IV+   DMEDED I REDMVVTV+  G++KR PL+ +RA
Sbjct: 496 GIISDELREVRDNFAVPRRTEIVDWSGDMEDEDLIEREDMVVTVTSGGWIKRTPLADFRA 555

Query: 559 QRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKAL 618
           Q+RGGKG SG+  ++ED VT LF+ +THT +LFF++ G VYK K WRLP      +GKA+
Sbjct: 556 QKRGGKGLSGMQTKEEDVVTTLFVANTHTQLLFFTTDGMVYKLKTWRLPQSGRTGKGKAI 615

Query: 619 INILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKL 678
           +NIL +  G  I  IMP    +  W NL VVFAT  G+VRRN+LSDF  + R+GKIAMKL
Sbjct: 616 VNILPIPTGVSIAAIMPVDVPDEEWENLQVVFATSGGDVRRNRLSDFTNVRRNGKIAMKL 675

Query: 679 DSR--DEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVI 736
                 ++++V  C++++D++L T  G+ +RF  + +RVF  R S GVRGI L   D V+
Sbjct: 676 PEDGSVKLVNVRICSEDDDVMLFTNSGRAIRFRSTDVRVFNSRESTGVRGIRLTGEDSVV 735

Query: 737 SMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLK 796
           SM+++ H+    ++R  Y+K     RR ++G T++  +   D+  + N S E   E+   
Sbjct: 736 SMSVIRHSKYTPEQRTAYLK----MRRAMAGLTDDAEASDEDAPEDPNFSTELYAEMSAA 791

Query: 797 EQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILV 856
           E  ILT++  G GK +SS+D+ +  R G G+ A D  K    G +VA FPV  +DQI+L 
Sbjct: 792 ENLILTITAGGSGKLSSSHDYPVRGRGGMGVTAMD--KAMRGGEIVASFPVELDDQIMLA 849

Query: 857 SDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
           + KG  IRVPV+ I   SR+  GV +F+T K E VVSV  I 
Sbjct: 850 TSKGQSIRVPVDGISFRSRSAGGVRVFNTGKGEEVVSVAWIA 891


>gi|92114290|ref|YP_574218.1| DNA gyrase subunit A [Chromohalobacter salexigens DSM 3043]
 gi|91797380|gb|ABE59519.1| DNA gyrase subunit A [Chromohalobacter salexigens DSM 3043]
          Length = 907

 Score =  938 bits (2425), Expect = 0.0,   Method: Composition-based stats.
 Identities = 411/912 (45%), Positives = 579/912 (63%), Gaps = 49/912 (5%)

Query: 11  EEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKK 70
           E  + I  V+I DE++ SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++G +WNK 
Sbjct: 3   EIAREILPVNIEDELKQSYLDYAMSVIIGRALPDVRDGLKPVHRRVLFAMHELGNDWNKA 62

Query: 71  YVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERY 130
           Y K AR+ G+V+GKYHPHG++A+YD + RMAQ++S+R +L++GQGNFGS+DGD  AA RY
Sbjct: 63  YKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQEFSMRYVLVDGQGNFGSIDGDSAAAMRY 122

Query: 131 TECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNI 190
           TE R+ + AH LL DL KDTVD+  NYDG+ + P VL  + PN+LVNG  GIAVGMATNI
Sbjct: 123 TEVRMSRLAHELLADLEKDTVDWVDNYDGTERIPEVLPTKVPNLLVNGASGIAVGMATNI 182

Query: 191 PTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVI 250
           P HN+ E++DGC+A+ID+  + +D LM  I GPDFPTG +I GR GI  AY TGRG I +
Sbjct: 183 PPHNMREIIDGCLALIDDYTLSIDDLMAYIPGPDFPTGGIINGRAGILEAYRTGRGRIYV 242

Query: 251 RGVSHIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYR 309
           R    IE      R+ I+VTE+PYQVNKA ++EKIAELV++KRI  IA+LRDESD++G R
Sbjct: 243 RARHTIEHDEKTGRDHIIVTELPYQVNKARLIEKIAELVKDKRIEGIAELRDESDKEGLR 302

Query: 310 VVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVV 369
           VVIE+KRG S DV++N L+ +T LQ++F +NMVAL+  +P+   L  IL+AFV  R EVV
Sbjct: 303 VVIEVKRGESGDVVVNNLFAHTQLQTVFGINMVALDNGQPKILNLKEILEAFVRHRREVV 362

Query: 370 VRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKD 429
            RRT + L KARDR H+L GLA+A++N+DEV+ +I+ SP+   A+ +L+ R+W    + D
Sbjct: 363 TRRTLFELKKARDRGHILEGLAVAISNIDEVIELIKASPSAAEAKEKLVARAWRPGQVTD 422

Query: 430 LIDLIDDSSYTIGS----------DGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
           +++    +S                    LS  Q +AILELRL RLTGL  + + +E  S
Sbjct: 423 MLERAGATSCKPEDLEEGYGLAEGQNEYRLSPAQAQAILELRLHRLTGLETEKLLDEYLS 482

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           +   I E  +IL+S  RLL +I++EL +++D+    R+T I    LD+  ED I  EDMV
Sbjct: 483 ILKRIAELNEILASPERLLDVIREELQAIRDQYGDERKTEIQASHLDLTIEDLINEEDMV 542

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           VT+S  GY K  PLS Y+AQRRGG+G+S   M+DED +  L + STH +VL FS+ G VY
Sbjct: 543 VTISRSGYAKTQPLSDYQAQRRGGRGKSATTMKDEDIIEHLLVASTHDTVLLFSNRGKVY 602

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
             KV+ +P  S  +RGK LIN+L L++GE I  I+P  E      + Y+ FAT  G V+R
Sbjct: 603 WLKVYEMPNASRGSRGKPLINLLPLDEGEAINAILPVREYR---EDSYIFFATAKGTVKR 659

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
             L  F +    G IA+ L+  D ++     +  +  +L +  G+ +RF    +R   GR
Sbjct: 660 TSLEQFSRPRSVGLIAIDLEEDDRLVGAAITSGNDHAMLLSSNGKAIRFEEGNVRAM-GR 718

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
            + GVRG+ L  G +VIS+ I                                 SL  D+
Sbjct: 719 TARGVRGMRLQGGAEVISLII-------------------------------PQSLTIDA 747

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
             + +  E   + +   + +ILT SE G+GKRT   +F +  R G+G+ A   S+ N  G
Sbjct: 748 ETDDDAEERPVETVGEDQVYILTASENGYGKRTRLDEFPLRGRGGQGVIAMQTSQRN--G 805

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
           ALVA   V D+D+++L++DKGTL+R  V E+ ++SR T+GV +  T + E +V+  R+ E
Sbjct: 806 ALVAAIQVRDSDEMMLITDKGTLVRTRVGEVSVSSRNTQGVTLIRTGEGEHLVATVRVDE 865

Query: 900 SE-IVDEAESTE 910
            + + D+A   E
Sbjct: 866 PDAVEDDALDAE 877



 Score = 62.9 bits (151), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 46/269 (17%), Positives = 95/269 (35%), Gaps = 19/269 (7%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  +   +  G VKR  L  +   R  G     + + ++D +    I S +   +  
Sbjct: 642 YREDSYIFFATAKGTVKRTSLEQFSRPRSVG--LIAIDLEEDDRLVGAAITSGNDHAMLL 699

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNL------ 646
           SS G   + +   +      ARG   + +    +   +        D  + ++       
Sbjct: 700 SSNGKAIRFEEGNVRAMGRTARGVRGMRLQGGAEVISLIIPQSLTIDAETDDDAEERPVE 759

Query: 647 -------YVVFATKHGNVRRNKLSDF--IQINRSGKIAMKLDSRDEILSVETC-TQENDI 696
                  Y++ A+++G  +R +L +F        G IAM+   R+  L         +++
Sbjct: 760 TVGEDQVYILTASENGYGKRTRLDEFPLRGRGGQGVIAMQTSQRNGALVAAIQVRDSDEM 819

Query: 697 LLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMK 756
           +L T  G  VR  +  +   + RN+ GV  I   +G+ +++   V   DA  D+ +    
Sbjct: 820 MLITDKGTLVRTRVGEV-SVSSRNTQGVTLIRTGEGEHLVATVRVDEPDAVEDDALDAEA 878

Query: 757 HMSAQRRLISGDTEEITSLKNDSSVEGNI 785
             S +    +  T              + 
Sbjct: 879 LDSEEGAATAEATPTPDDGAPSDEAPQDD 907


>gi|229586449|ref|YP_002844950.1| DNA gyrase subunit A [Rickettsia africae ESF-5]
 gi|228021499|gb|ACP53207.1| DNA gyrase subunit A [Rickettsia africae ESF-5]
          Length = 905

 Score =  938 bits (2424), Expect = 0.0,   Method: Composition-based stats.
 Identities = 455/891 (51%), Positives = 634/891 (71%), Gaps = 8/891 (0%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++    +  V+I DEM+ SYL YA++VI+ RAIPD+RDGLKPVHRRI++ M + G   +K
Sbjct: 3   DKSSSNLVPVNIEDEMKVSYLDYAMSVIVSRAIPDVRDGLKPVHRRIIYSMHEAGNHASK 62

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+VMGKYHPHG++AIYDAL RMAQD+SLRL L++GQGNFGS+DGD  AA R
Sbjct: 63  PYRKSARIVGDVMGKYHPHGDSAIYDALVRMAQDFSLRLPLVDGQGNFGSMDGDAAAAMR 122

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE R+ K ++ L++D+ K+TV F PNYDGS +EP VL A +PN+LVNG GGIAVGMATN
Sbjct: 123 YTESRMAKVSYKLVEDIDKETVSFNPNYDGSEEEPSVLPAMFPNLLVNGSGGIAVGMATN 182

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNLGEV+D C   IDN DI++  L+E+++GPDFPTG++ILG +GI++AY TGRGSI+
Sbjct: 183 IPPHNLGEVIDACCLYIDNNDIEILDLLEVVKGPDFPTGSMILGISGIRSAYLTGRGSII 242

Query: 250 IRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYR 309
           +RG + IE     R+ I++TEIPY VNKA ++EKIAE+V+EKRI  I+DLRDES++ G R
Sbjct: 243 MRGRAEIENIDNSRQAIIITEIPYMVNKARLVEKIAEMVKEKRIEGISDLRDESNKNGVR 302

Query: 310 VVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVV 369
           + IELK+   A+V+LNQ+Y  T LQ+ F V M+AL    P+   L  ++ AFV+FRE V+
Sbjct: 303 IFIELKKDVVAEVVLNQIYACTQLQTSFGVIMLALKDGLPKVMNLKEVIAAFVSFREVVI 362

Query: 370 VRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKD 429
             RT YLLNKARDRAH+L+GL IAV+N+DE++RII+ S +P  A++ELM R W A +I  
Sbjct: 363 TNRTIYLLNKARDRAHILLGLTIAVSNIDEIIRIIKASNDPNAAKQELMARQWEALNILP 422

Query: 430 LIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLD 489
           L+ L+DD +  +   G    +EVQ +AILE+RL RLT + ++ +  +L +L  EI E L+
Sbjct: 423 LVKLVDDKAM-LNEQGKCNFTEVQAKAILEMRLQRLTAMEKNKLEEDLKNLITEITEYLN 481

Query: 490 ILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVK 549
           IL SR+RLL I+K+EL+ VK+E  TPR T I  G  D + ED I RE+MVVTV+  GY+K
Sbjct: 482 ILGSRTRLLEILKEELIKVKEEFATPRLTSIEFGEFDQDIEDLIQREEMVVTVTLGGYIK 541

Query: 550 RVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIG 609
           RVPLS YRAQ+RGGKGRSG+ MRDED  T +F+ STHT +LFFS++G VY  K+++LP+ 
Sbjct: 542 RVPLSSYRAQKRGGKGRSGLSMRDEDITTQVFVGSTHTPMLFFSNIGQVYSLKLYKLPLS 601

Query: 610 SPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQIN 669
           +PQ +G+ ++NIL L   E IT IMP PE++   +NL ++FAT  GN+RR+ L DF ++ 
Sbjct: 602 NPQGKGRPMVNILPLKANEHITNIMPLPENQDERDNLNIMFATAKGNIRRSDLLDFTKLQ 661

Query: 670 RSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISL 729
            +GKIA++LD  D+++ V+ C ++  ILL TK G+ +RFP+ ++RV   R S GVRG+ L
Sbjct: 662 SNGKIAIRLDEDDKLIDVKPCKEDEHILLATKAGKALRFPVESLRVIKSRTSDGVRGMKL 721

Query: 730 AKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEER 789
           AK D VISM ++    +  ++R  Y+     QR  I+        + N   +  +++   
Sbjct: 722 AKEDSVISMTVLKGISSTKEDRDAYLSVPWEQRLEIAKGE-----VFNPEELGVSLTAPA 776

Query: 790 CQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVND 849
             E+   E+FILTV+E GFGKR+S+Y +RI++R G GI   D++  ++ G +V V PV  
Sbjct: 777 IVEMANSEEFILTVTENGFGKRSSAYGYRITDRGGSGIINMDIN--DKTGLVVGVMPVKM 834

Query: 850 NDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900
           +D+++L+++ G LIR  +  +RI  R T GV++F     E+VVSV  I E+
Sbjct: 835 DDELMLITNSGKLIRCKLESVRITGRNTSGVILFKLDDGEKVVSVSLIAET 885


>gi|54297327|ref|YP_123696.1| DNA gyrase, subunit A, type II topoisomerase [Legionella
           pneumophila str. Paris]
 gi|53751112|emb|CAH12523.1| DNA gyrase, subunit A, type II topoisomerase [Legionella
           pneumophila str. Paris]
          Length = 863

 Score =  938 bits (2424), Expect = 0.0,   Method: Composition-based stats.
 Identities = 412/906 (45%), Positives = 570/906 (62%), Gaps = 68/906 (7%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
           K +  V+I DE++ SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++G +WNK Y K
Sbjct: 6   KEVLPVNIEDELKQSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMSELGNDWNKPYKK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            AR+ G+V+GKYHPHG+ A+YD + RMAQ +S+R LLI+GQGNFGSVDGD PAA RYTE 
Sbjct: 66  SARVVGDVIGKYHPHGDTAVYDTIVRMAQPFSMRYLLIDGQGNFGSVDGDAPAAMRYTEV 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K AH LL DL K+TVDF PNYD +   PVVL +R PN+LVNG  GIAVGMATNIP H
Sbjct: 126 RMSKVAHALLADLDKETVDFSPNYDETEFAPVVLPSRIPNLLVNGSSGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NL EV++ C+A++D PD  L+ LMEII GPDFPT A+I GR GI   Y TG+G +VIR  
Sbjct: 186 NLTEVINACIALVDEPDTSLEDLMEIIPGPDFPTAAIINGRAGIIEGYRTGKGRVVIRAR 245

Query: 254 SHIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVI 312
           + IE   S  R+ I++ E+PYQVNKA ++E+IAELVR+K++  I+ LRDESD+QG RVVI
Sbjct: 246 TEIETDESSGRQSIIIQELPYQVNKARLIERIAELVRDKKVEGISGLRDESDKQGMRVVI 305

Query: 313 ELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRR 372
           ELKR   ADV+LN L+ +T +Q++F +NMVAL   +P    L  IL+ F+  R EVV RR
Sbjct: 306 ELKRNEVADVVLNNLFAHTQMQNVFGINMVALVDGQPRTLNLKQILEYFIKHRREVVTRR 365

Query: 373 TKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLID 432
           T + L KAR RAH+L GL IA+AN+DE++ +I+ SP P+ A+  L+ + W    +K +++
Sbjct: 366 TIFELKKARSRAHLLEGLGIALANIDEMIALIKQSPTPQDAKSALLSKIWQPGLVKAMLE 425

Query: 433 LIDDSSYTIGS--------DGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEI 484
               ++             +    LSE Q +AILELRL RLT L +D I NE   L   I
Sbjct: 426 KAGSNASRPDDLTEEYGLHENGYKLSEAQAQAILELRLHRLTALEQDKIINEFEELLNLI 485

Query: 485 KECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSH 544
           KE LDIL+S  RL+ +I+ EL+ +K +    RRT I     D+  ED I  ED+VVT+SH
Sbjct: 486 KELLDILASPERLMQVIRDELIEIKSQFGDERRTEITASQEDLTIEDLITEEDVVVTLSH 545

Query: 545 LGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVW 604
            GYVK  P++ Y+AQRRGGKG+S   ++DEDFV  L I STH ++L FS+ G +Y  K +
Sbjct: 546 QGYVKYQPITAYQAQRRGGKGKSATHVKDEDFVERLVIASTHDTLLCFSNHGKLYWLKAY 605

Query: 605 RLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSD 664
           +LP  S  +RG+ +INIL L +GE I  ++P  E +   +  YV  ATK G V++  L+ 
Sbjct: 606 QLPQASRASRGRPIINILPLAEGEEINAMLPVREYK---DGSYVFMATKKGTVKKVPLNA 662

Query: 665 FIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGV 724
           F +   +G IA+ L+  D ++ V+      DI+L T  G+ +RF  + +R   GR + GV
Sbjct: 663 FSRPRSNGIIAVDLEEDDSLVGVDITDGTRDIMLFTDAGKVIRFDENKVRPM-GRTARGV 721

Query: 725 RGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGN 784
           RGI + K   V S+ +V                                           
Sbjct: 722 RGIRVEKDQAVKSLVVVDP----------------------------------------- 740

Query: 785 ISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAV 844
                          ILT +E G+GKRT   ++R+S R G+G+ +  V++ N  G +V  
Sbjct: 741 -----------NGGTILTATENGYGKRTHIDEYRVSGRGGQGVISIQVTERN--GKVVRS 787

Query: 845 FPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE-SEIV 903
             V DND+ +L++DKGTL+R  VNE+ +  R T+GV + + +  E VV +++I +  E +
Sbjct: 788 LQVTDNDEAMLITDKGTLVRFKVNELSVIGRNTQGVRLINVSSGETVVGMQKIVDLGEEL 847

Query: 904 DEAEST 909
           +EAE +
Sbjct: 848 EEAEDS 853


>gi|254468943|ref|ZP_05082349.1| DNA gyrase, A subunit [beta proteobacterium KB13]
 gi|207087753|gb|EDZ65036.1| DNA gyrase, A subunit [beta proteobacterium KB13]
          Length = 855

 Score =  938 bits (2424), Expect = 0.0,   Method: Composition-based stats.
 Identities = 402/909 (44%), Positives = 565/909 (62%), Gaps = 67/909 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
            +  K    VS+ DEM+ SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M ++   +N+
Sbjct: 2   NQFAKETLPVSLEDEMKKSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMHELSNSYNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG+ A YD + RMAQD+SLR +L++GQGNFGS+DGD  AA R
Sbjct: 62  PYKKSARIVGDVIGKYHPHGDTAAYDTIVRMAQDFSLRYMLVDGQGNFGSIDGDNAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE R+ K +H LL D+ KDTVDF PNYDGS  EP+++  R PN+L+NG  GIAVGMATN
Sbjct: 122 YTEIRMSKISHELLADIDKDTVDFGPNYDGSENEPLIMPTRIPNLLINGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL EV++ CV ++DNP+I +D L+  I GPDFPT  +I G +GIK  Y TGRG +V
Sbjct: 182 IPPHNLTEVINACVEILDNPNISIDELLNFIPGPDFPTAGIIHGNSGIKEGYRTGRGRVV 241

Query: 250 IRGVSHIEKTSGD-REQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R  +H E+T    RE I++ E+PYQVNK  +LEKIAELV +K++  I+DLRDESD+ G 
Sbjct: 242 MRARTHFEETDKGKREAIIIDELPYQVNKKNLLEKIAELVNDKKLEGISDLRDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVIELKRG   DV+LN LY+ T LQ  F +NMVAL   +P+   L  +L AF+  R EV
Sbjct: 302 RVVIELKRGEIPDVVLNNLYKQTQLQDSFGINMVALIDGQPKLLNLKQVLDAFLNHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           + RRT + L KAR+R H+L GLA+A+ N+DE+++II+ SP+P  A+ ELMQR W +S + 
Sbjct: 362 ITRRTVFELRKARERGHILEGLAVALENVDEMIKIIKSSPSPVEAKTELMQREWKSSVVS 421

Query: 429 DLIDLIDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
            ++   D + Y            +    LS++Q + IL++RL RLTGL +D I NE   +
Sbjct: 422 SMLKQGDATQYRPEGLLSVYGLKENGYKLSDIQAQEILQMRLQRLTGLEQDKIVNEYKEI 481

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
              I + +DIL+   R+  IIK EL  +K+     RR+ IVE   D+  ED I  +DMVV
Sbjct: 482 MDVIADLIDILNKPDRVTSIIKTELEEIKETYGDDRRSEIVENAEDLSIEDLIAPQDMVV 541

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           T+SH GY+K   L  YRAQ+RGG+G+     +D+DF+  +F+ ++H ++L FSS G VY 
Sbjct: 542 TLSHTGYIKAQALDDYRAQKRGGRGKQATATKDDDFIDQMFVANSHDNILCFSSRGQVYW 601

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
            KV+ +P GS  +RGK ++N+  L  GE+I  I+   E     +N Y+  AT  G V++ 
Sbjct: 602 LKVYEVPQGSRVSRGKPIVNLFPLMPGEKINAILTVKEFV---DNEYIFMATAKGTVKKT 658

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
            LSDF    +SG IA+KLD+ D ++       ENDI+L +  G+ V F  S +R   GRN
Sbjct: 659 PLSDFSNPRKSGIIAIKLDNGDYLIGAGITKGENDIVLVSNHGKAVWFGESDVRSM-GRN 717

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSS 780
           + GVRG+ L  G +V+S+ I  +                                     
Sbjct: 718 ARGVRGMKLTDGGEVLSLLIAEN------------------------------------- 740

Query: 781 VEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGA 840
                          + Q ++  +E G+GKRT   +FR S R  +G++A  VS  N  G 
Sbjct: 741 ---------------EAQSVMVATENGYGKRTLLSEFRRSGRGTQGVKAIQVSDRN--GQ 783

Query: 841 LVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900
           +V    V D+D+++L++  G LIR  V+EIR   RAT+GV + + + DE++  +E++ ES
Sbjct: 784 VVGAKLVGDHDELMLITTGGVLIRTRVSEIRELGRATQGVTLINLSDDEKLRGLEKVAES 843

Query: 901 EIVDEAEST 909
           E  DE +  
Sbjct: 844 EHHDEEDGD 852


>gi|67459447|ref|YP_247071.1| DNA gyrase subunit A [Rickettsia felis URRWXCal2]
 gi|75536139|sp|Q4UKM1|GYRA_RICFE RecName: Full=DNA gyrase subunit A
 gi|67004980|gb|AAY61906.1| DNA gyrase subunit A [Rickettsia felis URRWXCal2]
          Length = 906

 Score =  938 bits (2424), Expect = 0.0,   Method: Composition-based stats.
 Identities = 458/891 (51%), Positives = 637/891 (71%), Gaps = 8/891 (0%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++    +  V+I DEM+ SYL YA++VI+ RAIPD+RDGLKPVHRRI++ M + G   +K
Sbjct: 3   DQNFSNLVPVNIEDEMKVSYLDYAMSVIVSRAIPDVRDGLKPVHRRIIYSMYEAGNHASK 62

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+VMGKYHPHG++AIYD+L RMAQD+SLRL L++GQGNFGS+DGD  AA R
Sbjct: 63  PYRKSARIVGDVMGKYHPHGDSAIYDSLVRMAQDFSLRLPLVDGQGNFGSMDGDAAAAMR 122

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE R+ K +H L++D+ K+TV F PNYDGS +EP VL A +PN+LVNG GGIAVGMATN
Sbjct: 123 YTESRMAKVSHKLVEDIDKETVSFNPNYDGSEEEPSVLPAMFPNLLVNGSGGIAVGMATN 182

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNLGEV+D C   IDN DI++  L+E+++GPDFPTG++ILG +GI++AY TGRGSI+
Sbjct: 183 IPPHNLGEVIDACCLYIDNNDIEILDLLEVVKGPDFPTGSMILGISGIRSAYLTGRGSII 242

Query: 250 IRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYR 309
           +RG + IE     R+ I++TEIPY VNKA ++EKIAE+V+EKRI  I+DLRDES++ G R
Sbjct: 243 MRGRAEIENIGNSRQAIIITEIPYMVNKARLVEKIAEMVKEKRIEGISDLRDESNKNGVR 302

Query: 310 VVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVV 369
           + IELK+    +V+LNQ+Y  T LQ+ F V M+AL    P+   L  ++ AFV+FRE V+
Sbjct: 303 IFIELKKDVVVEVVLNQIYACTQLQTSFGVIMLALKDGLPKVMNLKEVIAAFVSFREVVI 362

Query: 370 VRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKD 429
             RT YLLNKARDRAH+L+GL IAV+N+DE++RII+ S NP  A++ELM RSW+A +I  
Sbjct: 363 TNRTIYLLNKARDRAHILLGLTIAVSNIDEIIRIIKASNNPNAAKQELMARSWDALNILP 422

Query: 430 LIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLD 489
           L+ L+DD +  +   G    +EVQ +AILE+RL RLT + ++ +  +L +L  EI E L+
Sbjct: 423 LVKLVDDKAM-LNEQGKCSFTEVQAKAILEMRLQRLTAMEKNKLEEDLKNLATEITEYLN 481

Query: 490 ILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVK 549
           IL SR+RLL I+K+EL+ VK+E  TPR T I  G  D + ED I RE+MVVTV+  GY+K
Sbjct: 482 ILGSRTRLLEILKEELIKVKEEFATPRLTSIEFGEFDQDIEDLIQREEMVVTVTLGGYIK 541

Query: 550 RVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIG 609
           RVPLS YRAQ+RGGKGRSG+ MRDED  T +F+ STHT +LFFS++G VY  K+++LP+ 
Sbjct: 542 RVPLSSYRAQKRGGKGRSGLSMRDEDITTQVFVGSTHTPMLFFSNIGQVYSLKLYKLPLS 601

Query: 610 SPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQIN 669
           +PQ +G+ ++NIL L + E IT IMP PE++  W+NL ++FAT  GN+RR+ L DF +I 
Sbjct: 602 NPQGKGRPMVNILPLKENEHITNIMPLPENQDEWDNLNIMFATAKGNIRRSDLLDFKKIQ 661

Query: 670 RSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISL 729
            +GKIA++LD  D+++ V+ C ++  ILL TK G+ +RFP+ ++RV   R S GVRG+ L
Sbjct: 662 SNGKIAIRLDEDDKLIDVKPCKEDEHILLATKAGKALRFPVESLRVIKSRTSDGVRGMKL 721

Query: 730 AKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEER 789
           AK D VISM ++    +  ++R  Y+     +R  I+   E      N   +   ++ + 
Sbjct: 722 AKEDSVISMTVLKGISSTKEDRDAYLTVPWEKRLEIAKGEE-----FNLEELGVTLTADS 776

Query: 790 CQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVND 849
             E+   E+FILTV+E GFGKR+S+Y +RI++R G GI   D++  ++ G +V V PV  
Sbjct: 777 ILEMANSEEFILTVTENGFGKRSSAYGYRITDRGGSGIINMDIN--DKTGLVVGVMPVKM 834

Query: 850 NDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900
           +D+++L+++ G LIR  +  +RI  R T GV++F     E+VVSV  I E+
Sbjct: 835 DDELMLITNSGKLIRCKLESVRITGRNTSGVILFKLDDGEKVVSVSLIAET 885



 Score = 69.8 bits (169), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 50/352 (14%), Positives = 126/352 (35%), Gaps = 18/352 (5%)

Query: 415 RELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIR 474
            ++  + +  S    ++   +           + LS  Q +      +  +  L  ++  
Sbjct: 566 EDITTQVFVGSTHTPMLFFSNIGQVYSLKLYKLPLSNPQGK---GRPMVNILPLKENEHI 622

Query: 475 NELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIV 534
             +  L     E  ++    +   G I++  L    ++ +  +  I     D   +    
Sbjct: 623 TNIMPLPENQDEWDNLNIMFATAKGNIRRSDLLDFKKIQSNGKIAIRLDEDDKLIDVKPC 682

Query: 535 REDMVVTV-SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
           +ED  + + +  G   R P+   R           +  R  D V  + +    + +    
Sbjct: 683 KEDEHILLATKAGKALRFPVESLR----------VIKSRTSDGVRGMKLAKEDSVISMTV 732

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
             G    ++     +  P  +   +      N  E   T+      E + +  +++  T+
Sbjct: 733 LKGISSTKEDRDAYLTVPWEKRLEIAKGEEFNLEELGVTLTADSILEMANSEEFILTVTE 792

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVRFPI 710
           +G  +R+    +   +R G   + +D  D+    + V     +++++L T  G+ +R  +
Sbjct: 793 NGFGKRSSAYGYRITDRGGSGIINMDINDKTGLVVGVMPVKMDDELMLITNSGKLIRCKL 852

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
            ++R   GRN+ GV    L  G++V+S++++       ++         A+ 
Sbjct: 853 ESVR-ITGRNTSGVILFKLDDGEKVVSVSLIAETSESEEDSELEEDLEQAEE 903


>gi|242238485|ref|YP_002986666.1| DNA gyrase subunit A [Dickeya dadantii Ech703]
 gi|242130542|gb|ACS84844.1| DNA gyrase, A subunit [Dickeya dadantii Ech703]
          Length = 878

 Score =  938 bits (2424), Expect = 0.0,   Method: Composition-based stats.
 Identities = 406/903 (44%), Positives = 572/903 (63%), Gaps = 68/903 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMSVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGS+DGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEVR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + + AH LL DL K+TVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MARIAHELLSDLDKETVDFVPNYDGTEQIPDVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A ID+ +I ++ LM  I GPDFPT A+I G+ GI+ AY TGRG + IR  +
Sbjct: 187 LSEVIDGCLAYIDDENISVEGLMTYIPGPDFPTAAIINGKRGIEEAYRTGRGKVYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV++KRI  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADEKSGRETIIVHEIPYQVNKARLIEKIAELVKDKRIEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T +Q  F +NMVAL+  +P+  TL  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNHLYSQTQMQVSFGINMVALHQGQPKLMTLKEILAAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KAR+RAH+L GLA+A+ N+D ++ +IR +  P  A+  L+ ++W    +  +++ 
Sbjct: 367 IFELRKARERAHILEGLAVALVNIDPIIELIRHASTPADAKAALVAQAWELGSVAAMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  +L+E Q +AIL+LRL +LTGL  + + +E   L  +I 
Sbjct: 427 AGDDAARPEWLEPEFGIRDGKYHLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTQIA 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
             L IL S  RL+ +I++EL ++K++ +  RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ALLFILRSPERLMEVIREELEAIKEQYNDQRRTEITHNSADINIEDLISQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PLS Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDQLLVANTHDTILCFSSRGRLYWLKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ +IN+L L Q ERIT I+P  E E     L V  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIINLLPLEQNERITAILPVREYE---EGLNVFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L +  G+ VRF  SA+R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNDGDELIGVDLTDGSNEVMLFSAEGKVVRFSESAVRTM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+V+S+ +                                             
Sbjct: 723 GINLQDDDRVVSLIVPRGEGD--------------------------------------- 743

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                         ILTV+E G+GKRT+  D+   +R+ KG+ +  VS+ N  G +V   
Sbjct: 744 --------------ILTVTENGYGKRTAINDYPTKSRATKGVISIKVSERN--GNVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V+  DQI++++D GTL+R  V+E+ I  R T+GV +  TA++ERVV ++R+ E    DE
Sbjct: 788 QVDTTDQIMMITDAGTLVRTRVSEVSIVGRNTQGVTLIRTAEEERVVGLQRVAEPVEDDE 847

Query: 906 AES 908
            + 
Sbjct: 848 LDG 850



 Score = 69.1 bits (167), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 43/246 (17%), Positives = 84/246 (34%), Gaps = 15/246 (6%)

Query: 538 MVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGF 597
            V   +  G VK+  L+ +   R  G     +   DE    DL        V+ FS+ G 
Sbjct: 645 NVFMATASGTVKKTALTEFSRPRSAGIIAVNLNDGDELIGVDL--TDGSNEVMLFSAEGK 702

Query: 598 VYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNV 657
           V +     +      A G   IN+   ++                     ++  T++G  
Sbjct: 703 VVRFSESAVRTMGRTATGVRGINLQDDDR---------VVSLIVPRGEGDILTVTENGYG 753

Query: 658 RRNKLSDFIQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVRFPISAIR 714
           +R  ++D+   +R+ K  + +   +     +        + I++ T  G  VR  +S + 
Sbjct: 754 KRTAINDYPTKSRATKGVISIKVSERNGNVVGAVQVDTTDQIMMITDAGTLVRTRVSEV- 812

Query: 715 VFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITS 774
              GRN+ GV  I  A+ ++V+ +  V     D +               +  + +    
Sbjct: 813 SIVGRNTQGVTLIRTAEEERVVGLQRVAEPVEDDELDGVVAVDGEELAEDMPDEPDNEDD 872

Query: 775 LKNDSS 780
              D  
Sbjct: 873 APVDDE 878


>gi|254461178|ref|ZP_05074594.1| DNA gyrase, A subunit [Rhodobacterales bacterium HTCC2083]
 gi|206677767|gb|EDZ42254.1| DNA gyrase, A subunit [Rhodobacteraceae bacterium HTCC2083]
          Length = 920

 Score =  938 bits (2423), Expect = 0.0,   Method: Composition-based stats.
 Identities = 470/919 (51%), Positives = 619/919 (67%), Gaps = 15/919 (1%)

Query: 1   MTEHIISSDEEEEKGIT-------SVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVH 53
           M +   + + E E           S+SIT EM+ SYL YA++VI+ RAIPDLRDGLKPVH
Sbjct: 1   MNDTPETPENEGESQPVVSTYTGPSISITQEMKTSYLDYAMSVIVSRAIPDLRDGLKPVH 60

Query: 54  RRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEG 113
           RRIL+ M + G    K Y K AR  G+VMGKYHPHG++AIYDAL RMAQD+S+ L L++G
Sbjct: 61  RRILYAMHEAGNTHEKSYRKSARAVGDVMGKYHPHGDSAIYDALVRMAQDFSMSLPLLDG 120

Query: 114 QGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPN 173
           QGNFGS+DGD  AA RYTE R+ K A FLL D+ K+TVDF+ NYDG  +EP VL ARYPN
Sbjct: 121 QGNFGSMDGDNAAAMRYTEVRMDKPAAFLLSDIDKETVDFQDNYDGKDREPTVLPARYPN 180

Query: 174 VLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILG 233
           +LVNG GGIAVGMATNIP HNLGEVV   +A+I+NPD+  + L+  + GPDFPTG ++LG
Sbjct: 181 MLVNGAGGIAVGMATNIPPHNLGEVVTATLALIENPDLTTEELIAYVPGPDFPTGGIMLG 240

Query: 234 RTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRI 293
           R+G + AY  GRGS+VIR  + +E+   DR  IV+ EIPYQVNK+ M+EKIAE VREK+I
Sbjct: 241 RSGARKAYLEGRGSVVIRSKTRVEEIRKDRYAIVIDEIPYQVNKSTMIEKIAEQVREKKI 300

Query: 294 VDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFT 353
             +A ++DESDR G RVV+ELKR A+ +V+LNQL+R+TS+Q+ F  NM+ALNG +PE  T
Sbjct: 301 EGVAHVQDESDRNGVRVVVELKRDATPEVVLNQLFRFTSMQTYFGCNMLALNGGRPETLT 360

Query: 354 LIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETA 413
           L   L +F+ FRE+VV RRT Y L KAR+R+H+L GLA+AV N+DEVV  IR S +   A
Sbjct: 361 LRRFLTSFIDFREDVVARRTAYELRKARERSHILCGLAVAVTNVDEVVATIRSSADAAEA 420

Query: 414 RRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDI 473
           R +L  R W A +I + I+LIDD ++ +  DGT  LSE Q RAILELRL RLT +G  ++
Sbjct: 421 REKLKTRRWPAIEIAEYINLIDDPTHKMNDDGTYNLSETQARAILELRLQRLTQIGVKEV 480

Query: 474 RNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCI 533
            +EL  L  +I+E L+IL SR R++ II+ EL  V+++   PRRT IV+   DMEDED I
Sbjct: 481 TDELKLLAGKIREYLEILGSRDRIMAIIRDELSEVREKFAVPRRTEIVDWSGDMEDEDLI 540

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
            REDMVVT++  GY+KR PL  +RAQRRGGKG +G+  +DED +T LF+ +THT +LFF+
Sbjct: 541 EREDMVVTITSGGYIKRTPLIDFRAQRRGGKGVAGMQTKDEDVITTLFVANTHTQLLFFT 600

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           + G  YK K WRLP+G   A+GKA++NIL +  G  I  IMP   DE  W++L VVFAT 
Sbjct: 601 TDGMSYKLKTWRLPLGGRTAKGKAIVNILPIPTGVSIAAIMPVDRDEKDWDDLQVVFATS 660

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKL---DSRDEILSVETCTQENDILLTTKLGQCVRFPI 710
            G VRRNKLSDF  + R+GKIAMK         ++ V   + ++D++L T  G+ +RF  
Sbjct: 661 AGTVRRNKLSDFTNVMRNGKIAMKFEGEHEGTTLIDVRIASNDDDVMLVTNSGRAIRFRA 720

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTE 770
           + +RVF  R S GVRGI L   D V+SM+++ H +A  DER  Y+K   A   L     +
Sbjct: 721 TDVRVFNSRASTGVRGIKLQGKDTVVSMSVIRHFEATSDERAAYLKMRRAMAGLA---DD 777

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
                + +      I++ER  E+   E  ILT++  G GK +SS+D+ +  R G G+ A 
Sbjct: 778 AELPDEEEGDANSQITQERYAEMSAIENLILTITSGGAGKLSSSHDYPLRGRGGMGVTAM 837

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
           D S     G +VA FPV  +DQI+L + KG  IRVPV+ I   SR+  GV +F+T K+E 
Sbjct: 838 DKSMR--GGEVVASFPVELDDQIMLATSKGQSIRVPVDGISFRSRSAGGVKVFNTGKNES 895

Query: 891 VVSVERIRESEIVDEAEST 909
           VVSV  I +    +  E  
Sbjct: 896 VVSVAWIADQGDDELGEGN 914


>gi|123441724|ref|YP_001005708.1| DNA gyrase subunit A [Yersinia enterocolitica subsp. enterocolitica
           8081]
 gi|122088685|emb|CAL11487.1| DNA gyrase subunit A [Yersinia enterocolitica subsp. enterocolitica
           8081]
          Length = 885

 Score =  938 bits (2423), Expect = 0.0,   Method: Composition-based stats.
 Identities = 408/900 (45%), Positives = 570/900 (63%), Gaps = 68/900 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+Y  + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYYTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL KDTVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKDTVDFVPNYDGTEQIPAVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A I++ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG + IR  +
Sbjct: 187 LSEVIDGCLAYIEDENITIEGLMEYIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVALSQGQPKLLNLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +  P  A+  L+  SW   ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRRAATPAEAKAGLIASSWELGNVAAMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
               +             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGGDAARPEWLEAEFGIRDGKYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTVIA 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E + IL +  RL+ +I++EL+++K++ +  RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELIFILENPERLMEVIREELVAIKEQYNDVRRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PLS Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      ++  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYE---EGRHIFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L + LG+ VRFP S +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGTNEVMLFSALGKVVRFPESQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+VIS+ I                                             
Sbjct: 723 GINLNGDDRVISLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV+E G+GKRT+  ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 738 --------PRGDGEILTVTENGYGKRTAVEEYPTKSRATQGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V   DQI++++D GTL+R  V+E+ +  R T+GV +  TA+DE VV ++R+ E E  D+
Sbjct: 788 QVAPTDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTAEDEHVVGLQRVAEPEEDDD 847


>gi|21104366|dbj|BAB93453.1| DNA gyrase A [Actinobacillus actinomycetemcomitans]
          Length = 887

 Score =  938 bits (2423), Expect = 0.0,   Method: Composition-based stats.
 Identities = 417/905 (46%), Positives = 581/905 (64%), Gaps = 39/905 (4%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
           + IT VS+ +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M + G  +NK Y K
Sbjct: 6   QDITPVSLEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHEGGNLYNKPYRK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            ARI G+V+GKYHPHG++A+YD L RMAQ +SLR +L++GQGNFGSVDGD PAA RYTE 
Sbjct: 66  SARIVGDVIGKYHPHGDSAVYDTLVRMAQPFSLRYMLVDGQGNFGSVDGDAPAAMRYTEA 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K AH LL DL K+TV+F PNYDGS   P VL  + P +LVNG  GIAVGMATNIP H
Sbjct: 126 RMTKIAHELLADLDKETVNFVPNYDGSEMIPEVLPTKVPALLVNGSSGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NLGEV+DGC+A I+N DI +D LM  I GPDFPT A+I GR GI+ AY TGRG I +R  
Sbjct: 186 NLGEVLDGCLAYIENNDITIDELMSHIPGPDFPTAALINGRKGIEEAYKTGRGKIYVRAR 245

Query: 254 SHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
           + IE     RE I+V EIPYQVNKA ++EKIA+ V++K+I  I+ LRDESD+ G R+VIE
Sbjct: 246 AEIETDEKGRESIIVNEIPYQVNKAKLIEKIADFVKDKKIEGISGLRDESDKDGMRIVIE 305

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T +Q  F +N+VAL+  +P+   L  +++AFV  R EVV RRT
Sbjct: 306 IKRDAVGEVVLNNLYALTQMQVTFGINIVALDHGQPKLLNLKQLIEAFVLHRREVVTRRT 365

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KAR+R H+L GLAIA+AN+D ++ +IR +PNPE A+REL+   W    + D++  
Sbjct: 366 IFELRKARERTHILEGLAIALANVDPIIELIRKAPNPENAKRELLTHPWQLGHVADMLAA 425

Query: 434 IDDSSYTIGS--------DGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
               +             DG  YL+EVQ +AIL+LRL +LT LG D+I +E   L   I 
Sbjct: 426 SGVDAARPEDLDEQYGIRDGLYYLTEVQAQAILDLRLQKLTNLGHDEILDEYKKLLDAIG 485

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           + L IL S  RL+ +I++EL  ++++ + PRRT I     D+  ED I +ED+VVT+SH 
Sbjct: 486 KLLYILRSPERLMEVIREELEQIREQFNDPRRTEITAASGDINLEDLIAQEDVVVTLSHE 545

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  P++ Y AQRRGGKG+S   M++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 546 GYVKYQPITDYEAQRRGGKGKSATKMKEEDFIEKLLVANTHDTILCFSSRGRLYWLKVYQ 605

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++NIL LN+ ERIT I+P    E    + +VV  T  G V++  L++F
Sbjct: 606 LPQASRGARGRPIVNILPLNENERITAILPVAAYE---EDKFVVMTTAGGIVKKIALTEF 662

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   SG IA+ L   DE++ V+     N+I+L +  G+ VRF  SA+R   GR + GVR
Sbjct: 663 SRPRSSGIIALNLRDEDELIGVDITDGSNEIMLFSSQGRVVRFSESAVRAM-GRLATGVR 721

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI LA                                   + + E+++    + +++ NI
Sbjct: 722 GIKLA-------------------------LTNDLNDDESAVEIEDVSDDNAEETLDLNI 756

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
            +     +      IL  ++ G+GKRT   ++   +R+ KG+ +  VS+ N  G +VA  
Sbjct: 757 DKVVSLVIPKNNGEILAATQNGYGKRTKLDEYPTKSRNTKGVISIKVSERN--GKVVAAA 814

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V +NDQI+L++D GTL+R  V+E+ I  R T+GV +  T++ E VVS+ERI E +  + 
Sbjct: 815 QVEENDQIMLITDAGTLVRTRVSEVSIVGRNTQGVRLIRTSEAEHVVSLERICEVDDEES 874

Query: 906 AESTE 910
              TE
Sbjct: 875 ENPTE 879



 Score = 71.0 bits (172), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 50/252 (19%), Positives = 99/252 (39%), Gaps = 25/252 (9%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  VV  +  G VK++ L+ +   R  G     + +RDED +  + I      ++ F
Sbjct: 639 YEEDKFVVMTTAGGIVKKIALTEFSRPRSSG--IIALNLRDEDELIGVDITDGSNEIMLF 696

Query: 593 SSLGFVYKEKVWRLPIGSP-----QARGKALINILSLNQGERITTIMP------------ 635
           SS G V +     +          +    AL N L+ ++       +             
Sbjct: 697 SSQGRVVRFSESAVRAMGRLATGVRGIKLALTNDLNDDESAVEIEDVSDDNAEETLDLNI 756

Query: 636 --FPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLD---SRDEILSVETC 690
                     NN  ++ AT++G  +R KL ++   +R+ K  + +       ++++    
Sbjct: 757 DKVVSLVIPKNNGEILAATQNGYGKRTKLDEYPTKSRNTKGVISIKVSERNGKVVAAAQV 816

Query: 691 TQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDE 750
            + + I+L T  G  VR  +S +    GRN+ GVR I  ++ + V+S+  +   D +  E
Sbjct: 817 EENDQIMLITDAGTLVRTRVSEV-SIVGRNTQGVRLIRTSEAEHVVSLERICEVDDEESE 875

Query: 751 RICYMKHMSAQR 762
                   + + 
Sbjct: 876 NPTESAVENNEE 887


>gi|291326671|ref|ZP_06125386.2| DNA gyrase, A subunit [Providencia rettgeri DSM 1131]
 gi|291313392|gb|EFE53845.1| DNA gyrase, A subunit [Providencia rettgeri DSM 1131]
          Length = 898

 Score =  938 bits (2423), Expect = 0.0,   Method: Composition-based stats.
 Identities = 412/910 (45%), Positives = 583/910 (64%), Gaps = 69/910 (7%)

Query: 11  EEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKK 70
           E  + IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M  +G +WNK 
Sbjct: 35  EIAREITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNVLGNDWNKP 94

Query: 71  YVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERY 130
           Y K ARI G+V+GKYHPHG++A+Y+ + R+AQ +S+R +L++GQGNFGSVDGD  AA RY
Sbjct: 95  YKKSARIVGDVIGKYHPHGDSAVYETIVRLAQPFSMRYMLVDGQGNFGSVDGDSAAAMRY 154

Query: 131 TECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNI 190
           TE R+ K AH LL DL K+TVDF PNYDG+ Q P V+  + PN+LVNG  GIAVGMATNI
Sbjct: 155 TEIRMAKIAHELLADLEKETVDFVPNYDGTEQIPEVMPTKIPNLLVNGSSGIAVGMATNI 214

Query: 191 PTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVI 250
           P HNLGEV++GC+A I++ DI ++ LME I GPDFPT A+I GR GI +AY TGRG + I
Sbjct: 215 PPHNLGEVINGCLAYIEDEDISIEGLMEHIPGPDFPTAAIINGRRGIIDAYRTGRGKVYI 274

Query: 251 RGVSHIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYR 309
           R  + +E      RE I+V+EIPYQVNKA ++EKIAELV++KR+  I+ LRDESD+ G R
Sbjct: 275 RASAEVEVDEKNGRETIIVSEIPYQVNKARLIEKIAELVKDKRVEGISALRDESDKDGMR 334

Query: 310 VVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVV 369
           +VIE+KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  I+ AFV  R EVV
Sbjct: 335 IVIEVKRDAVGEVVLNNLYSLTQLQVSFGINMVALHQGQPKILNLKDIIAAFVRHRREVV 394

Query: 370 VRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKD 429
            RRT + L KARDRAH+L  LAIA+AN+D ++ +IR +P P  A+  L+ RSW+  ++  
Sbjct: 395 TRRTIFELRKARDRAHILEALAIALANIDPIIELIRKAPTPAEAKAGLIARSWDLGNVAA 454

Query: 430 LIDLIDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLG 481
           +++   D +             +G  +L+E Q +AIL+LRL +LTGL  + +  E   L 
Sbjct: 455 MLERAGDDAARPEWLEPQFGVHEGQYFLTEQQAQAILDLRLQKLTGLEHEKLLEEYRDLL 514

Query: 482 IEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVT 541
           ++I+  L IL S  RL+ +I++EL  ++D  + PRRT I E   D+  ED I +ED+VVT
Sbjct: 515 VQIEALLFILRSPERLMEVIREELEIIRDTYNDPRRTEITENTADINIEDLINQEDVVVT 574

Query: 542 VSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKE 601
           +SH GYVK  PLS Y AQRRGGKG+S    +DEDF+  L + +TH ++L FSS G +Y  
Sbjct: 575 LSHQGYVKYQPLSDYEAQRRGGKGKSAARTKDEDFIERLLVANTHDTILCFSSRGRLYWM 634

Query: 602 KVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNK 661
           KV++LP  S  ARG+ ++N+L L Q ERIT I+P  E E  +N   V  AT  G V++  
Sbjct: 635 KVYQLPEASRGARGRPIVNLLPLEQDERITAILPVREYEEGYN---VFMATASGTVKKTP 691

Query: 662 LSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNS 721
           L +F +   +G IA+ L+  DE++ V+     N+++L +  G+ VRF   A+R   GR +
Sbjct: 692 LQEFSRPRSAGIIAVNLNEGDELIGVDLTDGSNEVMLFSAQGKVVRFAEDAVRPM-GRTA 750

Query: 722 VGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSV 781
            GVRGI L   D+V+S+ I                                         
Sbjct: 751 TGVRGIKLMDNDKVVSLII----------------------------------------- 769

Query: 782 EGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGAL 841
                          E  ILTV+E G+GKRT   ++   +R+ +G+ +  VS+ N  G +
Sbjct: 770 ------------PRGEGHILTVTENGYGKRTEEAEYPTKSRATQGVISIKVSERN--GNV 815

Query: 842 VAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESE 901
           V    V++ DQI++++D GTL+R  V+E+ +  R T+GV +  TA+DE+VV ++R+ E++
Sbjct: 816 VGAIQVDETDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTAEDEKVVGLQRVAETD 875

Query: 902 IVDEA-ESTE 910
             + A E+TE
Sbjct: 876 DDENAIENTE 885



 Score = 77.1 bits (188), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 68/418 (16%), Positives = 143/418 (34%), Gaps = 35/418 (8%)

Query: 365 REEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNA 424
             E ++   + LL +      +L      +  + E + IIR + N    RR  +  +   
Sbjct: 502 EHEKLLEEYRDLLVQIEALLFILRSPERLMEVIREELEIIRDTYN--DPRRTEITENTAD 559

Query: 425 SDIKDLIDLIDDSSYTIGSDGTMY--LSEVQTRAILELRLARLTGLGRDDIRNELNSLGI 482
            +I+DLI+  D            Y  LS+ + +       +       D I   L +   
Sbjct: 560 INIEDLINQEDVVVTLSHQGYVKYQPLSDYEAQRRGGKGKSAARTKDEDFIERLLVANTH 619

Query: 483 E---------IKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCI 533
           +             + +        G   + ++++       R T I+      E  +  
Sbjct: 620 DTILCFSSRGRLYWMKVYQLPEASRGARGRPIVNLLPLEQDERITAILPVREYEEGYN-- 677

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
                V   +  G VK+ PL  +   R  G     +   DE    DL        V+ FS
Sbjct: 678 -----VFMATASGTVKKTPLQEFSRPRSAGIIAVNLNEGDELIGVDL--TDGSNEVMLFS 730

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           + G V +     +      A G   I ++  ++                    +++  T+
Sbjct: 731 AQGKVVRFAEDAVRPMGRTATGVRGIKLMDNDK---------VVSLIIPRGEGHILTVTE 781

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVRFPI 710
           +G  +R + +++   +R+ +  + +   +     +      + + I++ T  G  VR  +
Sbjct: 782 NGYGKRTEEAEYPTKSRATQGVISIKVSERNGNVVGAIQVDETDQIMMITDAGTLVRTRV 841

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGD 768
           S +    GRN+ GV  I  A+ ++V+ +  V   D D +      ++      +   +
Sbjct: 842 SEV-SVVGRNTQGVTLIRTAEDEKVVGLQRVAETDDDENAIENTEENGVDDANIDDQE 898


>gi|309781037|ref|ZP_07675775.1| DNA gyrase, A subunit [Ralstonia sp. 5_7_47FAA]
 gi|308920103|gb|EFP65762.1| DNA gyrase, A subunit [Ralstonia sp. 5_7_47FAA]
          Length = 889

 Score =  938 bits (2423), Expect = 0.0,   Method: Composition-based stats.
 Identities = 387/917 (42%), Positives = 564/917 (61%), Gaps = 66/917 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++  K    VS+ +EM++SYL YA++VI+GRA+PD+RDGLKPVHRR L+ M ++  +WN+
Sbjct: 2   DQFAKETLPVSLEEEMRSSYLAYAMSVIVGRALPDVRDGLKPVHRRALYSMHELNNDWNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG+ A+YD + RMAQ++SLR +L++GQGNFGSVDGD  AA R
Sbjct: 62  PYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQNFSLRYMLVDGQGNFGSVDGDNAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE RL K AH LL DL K+TV+F PNYDGS  EP VL AR PN+L+NG  GIAVGMATN
Sbjct: 122 YTEIRLSKIAHELLADLDKETVNFEPNYDGSETEPSVLPARIPNLLINGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL EVVDGC+ ++ NP+  +D L+E+I  PDFPT  +I G +G++  Y TGRG +V
Sbjct: 182 IPPHNLNEVVDGCLHLLRNPEATVDELIELIPAPDFPTAGIIYGISGVREGYRTGRGRVV 241

Query: 250 IRGVSHIEKTSGDR-EQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R  +H E     + + I+V E+PYQVNK  +LE+IAELV EKRI  I+D+RDESD+ G 
Sbjct: 242 MRAKTHFEDIDRGQRQAIIVDELPYQVNKRTLLERIAELVTEKRIEGISDIRDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVIELKRG   +V+LN LY+ T LQ  F +NMVAL   +P    L  +L+ F+  R EV
Sbjct: 302 RVVIELKRGEVPEVVLNNLYKNTQLQDTFGMNMVALVDGQPRLLNLRQMLECFLLHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KAR+R H+L GLA+A+AN+DE + II+ +P P  A+ ELM RSW++  ++
Sbjct: 362 VTRRTVFDLRKARERGHILEGLAVALANIDEFIAIIKAAPTPPVAKAELMNRSWDSGLVR 421

Query: 429 DLIDLIDD---------------SSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDI 473
           D++   +                  + +  DG   LS+ Q + IL++RL RLTGL +D I
Sbjct: 422 DMLVRAESETSGGGAAYRPEGLLPVFGMQGDGLYRLSDTQAQEILQMRLQRLTGLEQDKI 481

Query: 474 RNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCI 533
             E   +  +I + LDIL+   R+  II +EL +++ E    RR++I     +++ ED I
Sbjct: 482 VQEYREVMAQIADLLDILARPERITAIIVEELTAIRAEFGDERRSQIEHNATELDTEDLI 541

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
             +D+VVT+SH GY+K  P+S YRAQ+RGG+G+     +++D++  LF+ +TH  +L FS
Sbjct: 542 TPQDLVVTLSHSGYMKSQPISEYRAQKRGGRGKQAAATKEDDWIDTLFVANTHDYILCFS 601

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           + G +Y  KVW +P GS  +RG+ ++N+  L+ GE+I  I+P  + +      +V  AT 
Sbjct: 602 NRGRLYWLKVWEVPQGSRNSRGRPIVNMFPLSPGEKINVILPVKQFD---EQHFVFMATS 658

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAI 713
            G V++  L++F    ++G IA+ LD  D ++  +    ++D++L +  G+ VRF  + +
Sbjct: 659 KGTVKKTALTEFSNPRKAGIIAVDLDEGDFLIGADITDGQHDVMLFSDAGKAVRFDENDV 718

Query: 714 RVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEIT 773
           R   GR + GVRG++L +  QVI+M +     A    +                      
Sbjct: 719 RPM-GRQARGVRGMNLEENQQVIAMLVAPAETAGEGAQSVAGS----------------- 760

Query: 774 SLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVS 833
                                     +LT +E G+GKRT   ++    R  KG+ A   S
Sbjct: 761 --------------------------VLTATENGYGKRTPISEYTRHGRGTKGMIAIQTS 794

Query: 834 KINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVS 893
           + N  G +VA   V   D+I+L++  G LIR  V+EIR   RAT+GV + S  +  ++  
Sbjct: 795 ERN--GKVVAAALVAPEDEIMLITTGGVLIRTRVDEIREMGRATQGVTLISVGEGNKLSG 852

Query: 894 VERIRESEIVDEAESTE 910
           ++R+ ES+  + AES E
Sbjct: 853 LQRVMESDA-EGAESVE 868



 Score = 75.6 bits (184), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 51/249 (20%), Positives = 105/249 (42%), Gaps = 13/249 (5%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  V   +  G VK+  L+ +   R+ G     +   + DF+    I      V+ F
Sbjct: 647 FDEQHFVFMATSKGTVKKTALTEFSNPRKAGIIAVDLD--EGDFLIGADITDGQHDVMLF 704

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYV---- 648
           S  G   +     +     QARG   +N   L + +++  ++  P + +      V    
Sbjct: 705 SDAGKAVRFDENDVRPMGRQARGVRGMN---LEENQQVIAMLVAPAETAGEGAQSVAGSV 761

Query: 649 VFATKHGNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQC 705
           + AT++G  +R  +S++ +  R   G IA++      ++++      E++I+L T  G  
Sbjct: 762 LTATENGYGKRTPISEYTRHGRGTKGMIAIQTSERNGKVVAAALVAPEDEIMLITTGGVL 821

Query: 706 VRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLI 765
           +R  +  IR   GR + GV  IS+ +G+++  +  V+ +DA+  E +       A     
Sbjct: 822 IRTRVDEIREM-GRATQGVTLISVGEGNKLSGLQRVMESDAEGAESVEGADAADAAPDAD 880

Query: 766 SGDTEEITS 774
           +   +   +
Sbjct: 881 AQPDDSSET 889


>gi|264677567|ref|YP_003277473.1| DNA gyrase subunit alpha [Comamonas testosteroni CNB-2]
 gi|262208079|gb|ACY32177.1| DNA gyrase, A subunit [Comamonas testosteroni CNB-2]
          Length = 898

 Score =  938 bits (2423), Expect = 0.0,   Method: Composition-based stats.
 Identities = 387/924 (41%), Positives = 561/924 (60%), Gaps = 69/924 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
            +  K    +S+ +EM+ SYL YA++VI+GRA+PD RDGLKPVHRR+L+ M ++  +WN+
Sbjct: 2   TQFAKETLPISLEEEMRRSYLDYAMSVIVGRALPDARDGLKPVHRRVLYAMHELNNDWNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG++A+YD + RMAQD+SLR +L++GQGNFGSVDGD  AA R
Sbjct: 62  PYKKSARIVGDVIGKYHPHGDSAVYDTIVRMAQDFSLRHMLVDGQGNFGSVDGDSAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE RL K AH +L D+ K+TVDF PNYDGS QEP+VL +R PN+LVNG  GIAVGMATN
Sbjct: 122 YTEIRLSKIAHEMLGDIDKETVDFGPNYDGSEQEPLVLPSRLPNLLVNGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL EVVDGC+ ++ NP+  +D LMEII  PDFPT  +I G  G+K  Y TGRG +V
Sbjct: 182 IPPHNLNEVVDGCLHLLQNPEASIDELMEIIPAPDFPTAGIIYGINGVKEGYRTGRGRVV 241

Query: 250 IRGVSHIEKTSGDREQ-IVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R   H E     + Q I+V E+PYQVNK  + E++AELV EK+I  I+ ++DESD+ G 
Sbjct: 242 MRAKCHFEDIDKGQRQSIIVDELPYQVNKKTLQERMAELVHEKKIEGISHIQDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           R+VIELKRG   +V+LN LY+ T LQ  F +NMVAL   +P+   L  +++ F+  R EV
Sbjct: 302 RLVIELKRGEVPEVVLNNLYKLTQLQDTFGMNMVALVNGQPKLCNLKDLIQVFLEHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KARDR HVL GLA+A+AN+D+ + IIR +P P  A+  LM++SW++  ++
Sbjct: 362 VTRRTVFELRKARDRGHVLEGLAVALANIDDFIAIIRNAPTPPVAKAALMEKSWDSKLVR 421

Query: 429 DLIDLIDDS----------------SYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDD 472
           +++                       + +  +G   LSE Q + IL++RL RLTGL +D 
Sbjct: 422 EMLTRTRTDGGVVNADDYRPEGLEVEFGMQQNGLYRLSETQAQEILQMRLQRLTGLEQDK 481

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTP----RRTRIVEGLLDME 528
           I  E   +   I++ LDIL+   R+  II +EL +VK E        RR+ +     D+ 
Sbjct: 482 IVAEYKDVMSVIEDLLDILAKPERVSIIIGEELNAVKAEFGQSKKGERRSTVEYSAQDLS 541

Query: 529 DEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTS 588
            ED I   DMVVT+SH GY+K  PLS YR+Q+RGG+G+     +++D++  LFI +TH  
Sbjct: 542 TEDLITPTDMVVTLSHTGYIKSQPLSEYRSQKRGGRGKQATATKEDDWIDQLFIANTHDY 601

Query: 589 VLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFP-EDESSWNNLY 647
           +L FS+ G +Y  KVW +P GS  +RG+ ++N+  L +GE+I  ++P   E+ S   + +
Sbjct: 602 LLCFSNRGRMYWLKVWEVPSGSRGSRGRPIVNMFPLQEGEKINVVLPLTGENRSFPEDHF 661

Query: 648 VVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVR 707
           V  AT  G V++  L++F    ++G IA+ LD  D ++       ++D++L +  G+ VR
Sbjct: 662 VFMATSMGTVKKTALTEFSNPRKAGIIAVGLDEGDYLIGAALTDGKHDVMLFSDGGKAVR 721

Query: 708 FPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISG 767
           F  + +R   GRN+ GVRG+++ +   VI+M +    D   +                  
Sbjct: 722 FDENDVRPM-GRNARGVRGMNIEEHQNVIAMLVAEADDGTGNVV---------------- 764

Query: 768 DTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGI 827
                                         Q +LT +E G+GKRT+  ++    R  KG+
Sbjct: 765 ---------------------------AGSQSVLTATENGYGKRTAISEYTRHGRGTKGM 797

Query: 828 RATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAK 887
            A   S+ N  G +VA   V   D+I+L++D G L+R  V EIR   RAT+GV + +  +
Sbjct: 798 IAIQQSERN--GKVVAATLVAPEDEIMLITDTGVLVRTRVAEIRELGRATQGVTLINLDE 855

Query: 888 DERVVSVERIRESEIVDEA-ESTE 910
             +++ ++RI E++  D A E  E
Sbjct: 856 GAKLIGLQRIVENDANDNAGEDGE 879



 Score = 79.5 bits (194), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 50/249 (20%), Positives = 104/249 (41%), Gaps = 13/249 (5%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  V   + +G VK+  L+ +   R+ G     V + + D++    +      V+ F
Sbjct: 656 FPEDHFVFMATSMGTVKKTALTEFSNPRKAG--IIAVGLDEGDYLIGAALTDGKHDVMLF 713

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWN----NLYV 648
           S  G   +     +      ARG   +N   + + + +  ++    D+ + N    +  V
Sbjct: 714 SDGGKAVRFDENDVRPMGRNARGVRGMN---IEEHQNVIAMLVAEADDGTGNVVAGSQSV 770

Query: 649 VFATKHGNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQC 705
           + AT++G  +R  +S++ +  R   G IA++      ++++      E++I+L T  G  
Sbjct: 771 LTATENGYGKRTAISEYTRHGRGTKGMIAIQQSERNGKVVAATLVAPEDEIMLITDTGVL 830

Query: 706 VRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLI 765
           VR  ++ IR   GR + GV  I+L +G ++I +  ++  DA+ +         S      
Sbjct: 831 VRTRVAEIREL-GRATQGVTLINLDEGAKLIGLQRIVENDANDNAGEDGEADDSGSAGAE 889

Query: 766 SGDTEEITS 774
                   S
Sbjct: 890 GAAESGDAS 898


>gi|254450619|ref|ZP_05064056.1| DNA gyrase, A subunit [Octadecabacter antarcticus 238]
 gi|198265025|gb|EDY89295.1| DNA gyrase, A subunit [Octadecabacter antarcticus 238]
          Length = 918

 Score =  938 bits (2423), Expect = 0.0,   Method: Composition-based stats.
 Identities = 470/920 (51%), Positives = 636/920 (69%), Gaps = 18/920 (1%)

Query: 1   MTEHIISSDEEEEKGIT-------SVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVH 53
           M +   + +  EE            +SIT EM+ SYL YA++VI+ RAIPDLRDGLKPVH
Sbjct: 1   MNDTPETPENTEEMPPERPVYDGPQISITAEMKTSYLDYAMSVIVSRAIPDLRDGLKPVH 60

Query: 54  RRILFGMMQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEG 113
           RRIL+ M + G   +K Y K AR  G+VMGKYHPHG++AIYDALARMAQD+S+ L L++G
Sbjct: 61  RRILYAMYEAGNTHDKPYRKSARAVGDVMGKYHPHGDSAIYDALARMAQDFSMSLPLLDG 120

Query: 114 QGNFGSVDGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPN 173
           QGNFGS+DGD PAA RYTE R+ K A ++L D+ KDTVDF+ NYDG  +EP VL +R+PN
Sbjct: 121 QGNFGSMDGDNPAAMRYTEVRMDKPAAYMLADIDKDTVDFQDNYDGKDREPTVLPSRFPN 180

Query: 174 VLVNGGGGIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILG 233
           +LVNG GGIAVGMATNIP HNLGEV+D C+ +I+NPD+  + L+E I GPDFPTG ++LG
Sbjct: 181 MLVNGAGGIAVGMATNIPPHNLGEVIDACLGLIENPDLTSEDLIEYIPGPDFPTGGIMLG 240

Query: 234 RTGIKNAYATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRI 293
           RTG + AY  GRGS++ R  +H E+   DR  I++TEIPYQVNK+ M+++IAE  R+K+I
Sbjct: 241 RTGARKAYLEGRGSVITRAKTHTEEIRKDRFAIIITEIPYQVNKSTMIDRIAEAARDKKI 300

Query: 294 VDIADLRDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFT 353
             I+ ++DESDR G RVVIELKR A+A+V+LNQL+R+T +Q+ F  NM+ALNG +PE  T
Sbjct: 301 EGISHVQDESDRNGVRVVIELKRDATAEVVLNQLFRFTPMQTYFGCNMLALNGGRPETLT 360

Query: 354 LIGILKAFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETA 413
           L   L +F+ FRE+VV+RRT + LNKARDRAHVL GLA+AV+N+DEVV  IR S +  +A
Sbjct: 361 LRRFLTSFLDFREDVVIRRTAFELNKARDRAHVLCGLAVAVSNVDEVVATIRASADAPSA 420

Query: 414 RRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDI 473
           R  LM R+W A++I   I LIDD ++   +DGT  LSE+Q RAILELRL RLT +G  ++
Sbjct: 421 RAALMTRAWPAAEILPFILLIDDPTHPANADGTYNLSEIQARAILELRLQRLTQIGVKEV 480

Query: 474 RNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCI 533
            +EL  L  +IKE L IL+SR R++ II  EL   K     PRRT+IV+   DMEDED I
Sbjct: 481 TDELEELAGKIKEYLAILASRERIMQIITDELAECKTLFAVPRRTQIVDWSGDMEDEDLI 540

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
             +DMVVTV+  GY+KR  L  +RAQ+RGGKG SG  ++++D VT LF+ +THT +LFF+
Sbjct: 541 ESQDMVVTVTETGYIKRTALVDFRAQKRGGKGVSGGSLKEDDVVTTLFVANTHTQLLFFT 600

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           + G VYK K WRLP GS  ++GKA++NIL +  G  I  IMP   DE  W++L +VFAT 
Sbjct: 601 TDGMVYKLKTWRLPQGSRTSKGKAIVNILPIPTGVSIAAIMPVDRDEKDWDDLQIVFATS 660

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKL---DSRDEILSVETCTQENDILLTTKLGQCVRFPI 710
            G VRRNKLSDF ++ R+GKIAMK    +   ++++   C+ ++D++L T  G+ +RF  
Sbjct: 661 AGTVRRNKLSDFTKVMRNGKIAMKFEGENEGVQLINARICSDDDDVMLVTNSGRAIRFAS 720

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTE 770
           + +RVF  R S+GVRGI L   D+++SM+++ H +A+ DER  Y+K   A   L      
Sbjct: 721 TDVRVFNSRASLGVRGIRLKGDDKIVSMSVIRHFEAESDERAAYLKMRRAMAGLA----- 775

Query: 771 EITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRAT 830
           +   ++++    GNI++ER  E+   E  ILT++  G GK +SS+D+ +  R G G+ A 
Sbjct: 776 DDAEIEDEDVTAGNITQERYAEMSASENLILTITAGGSGKLSSSHDYPLRGRGGMGVTAM 835

Query: 831 DVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDER 890
           D  K    G +VA FPV  +DQI+L + KG  IRVPV  I   SR+  GV +F+T K+E 
Sbjct: 836 D--KAMRGGEIVASFPVEMDDQIMLATSKGQSIRVPVEGISFRSRSAGGVKVFNTGKNEI 893

Query: 891 VVSVERIRESEIVDEAESTE 910
           VVSV  I +    ++ ++ E
Sbjct: 894 VVSVAYIADR-ADEDGDADE 912


>gi|157371506|ref|YP_001479495.1| DNA gyrase subunit A [Serratia proteamaculans 568]
 gi|157323270|gb|ABV42367.1| DNA gyrase, A subunit [Serratia proteamaculans 568]
          Length = 882

 Score =  938 bits (2423), Expect = 0.0,   Method: Composition-based stats.
 Identities = 407/905 (44%), Positives = 577/905 (63%), Gaps = 68/905 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I DE++NSYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK Y K 
Sbjct: 7   EITPVNIEDELKNSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMSVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEVR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL K+TVDF PNYDG+ Q P V+  + PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKETVDFVPNYDGTEQIPAVMPTKIPNLLVNGASGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV++GC+A ID+ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG I +R  +
Sbjct: 187 LSEVINGCLAYIDDENISIEGLMEYIPGPDFPTAAIINGRRGIEEAYRTGRGKIYLRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL+AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVTFGINMVALHQGQPKLLNLKDILQAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +P P  A+  L+ ++W+  ++  +++ 
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIEMIRRAPTPAEAKAALVAQAWDLGNVAAMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  +L+E Q +AIL+LRL +LTGL  + + +E   L   I 
Sbjct: 427 AGDDAARPEWLEPEFGIRDGKYHLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTAIA 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
             + IL +  RL+ +I++EL+++K++ +  RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ALIFILENPDRLMEVIREELVAIKEQYNDGRRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PL+ Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      +V  AT  G V++  L+DF
Sbjct: 607 LPEASRGARGRPIVNLLPLEANERITAILPVREYE---EGRHVFMATASGTVKKTALTDF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L +  G+ VRFP + +R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGSNEVMLFSANGKVVRFPETQVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L +GD VIS+ +                                             
Sbjct: 723 GINLGEGDSVISLIVPRGEGD--------------------------------------- 743

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                         ILTV++ G+GKRT+  ++   +R+ +G+ +  VS+ N  G +V   
Sbjct: 744 --------------ILTVTQNGYGKRTAVTEYPTKSRATQGVISIKVSERN--GQVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V+  DQI++++D GTL+R  V+E+ +  R T+GV +  TA+DE VV ++R+ E    +E
Sbjct: 788 QVDTTDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTAEDENVVGLQRVAEPVEDEE 847

Query: 906 AESTE 910
            +S E
Sbjct: 848 LDSLE 852



 Score = 73.7 bits (179), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 43/249 (17%), Positives = 89/249 (35%), Gaps = 15/249 (6%)

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           V   +  G VK+  L+ +   R  G     +   DE    DL        V+ FS+ G V
Sbjct: 646 VFMATASGTVKKTALTDFSRPRSAGIIAVNLNEGDELIGVDL--TDGSNEVMLFSANGKV 703

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVR 658
            +    ++      A G   IN+   +                      ++  T++G  +
Sbjct: 704 VRFPETQVRSMGRTATGVRGINLGEGD---------SVISLIVPRGEGDILTVTQNGYGK 754

Query: 659 RNKLSDFIQINRSGKIAMKLD---SRDEILSVETCTQENDILLTTKLGQCVRFPISAIRV 715
           R  ++++   +R+ +  + +       +++        + I++ T  G  VR  +S +  
Sbjct: 755 RTAVTEYPTKSRATQGVISIKVSERNGQVVGAVQVDTTDQIMMITDAGTLVRTRVSEV-S 813

Query: 716 FAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSL 775
             GRN+ GV  I  A+ + V+ +  V     D +          A+      D  + +  
Sbjct: 814 VVGRNTQGVTLIRTAEDENVVGLQRVAEPVEDEELDSLEPGAEVAEEDAAPLDEGDDSEA 873

Query: 776 KNDSSVEGN 784
            +D+  +  
Sbjct: 874 PDDAEEDNA 882


>gi|126726444|ref|ZP_01742285.1| DNA gyrase subunit A [Rhodobacterales bacterium HTCC2150]
 gi|126704307|gb|EBA03399.1| DNA gyrase subunit A [Rhodobacterales bacterium HTCC2150]
          Length = 924

 Score =  937 bits (2422), Expect = 0.0,   Method: Composition-based stats.
 Identities = 474/893 (53%), Positives = 630/893 (70%), Gaps = 8/893 (0%)

Query: 18  SVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCARI 77
            VSI DEM+ SYL YA++VI+ RAIPDLRDGLKPVHRRIL+ M + G    K Y K AR 
Sbjct: 25  QVSIVDEMKTSYLDYAMSVIVSRAIPDLRDGLKPVHRRILYAMYEAGNTHEKSYRKSARA 84

Query: 78  SGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRLQK 137
            G+VMGKYHPHG++AIYDAL RMAQD+S+ L L++GQGNFGS+DGD PAA RYTE R+ K
Sbjct: 85  VGDVMGKYHPHGDSAIYDALVRMAQDFSMSLPLLDGQGNFGSMDGDNPAAMRYTEVRMDK 144

Query: 138 AAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNLGE 197
            +  LL D+ KDTVDF+ NYDG  +EP VL +R+PN+LVNG GGIAVGMATNIP HNLGE
Sbjct: 145 PSASLLADIEKDTVDFQDNYDGKDREPSVLPSRFPNMLVNGAGGIAVGMATNIPPHNLGE 204

Query: 198 VVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSHIE 257
           ++D  +A+I NPD+  + L++ +  PDFPTG +ILGRTG + AY  GRGS+VIR  + +E
Sbjct: 205 IIDATLALITNPDLTSEELIQYVPAPDFPTGGIILGRTGARKAYIEGRGSVVIRAKTRVE 264

Query: 258 KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELKRG 317
           +   DR  IV+ EIPYQVNKA+++EKIAE VR+KRI  I+ ++DESDR G RVV+ELKR 
Sbjct: 265 EIRKDRYAIVLDEIPYQVNKASLIEKIAETVRDKRIDGISHVQDESDRNGVRVVVELKRD 324

Query: 318 ASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKYLL 377
           A+A+V+LNQL+R+T +Q+ F  NM+ALNG +PE+ TL   L +F+ FREEVV RRT + L
Sbjct: 325 ATAEVVLNQLFRFTPMQTSFGCNMLALNGGRPEQLTLRRFLTSFLDFREEVVARRTAFEL 384

Query: 378 NKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDS 437
            KAR+R+HVL GLA+AV+N+DE+V  IR S +P  AR +LM R W A+DI + I LIDD 
Sbjct: 385 RKARERSHVLCGLAVAVSNVDEIVATIRTSADPAEARAKLMTRRWPATDILEYIALIDDP 444

Query: 438 SYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRL 497
           ++    DGT  LSE Q RAILELRL RLT LG  ++ +EL  L   I+E L+IL+SR R+
Sbjct: 445 THRANDDGTYNLSETQARAILELRLQRLTALGVSEVTDELQVLAANIREYLEILASRERI 504

Query: 498 LGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSVYR 557
           +GII  EL  VKD+   PRR+ I++   DMEDED I  EDMVVTV+  GY+KR PL+ +R
Sbjct: 505 MGIITDELQEVKDKFAVPRRSEIIDWSGDMEDEDLIESEDMVVTVTATGYIKRTPLADFR 564

Query: 558 AQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGKA 617
           AQ+RGGKG SG+  +++D VT+LF+ +THT +LFF++ G VYK K WRLP G   A+GKA
Sbjct: 565 AQKRGGKGLSGMSTKEDDVVTNLFVANTHTQLLFFTTAGMVYKLKTWRLPQGGRTAKGKA 624

Query: 618 LINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMK 677
           +INIL + QG  +  +MP   DE  W +L +VFAT  G+VRRN LSDF  + R+GKIAMK
Sbjct: 625 IINILPIPQGVSVAAVMPVDRDEDDWGDLQIVFATTAGDVRRNALSDFTNVMRNGKIAMK 684

Query: 678 LDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVIS 737
           L    E+++   C++++D++L T  G+ +RF  + +RVF GR+S GVRGI LA+G  V+S
Sbjct: 685 LPEGVELVNARICSEDDDVMLVTDAGRAIRFRTTDVRVFKGRDSTGVRGIRLAEGRSVVS 744

Query: 738 MAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEERCQELKLKE 797
           MA++ H +A  ++R  Y+K     RR + G ++++    ++ +     + E+ +E++  E
Sbjct: 745 MAVIRHFEASAEDRAAYLK----MRRAVEGMSDDVDGEDDEVAASDTFTMEQYEEMRAAE 800

Query: 798 QFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVNDNDQIILVS 857
             ILT+S  G GK +SS+D+ +  R G+G+ A D  K    G LVA FPV   DQI+L +
Sbjct: 801 DLILTISNGGSGKLSSSHDYPVRGRGGQGVAAMD--KAMRGGPLVACFPVEIEDQIMLAT 858

Query: 858 DKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAESTE 910
             G  IR P+  I   SR+  GV +F TAK E VVSV  I   +  DEAE  E
Sbjct: 859 STGQSIRCPIKGISFRSRSAGGVKVFDTAKKETVVSVALIA--DQGDEAEDAE 909



 Score = 48.2 bits (113), Expect = 0.005,   Method: Composition-based stats.
 Identities = 36/236 (15%), Positives = 80/236 (33%), Gaps = 13/236 (5%)

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
             +D V+ V+  G   R   +  R     G+  +GV          +  ++        +
Sbjct: 698 SEDDDVMLVTDAGRAIRFRTTDVRV--FKGRDSTGVRGIRLAEGRSVVSMAVIRHFEASA 755

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
                Y               G +       ++     T      +E       ++  + 
Sbjct: 756 EDRAAY-------LKMRRAVEGMSDDVDGEDDEVAASDTFTMEQYEEMRAAEDLILTISN 808

Query: 654 HGNVRRNKLSDF-IQINRSGKIAM--KLDSRDEILSVETCTQENDILLTTKLGQCVRFPI 710
            G+ + +   D+ ++      +A   K      +++      E+ I+L T  GQ +R PI
Sbjct: 809 GGSGKLSSSHDYPVRGRGGQGVAAMDKAMRGGPLVACFPVEIEDQIMLATSTGQSIRCPI 868

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLIS 766
             I  F  R++ GV+    AK + V+S+A++     + ++     +    +    +
Sbjct: 869 KGI-SFRSRSAGGVKVFDTAKKETVVSVALIADQGDEAEDAEIISETGPEETTTSA 923


>gi|148557457|ref|YP_001265039.1| DNA gyrase subunit A [Sphingomonas wittichii RW1]
 gi|148502647|gb|ABQ70901.1| DNA gyrase subunit A [Sphingomonas wittichii RW1]
          Length = 936

 Score =  937 bits (2422), Expect = 0.0,   Method: Composition-based stats.
 Identities = 477/905 (52%), Positives = 637/905 (70%), Gaps = 21/905 (2%)

Query: 8   SDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEW 67
               E   I+ +SI DEM++SYL YA++VI+ RA+PD+RDGLKPVHRRIL+   + G   
Sbjct: 24  PPPIENSDISPISIIDEMKSSYLDYAMSVIVSRALPDVRDGLKPVHRRILYACQEGGFVP 83

Query: 68  NKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAA 127
            + Y K A+I G+VMG YHPHG+++IYDALAR+AQDW++R+ LI+GQGNFGS+D DPPA+
Sbjct: 84  GRPYRKSAKIVGDVMGNYHPHGDSSIYDALARLAQDWAMRVPLIDGQGNFGSMDPDPPAS 143

Query: 128 ERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMA 187
            RYTE RL K A  LLDDL KDTV+F PNYDGS  EP VL AR+PN+LVNG GGIAVGMA
Sbjct: 144 MRYTEARLAKVAMTLLDDLDKDTVNFTPNYDGSRDEPQVLPARFPNILVNGAGGIAVGMA 203

Query: 188 TNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGS 247
           TNIP HNLGEV+  C A +DNP I +D LM I+ GPDFPTGA+ILG++G + AY TGRGS
Sbjct: 204 TNIPPHNLGEVIAACKAYVDNPAISIDELMAIVPGPDFPTGALILGQSGARQAYHTGRGS 263

Query: 248 IVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQG 307
           I++R    +E++ GDR  IV+TEIPYQV K+ ++EKIAE  ++KRI  I+D+RDES+RQG
Sbjct: 264 IIMRSRHEVEESRGDRRSIVLTEIPYQVGKSGLVEKIAEAAKDKRIEGISDIRDESNRQG 323

Query: 308 YRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREE 367
            R+V++LKR A+ DV+LNQL+R+T  Q+ F  NM+A+ G +PE   L  I+++FV FREE
Sbjct: 324 VRIVMDLKRDATPDVVLNQLWRHTPAQTSFPANMLAIRGGRPETLNLRDIVESFVKFREE 383

Query: 368 VVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDI 427
           V+ RR+K+ LNKAR+RAH+L+GL IAV NLDEVVRIIR S +P  AR  L+ R W   +I
Sbjct: 384 VITRRSKFELNKARERAHILLGLVIAVTNLDEVVRIIRRSASPAEARAALISREWPRGEI 443

Query: 428 KDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKEC 487
           +  I L++    TIG   T  LSEVQ RAIL+LRL RLT LGRD+I +EL  L   I E 
Sbjct: 444 ESYIKLVEAVD-TIGDAPTYQLSEVQVRAILDLRLHRLTALGRDEIGDELAKLAESIAEL 502

Query: 488 LDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGY 547
           L+IL +R RL  ++ +E  ++  E  TPRRT I     D++DED I REDMVVTV+H GY
Sbjct: 503 LEILGNRVRLYQVMVEEFDAILVEFATPRRTEIAPAGDDIDDEDLIEREDMVVTVTHGGY 562

Query: 548 VKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLP 607
           +KR PL  +RAQRRGGKGRSG+  +DED VT+LF+ STHT VLFFS+ G VY++KVWRLP
Sbjct: 563 IKRTPLEAFRAQRRGGKGRSGMATKDEDAVTELFVTSTHTPVLFFSNHGKVYRKKVWRLP 622

Query: 608 IGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQ 667
            G+PQARG+ +IN+L L  GE+ITT++P PEDE SW+ L+VVFAT HGNVRRN +  F  
Sbjct: 623 EGAPQARGRPMINLLPLADGEKITTVLPLPEDEESWSTLHVVFATAHGNVRRNSMDAFAN 682

Query: 668 INRSGKIAMKLDSR--DEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
           +  +GK AM+ D    D ++ V   T+++D+LL T+ G+ +RF  + +R F  R S GVR
Sbjct: 683 VPTNGKFAMRFDEDATDRLIGVALLTEQDDVLLATRGGKAIRFASTDVREFQSRTSTGVR 742

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI L   D+VIS++I+   DA  DER  Y++    +                D+  +  +
Sbjct: 743 GILLKGDDEVISLSILKGFDASTDERDAYLRAAPWK----------------DNEADPTL 786

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
           S ER  E +  E+FILTV   G+GKR+S+Y++R + R G+GI   D  + N  G +VA F
Sbjct: 787 SAERMAEFEAAEEFILTVCANGYGKRSSAYEYRRTGRGGQGIGNIDNLERN--GPVVASF 844

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           P ++ +Q++LV+D+  LIR+ V + R+  R + GV +F+ + +E VV   RI ES+   E
Sbjct: 845 PAHNGEQLMLVTDQAKLIRLSVGDTRVIGRNSAGVRLFNVSDNEHVVGAARIEESDDEAE 904

Query: 906 AESTE 910
           A+  +
Sbjct: 905 ADLGD 909



 Score = 56.3 bits (134), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 37/288 (12%), Positives = 87/288 (30%), Gaps = 38/288 (13%)

Query: 531 DCIVREDMVVTV-----SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVST 585
                E+   T+     +  G V+R  +  +      GK          D +  + +++ 
Sbjct: 650 PLPEDEESWSTLHVVFATAHGNVRRNSMDAFANVPTNGKFAMRFDEDATDRLIGVALLTE 709

Query: 586 HTSVLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNN 645
              VL  +  G   +     +     +        +L  +      +I+   +  +   +
Sbjct: 710 QDDVLLATRGGKAIRFASTDVREFQSRTSTGVRGILLKGDDEVISLSILKGFDASTDERD 769

Query: 646 LYV---------------------------VFAT--KHGNVRRNKLSDFIQINRSGKIAM 676
            Y+                              T   +G  +R+   ++ +  R G+   
Sbjct: 770 AYLRAAPWKDNEADPTLSAERMAEFEAAEEFILTVCANGYGKRSSAYEYRRTGRGGQGIG 829

Query: 677 KLDSRDEILSV---ETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGD 733
            +D+ +    V           ++L T   + +R  +   RV  GRNS GVR  +++  +
Sbjct: 830 NIDNLERNGPVVASFPAHNGEQLMLVTDQAKLIRLSVGDTRVI-GRNSAGVRLFNVSDNE 888

Query: 734 QVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSV 781
            V+  A +  +D + +  +       A         +     +     
Sbjct: 889 HVVGAARIEESDDEAEADLGDGTGEIAPADDAVVGEDLADGGEASGDE 936


>gi|34580784|ref|ZP_00142264.1| DNA gyrase subunit A [Rickettsia sibirica 246]
 gi|28262169|gb|EAA25673.1| DNA gyrase subunit A [Rickettsia sibirica 246]
          Length = 905

 Score =  937 bits (2422), Expect = 0.0,   Method: Composition-based stats.
 Identities = 455/891 (51%), Positives = 633/891 (71%), Gaps = 8/891 (0%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++    +  V+I DEM+ SYL YA++VI+ RAIPD+RDGLKPVHRRI++ M + G   +K
Sbjct: 3   DKSSSNLVPVNIEDEMKVSYLDYAMSVIVSRAIPDVRDGLKPVHRRIIYSMHEAGNHASK 62

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+VMGKYHPHG++AIYDAL RMAQD+SLRL L++GQGNFGS+DGD  AA R
Sbjct: 63  PYRKSARIVGDVMGKYHPHGDSAIYDALVRMAQDFSLRLPLVDGQGNFGSMDGDAAAAMR 122

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE R+ K ++ L++D+ K+TV F PNYDGS +EP VL A +PN+LVNG GGIAVGMATN
Sbjct: 123 YTESRMAKVSYKLVEDIDKETVSFNPNYDGSEEEPSVLPAMFPNLLVNGSGGIAVGMATN 182

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNLGEV+D C   IDN DI++  L+E+++GPDFPTG++ILG +GI++AY TGRGSI+
Sbjct: 183 IPPHNLGEVIDACCLYIDNNDIEILDLLEVVKGPDFPTGSMILGISGIRSAYLTGRGSII 242

Query: 250 IRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYR 309
           +RG + IE     R+ I++TEIPY VNKA ++EKIAE+V+EKRI  I+DLRDES++ G R
Sbjct: 243 MRGRAEIENIGNSRQAIIITEIPYMVNKARLVEKIAEMVKEKRIEGISDLRDESNKNGVR 302

Query: 310 VVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVV 369
           + IELK+   A+V+LNQ+Y  T LQ+ F V M+AL    P+   L  ++ AFV+FRE V+
Sbjct: 303 IFIELKKDVVAEVVLNQIYACTQLQTSFGVIMLALKDGLPKVMNLKEVIAAFVSFREVVI 362

Query: 370 VRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKD 429
             RT YLLNKARDRAH+L+GL IAV+N+DE++RII+ S +P  A++ELM R W A +I  
Sbjct: 363 TNRTIYLLNKARDRAHILLGLTIAVSNIDEIIRIIKASNDPNAAKQELMVRQWEALNILP 422

Query: 430 LIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLD 489
           L+ L+DD +  +   G    +EVQ +AILE+RL RLT + ++ +  +L +L  EI E L+
Sbjct: 423 LVKLVDDKAM-LNEQGKCNFTEVQAKAILEMRLQRLTAMEKNKLEEDLKNLITEITEYLN 481

Query: 490 ILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVK 549
           IL SR+RLL I+K+EL+ VK+E  TPR T I  G  D + ED I RE+MVVTV+  GY+K
Sbjct: 482 ILGSRTRLLEILKEELIKVKEEFATPRLTSIEFGEFDQDIEDLIQREEMVVTVTLGGYIK 541

Query: 550 RVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIG 609
           RVPLS YRAQ+RGGKGRSG+ MRDED  T +F+ STHT +LFFS++G VY  K+++LP+ 
Sbjct: 542 RVPLSSYRAQKRGGKGRSGLSMRDEDITTQVFVGSTHTPMLFFSNIGQVYSLKLYKLPLS 601

Query: 610 SPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQIN 669
           +PQ +G+ ++NIL L   E IT IMP PE++   +NL ++FAT  GN+RR+ L DF ++ 
Sbjct: 602 NPQGKGRPMVNILPLKANEHITNIMPLPENQDERDNLNIMFATAKGNIRRSDLLDFKKLQ 661

Query: 670 RSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISL 729
            +GKIA++LD  D+++ V+ C ++  ILL TK G+ +RFP+ ++RV   R S GVRG+ L
Sbjct: 662 SNGKIAIRLDEDDKLIDVKPCKEDEHILLATKAGKALRFPVESLRVIKSRTSDGVRGMKL 721

Query: 730 AKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEER 789
           AK D VISM ++    +  ++R  Y+     QR  I+          N   +  +++   
Sbjct: 722 AKEDSVISMTVLKGISSTKEDRDAYLSVPWEQRLEIAKGE-----AFNPEELGVSLTAPA 776

Query: 790 CQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVND 849
             E+   E+FILTV+E GFGKR+S+Y +RI++R G GI   D++  ++ G +V V PV  
Sbjct: 777 IVEMANSEEFILTVTENGFGKRSSAYGYRITDRGGSGIINMDIN--DKTGLVVGVMPVKM 834

Query: 850 NDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900
           +D+++L+++ G LIR  +  +RI  R T GV++F     E+VVSV  I E+
Sbjct: 835 DDELMLITNSGKLIRCKLESVRITGRNTSGVILFKLDDGEKVVSVSLIAET 885


>gi|15892196|ref|NP_359910.1| DNA gyrase subunit A [Rickettsia conorii str. Malish 7]
 gi|20138264|sp|Q92IZ6|GYRA_RICCN RecName: Full=DNA gyrase subunit A
 gi|15619329|gb|AAL02811.1| DNA gyrase subunit A [Rickettsia conorii str. Malish 7]
          Length = 905

 Score =  937 bits (2422), Expect = 0.0,   Method: Composition-based stats.
 Identities = 454/891 (50%), Positives = 633/891 (71%), Gaps = 8/891 (0%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++    +  V+I DEM+ SYL YA++VI+ RAIPD+RDGLKPVHRRI++ M + G   +K
Sbjct: 3   DKSSSNLVPVNIEDEMKVSYLDYAMSVIVSRAIPDVRDGLKPVHRRIIYSMHEAGNHASK 62

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+VMGKYHPHG++AIYDAL RMAQD+SLRL L++GQGNFGS+DGD  AA R
Sbjct: 63  PYRKSARIVGDVMGKYHPHGDSAIYDALVRMAQDFSLRLPLVDGQGNFGSMDGDAAAAMR 122

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE R+ K ++ L++D+ K+TV F PNYDGS +EP VL A +PN+LVNG GGIAVGMATN
Sbjct: 123 YTESRMAKVSYKLVEDIDKETVSFNPNYDGSEEEPSVLPAMFPNLLVNGSGGIAVGMATN 182

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNLGEV+D C   IDN DI++  L+E+++GPDFPTG++ILG +GI++AY TGRGSI+
Sbjct: 183 IPPHNLGEVIDACCLYIDNNDIEILDLLEVVKGPDFPTGSMILGISGIRSAYLTGRGSII 242

Query: 250 IRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYR 309
           +RG + IE    +R+ I++TEIPY VNKA ++EKIAE+V+EKRI  I+DLRDES++ G R
Sbjct: 243 MRGRAEIENIGNNRQAIIITEIPYMVNKARLVEKIAEMVKEKRIEGISDLRDESNKNGVR 302

Query: 310 VVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVV 369
           + IELK+   A+V+LNQ+Y  T LQ+ F V M+AL    P+   L  ++ AFV+FRE V+
Sbjct: 303 IFIELKKDVVAEVVLNQIYACTQLQTSFGVIMLALKDGLPKVMNLKEVIAAFVSFREVVI 362

Query: 370 VRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKD 429
             RT YLLNKARDRAH+L+GL IAV+N+DE++RII+ S +   A++ELM R W A +I  
Sbjct: 363 TNRTIYLLNKARDRAHILLGLTIAVSNIDEIIRIIKASNDSNAAKQELMARQWEALNILP 422

Query: 430 LIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLD 489
           L+ L+DD +  +   G    +EVQ +AILE+RL RLT + ++ +  +L +L  EI E L+
Sbjct: 423 LVKLVDDKAM-LNEQGKCNFTEVQAKAILEMRLQRLTAMEKNKLEEDLKNLITEITEYLN 481

Query: 490 ILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVK 549
           IL SR+RLL I+K+EL+ VK+E  TPR T I  G  D + ED I RE+MVVTV+  GY+K
Sbjct: 482 ILGSRTRLLEILKEELIKVKEEFATPRLTSIEFGEFDQDIEDLIQREEMVVTVTLGGYIK 541

Query: 550 RVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIG 609
           RVPLS YRAQ+RGGKGRSG+ MRDED  T +F+ STHT +LFFS++G VY  K+++LP+ 
Sbjct: 542 RVPLSSYRAQKRGGKGRSGLSMRDEDITTQVFVGSTHTPMLFFSNIGQVYSLKLYKLPLS 601

Query: 610 SPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQIN 669
           +PQ +G+ ++NIL L   E IT IMP PE++   +NL ++FAT  GN+RR+ L DF ++ 
Sbjct: 602 NPQGKGRPMVNILPLKANEHITNIMPLPENQDERDNLNIMFATAKGNIRRSDLLDFKKLQ 661

Query: 670 RSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISL 729
            +GKIA++LD  D+++ V+ C ++  ILL TK G+ +RFP+ ++RV   R S GVRG+ L
Sbjct: 662 SNGKIAIRLDEDDKLIDVKPCKEDEHILLATKAGKALRFPVESLRVIKSRTSDGVRGMKL 721

Query: 730 AKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEER 789
           AK D VISM ++    +  ++R  Y+     QR  I+          N   +  +++   
Sbjct: 722 AKEDSVISMTVLKGISSTKEDRDAYLSVPWEQRLEIAKGE-----AFNPEELGVSLTAPA 776

Query: 790 CQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVND 849
             E+   E+FILTV+E GFGKR+S+Y +RI++R G GI   D++  ++ G +V V PV  
Sbjct: 777 IVEMANSEEFILTVTENGFGKRSSAYGYRITDRGGSGIINMDIN--DKTGLVVGVMPVKM 834

Query: 850 NDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900
           +D+++L+++ G LIR  +  +RI  R T GV++F     E+VVSV  I E+
Sbjct: 835 DDELMLITNSGKLIRCKLESVRITGRNTSGVILFKLDDGEKVVSVSLIAET 885


>gi|307610121|emb|CBW99663.1| DNA gyrase, subunit A, type II topoisomerase [Legionella
           pneumophila 130b]
          Length = 863

 Score =  937 bits (2421), Expect = 0.0,   Method: Composition-based stats.
 Identities = 413/906 (45%), Positives = 570/906 (62%), Gaps = 68/906 (7%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
           K +  V+I DE++ SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++G +WNK Y K
Sbjct: 6   KEVLPVNIEDELKQSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMSELGNDWNKPYKK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            AR+ G+V+GKYHPHG+ A+YD + RMAQ +S+R +LI+GQGNFGSVDGD PAA RYTE 
Sbjct: 66  SARVVGDVIGKYHPHGDTAVYDTIVRMAQPFSMRYMLIDGQGNFGSVDGDAPAAMRYTEV 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K AH LL DL K+TVDF PNYD +   PVVL +R PN+LVNG  GIAVGMATNIP H
Sbjct: 126 RMSKVAHALLADLDKETVDFSPNYDETEFAPVVLPSRIPNLLVNGSSGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NL EV++ C+A++D PD  L+ LMEII GPDFPT A+I GR GI   Y TG+G +VIR  
Sbjct: 186 NLTEVINACIALVDEPDTSLEDLMEIIPGPDFPTAAIINGRAGIIEGYRTGKGRVVIRAR 245

Query: 254 SHIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVI 312
           + IE   S  R+ I++ E+PYQVNKA ++E+IAELVR+K+I  I+ LRDESD+QG RVVI
Sbjct: 246 TEIETDESSGRQSIIIQELPYQVNKARLIERIAELVRDKKIEGISGLRDESDKQGMRVVI 305

Query: 313 ELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRR 372
           ELKR   ADV+LN L+ +T +Q++F +NMVAL   +P    L  IL+ F+  R EVV RR
Sbjct: 306 ELKRNEVADVVLNNLFAHTQMQNVFGINMVALVDGQPRTLNLKQILEYFIKHRREVVTRR 365

Query: 373 TKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLID 432
           T + L KAR RAH+L GL IA+AN+DE++ +I+ SP P+ A+  L+ + W    +K +++
Sbjct: 366 TIFELKKARSRAHLLEGLGIALANIDEMIALIKQSPTPQDAKSALLSKIWQPGLVKAMLE 425

Query: 433 LIDDSSYTIGS--------DGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEI 484
               ++             +    LSE Q +AILELRL RLT L +D I NE   L   I
Sbjct: 426 KAGSNASRPDDLTEEYGLHENGYKLSEAQAQAILELRLHRLTALEQDKIINEFEELLNLI 485

Query: 485 KECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSH 544
           KE LDIL+S  RL+ +I+ EL+ +K +    RRT I     D+  ED I  ED+VVT+SH
Sbjct: 486 KELLDILASPERLMQVIRDELIEIKSQFGDERRTEITASQEDLTIEDLITEEDVVVTLSH 545

Query: 545 LGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVW 604
            GYVK  P++ Y+AQRRGGKG+S   ++DEDFV  L I STH ++L FS+ G +Y  K +
Sbjct: 546 QGYVKYQPITAYQAQRRGGKGKSATHVKDEDFVERLVIASTHDTLLCFSNHGKLYWLKAY 605

Query: 605 RLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSD 664
           +LP  S  +RG+ +INIL L +GE I  ++P  E +   +  YV  ATK G V++  L+ 
Sbjct: 606 QLPQASRASRGRPIINILPLAEGEEINAMLPVREYK---DGSYVFMATKKGTVKKVPLNA 662

Query: 665 FIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGV 724
           F +   +G IA+ L+  D ++ V+      DI+L T  G+ +RF  S +R   GR + GV
Sbjct: 663 FSRPRSNGIIAVDLEEDDSLVGVDITDGARDIMLFTDAGKVIRFDESKVRPM-GRTARGV 721

Query: 725 RGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGN 784
           RGI + K   V S+ +V                                           
Sbjct: 722 RGIRVEKDQAVKSLVVVDP----------------------------------------- 740

Query: 785 ISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAV 844
                          ILT +E G+GKRT   ++R+S R G+G+ +  V++ N  G +V  
Sbjct: 741 -----------SGGTILTATENGYGKRTHIDEYRVSGRGGQGVISIQVTERN--GKVVRS 787

Query: 845 FPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE-SEIV 903
             V DND+ +L++DKGTL+R  VNE+ +  R T+GV + + +  E VV +++I +  E +
Sbjct: 788 LQVTDNDEAMLITDKGTLVRFKVNELSVIGRNTQGVRLINVSSGEAVVGMQKIVDLGEEL 847

Query: 904 DEAEST 909
           +EAE +
Sbjct: 848 EEAEDS 853


>gi|238650438|ref|YP_002916290.1| DNA gyrase subunit A [Rickettsia peacockii str. Rustic]
 gi|238624536|gb|ACR47242.1| DNA gyrase subunit A [Rickettsia peacockii str. Rustic]
          Length = 905

 Score =  937 bits (2421), Expect = 0.0,   Method: Composition-based stats.
 Identities = 456/891 (51%), Positives = 632/891 (70%), Gaps = 8/891 (0%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++    +  V+I DEM+ SYL YA++VI+ RAIPD+RDGLKPVHRRI++ M + G   +K
Sbjct: 3   DKSSSNLVPVNIEDEMKVSYLDYAMSVIVSRAIPDVRDGLKPVHRRIIYSMHEAGNHASK 62

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+VMGKYHPHG++AIYDAL RMAQD+SLRL L+EGQGNFGS+DGD  AA R
Sbjct: 63  PYRKSARIVGDVMGKYHPHGDSAIYDALVRMAQDFSLRLPLVEGQGNFGSMDGDAAAAMR 122

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE R+ K ++ L++D+ K+TV F PNYDGS +EP VL A +PN+LVNG GGIAVGMATN
Sbjct: 123 YTESRMAKVSYKLVEDIDKETVSFNPNYDGSEKEPSVLPAMFPNLLVNGSGGIAVGMATN 182

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNLGEV+D C   IDN DI++  L+E+++GPDFPTG++ILG +GI++AY TGRGSI+
Sbjct: 183 IPPHNLGEVIDACCLYIDNNDIEILDLLEVVKGPDFPTGSMILGISGIRSAYLTGRGSII 242

Query: 250 IRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYR 309
           +RG + IE     R+ I++TEIPY VNKA ++EKIAE+V+EKRI  I+DLRDES++ G R
Sbjct: 243 MRGRAEIENIGNSRQAIIITEIPYMVNKARLVEKIAEMVKEKRIEGISDLRDESNKNGVR 302

Query: 310 VVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVV 369
           + IELK+   A+V+LNQ+Y  T LQ+ F V M+AL    P+   L  ++ AFV FRE V+
Sbjct: 303 IFIELKKDVVAEVVLNQIYACTQLQTSFGVIMLALKDGLPKVMNLKEVIAAFVNFREVVI 362

Query: 370 VRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKD 429
             RT YLLNKARDRAH+L+GL IAV+N+DE++RII+ S +P  A++ELM R W A +I  
Sbjct: 363 TNRTIYLLNKARDRAHILLGLTIAVSNIDEIIRIIKASNDPNAAKQELMARQWEALNILP 422

Query: 430 LIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLD 489
           L+ L+DD +  +   G    +EVQ +AILE+RL RLT + ++ +  +L +L  EI E L+
Sbjct: 423 LVKLVDDKAM-LNEQGKCNFTEVQAKAILEMRLQRLTAMEKNKLEEDLKNLTTEITEYLN 481

Query: 490 ILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVK 549
           IL SR+RLL I+K+EL+ VK+E  TPR T I  G  D + ED I RE+MVVTV+  GY+K
Sbjct: 482 ILGSRTRLLEILKEELIKVKEEFATPRLTSIEFGEFDQDIEDLIQREEMVVTVTLGGYIK 541

Query: 550 RVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIG 609
           RVPLS YRAQ+RGGKGRSG+ MRDED  T +F+ STHT +LFFS++G VY  K+++LP+ 
Sbjct: 542 RVPLSSYRAQKRGGKGRSGLSMRDEDITTQVFVGSTHTPMLFFSNIGQVYSLKLYKLPLS 601

Query: 610 SPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQIN 669
           +PQ +G+ ++NIL L   E IT IMP PE++   +NL ++FAT  GN+RR+ L DF ++ 
Sbjct: 602 NPQGKGRPMVNILPLKANEHITNIMPLPENQDERDNLNIMFATAKGNIRRSDLLDFKKLQ 661

Query: 670 RSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISL 729
            +GKIA++LD  D+++ V+ C ++  ILL TK G+ +RFP+ ++RV   R S GVRG+ L
Sbjct: 662 SNGKIAIRLDEDDKLIDVKPCKEDEHILLATKAGKALRFPVESLRVIKSRTSDGVRGMKL 721

Query: 730 AKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEER 789
           AK D VISM ++    +  ++R  Y+     QR  I+          N   +  +++   
Sbjct: 722 AKEDSVISMTVLKGISSTKEDRDAYLSVPWEQRLEIAKGE-----AFNSEELGVSLTVPA 776

Query: 790 CQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVND 849
             E+   E+FILTV+E GFGKR+S+Y +RI++R G GI   D++  ++ G +V V PV  
Sbjct: 777 IVEMANSEEFILTVTENGFGKRSSAYGYRITDRGGSGIINMDIN--DKTGLVVGVMPVKM 834

Query: 850 NDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900
           +D+++L+++ G LIR  +  +RI  R T GV++F     E+VVSV  I E+
Sbjct: 835 DDELMLITNSGKLIRCKLESVRITGRNTSGVILFKLDDGEKVVSVSLIAET 885


>gi|307129982|ref|YP_003881998.1| DNA gyrase subunit A [Dickeya dadantii 3937]
 gi|306527511|gb|ADM97441.1| DNA gyrase subunit A [Dickeya dadantii 3937]
          Length = 877

 Score =  937 bits (2421), Expect = 0.0,   Method: Composition-based stats.
 Identities = 408/903 (45%), Positives = 577/903 (63%), Gaps = 68/903 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMSVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGS+DGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEVR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL K+TVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLSDLEKETVDFVPNYDGTEQIPDVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV+DGC+A ID+ +I ++ LM  I GPDFPT A+I G+ GI+ AY TGRG + IR  +
Sbjct: 187 LSEVIDGCLAYIDDENISVEGLMTHIPGPDFPTAAIINGKRGIEEAYRTGRGKVYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKRI  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKSGRETIIVHEIPYQVNKARLIEKIAELVKEKRIEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T +Q  F +NMVAL+  +P+  TL  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNHLYSQTQMQVSFGINMVALHQGQPKLMTLKEILSAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KAR+RAH+L GLAIA+AN+D ++ +IR +  P  A+  L+ ++W    +  +++ 
Sbjct: 367 IFELRKARERAHILEGLAIALANIDPIIELIRHASTPADAKAALVAQAWALGGVAAMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  +L+E+Q +AIL+LRL +LTGL  + + +E   L  +I 
Sbjct: 427 AGDDAARPEWLEPEFGIHDGYYHLTELQAQAILDLRLQKLTGLEHEKLLDEYKELLAQIA 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E L IL S  RL+ +I++EL++++++ +  RRT I     D+  ED I +E++VVT+SH 
Sbjct: 487 ELLFILRSPERLMEVIREELVAIREQYNDARRTEITHNSADINIEDLISQENVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PLS Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWLKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ +IN+L L   ERIT I+P  E E   N   V  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIINLLPLEPDERITAILPVREYEEGMN---VFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L +  G+ VRF  SA+R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNDGDELIGVDLTDGSNEVMLFSAEGKVVRFSESAVRTM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+V+S+ +                                             
Sbjct: 723 GINLQDDDRVVSLIVPRGEGD--------------------------------------- 743

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                         ILTV++ GFGKRT+  ++ + +R+ KG+ +  VS+ N  G +V   
Sbjct: 744 --------------ILTVTQNGFGKRTAVTEYPVKSRATKGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V+  DQI++++D GTL+R  V+E+ I  R T+GV +  TA+DE+VV ++R+ E    DE
Sbjct: 788 QVDSADQIMMITDAGTLVRTRVSEVSIVGRNTQGVTLIRTAEDEQVVGLQRVAEPVEDDE 847

Query: 906 AES 908
            +S
Sbjct: 848 LDS 850



 Score = 70.2 bits (170), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 44/245 (17%), Positives = 86/245 (35%), Gaps = 15/245 (6%)

Query: 538 MVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGF 597
            V   +  G VK+  L+ +   R  G     +   DE    DL        V+ FS+ G 
Sbjct: 645 NVFMATASGTVKKTALTEFSRPRSAGIIAVNLNDGDELIGVDL--TDGSNEVMLFSAEGK 702

Query: 598 VYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNV 657
           V +     +      A G   IN+   ++                     ++  T++G  
Sbjct: 703 VVRFSESAVRTMGRTATGVRGINLQDDDR---------VVSLIVPRGEGDILTVTQNGFG 753

Query: 658 RRNKLSDFIQINRSGKIAMKLD---SRDEILSVETCTQENDILLTTKLGQCVRFPISAIR 714
           +R  ++++   +R+ K  + +       +++        + I++ T  G  VR  +S + 
Sbjct: 754 KRTAVTEYPVKSRATKGVISIKVSERNGKVVGAVQVDSADQIMMITDAGTLVRTRVSEV- 812

Query: 715 VFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITS 774
              GRN+ GV  I  A+ +QV+ +  V     D +               I     +  +
Sbjct: 813 SIVGRNTQGVTLIRTAEDEQVVGLQRVAEPVEDDELDSVVPVDGELPEEDIDEPENDDDT 872

Query: 775 LKNDS 779
             +D 
Sbjct: 873 PADDE 877


>gi|261868281|ref|YP_003256203.1| DNA gyrase subunit A [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413613|gb|ACX82984.1| DNA gyrase, A subunit [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 887

 Score =  937 bits (2421), Expect = 0.0,   Method: Composition-based stats.
 Identities = 417/905 (46%), Positives = 582/905 (64%), Gaps = 39/905 (4%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
           + IT VS+ +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M + G  +NK Y K
Sbjct: 6   QDITPVSLEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHEGGNLYNKPYRK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            ARI G+V+GKYHPHG++A+YD L RMAQ +SLR +L++GQGNFGSVDGD PAA RYTE 
Sbjct: 66  SARIVGDVIGKYHPHGDSAVYDTLVRMAQPFSLRYMLVDGQGNFGSVDGDAPAAMRYTEA 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K AH LL DL K+TV+F PNYDGS   P VL  + P +LVNG  GIAVGMATNIP H
Sbjct: 126 RMTKIAHELLADLDKETVNFVPNYDGSEMIPEVLPTKVPALLVNGSSGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NLGEV+DGC+A I+N DI +D LM  I GPDFPT A+I GR GI+ AY TGRG I +R  
Sbjct: 186 NLGEVLDGCLAYIENNDITIDELMSHIPGPDFPTAALINGRKGIEEAYKTGRGKIYVRAR 245

Query: 254 SHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
           + IE     RE I+V EIPYQVNKA ++EKIA+ V++K+I  I+ LRDESD+ G R+VIE
Sbjct: 246 AEIETDEKGRESIIVNEIPYQVNKAKLIEKIADFVKDKKIEGISGLRDESDKDGMRIVIE 305

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T +Q    +N+VAL+  +P+   L  +++AFV  R EVV RRT
Sbjct: 306 IKRDAVGEVVLNNLYALTQMQVTLGINIVALDHGQPKLLNLKQLIEAFVLHRREVVTRRT 365

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KAR+R H+L GLAIA+AN+D ++ +IR +PNPE A+REL+   W    + D++  
Sbjct: 366 IFELRKARERTHILEGLAIALANVDPIIELIRKAPNPENAKRELLTHPWQLGHVADMLAA 425

Query: 434 IDDSSYTIGS--------DGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
               +             DG  YL+EVQ +AIL+LRL +LT LG D+I +E   L   I 
Sbjct: 426 SGVDAARPEDLDEQYGIRDGLYYLTEVQAQAILDLRLQKLTNLGHDEILDEYKKLLDAIG 485

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           + L IL S  RL+ +I++EL  ++++ + PRRT I     D+  ED I +ED+VVT+SH 
Sbjct: 486 KLLYILRSPERLMEVIREELEQIREQFNDPRRTEITAASGDINLEDLIAQEDVVVTLSHE 545

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  P++ Y AQRRGGKG+S   M++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 546 GYVKYQPITDYEAQRRGGKGKSATKMKEEDFIEKLLVANTHDTILCFSSRGRLYWLKVYQ 605

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++NIL LN+ ERIT I+P    E    + +VV AT  G V++  L++F
Sbjct: 606 LPQASRGARGRPIVNILPLNENERITAILPVAAYE---EDKFVVMATAGGIVKKITLTEF 662

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   SG IA+ L   DE++ V+     N+I+L +  G+ VRF  SA+R   GR + GVR
Sbjct: 663 SRPRSSGIIALNLRDEDELIGVDITDGSNEIMLFSSQGRVVRFSESAVRAM-GRLATGVR 721

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI LA                                   + + E+++    + +++ NI
Sbjct: 722 GIKLA-------------------------LTNDLNDDESAVEIEDVSDDNAEETLDLNI 756

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
            +     +      ILT ++ G+GKRT   ++   +R+ KG+ +  VS+ N  G +VA  
Sbjct: 757 DKVVSLVIPKNNGEILTATQNGYGKRTKLDEYPTKSRNTKGVISIKVSERN--GKVVAAA 814

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V +NDQI+L+++ GTL+R  V+E+ I  R T+GV +  T++ E VVS+ERI E +  + 
Sbjct: 815 QVEENDQIMLITNAGTLVRTRVSEVSIVGRNTQGVRLIRTSEAEHVVSLERICEVDDEES 874

Query: 906 AESTE 910
              TE
Sbjct: 875 ENPTE 879



 Score = 71.4 bits (173), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 50/252 (19%), Positives = 100/252 (39%), Gaps = 25/252 (9%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  VV  +  G VK++ L+ +   R  G     + +RDED +  + I      ++ F
Sbjct: 639 YEEDKFVVMATAGGIVKKITLTEFSRPRSSG--IIALNLRDEDELIGVDITDGSNEIMLF 696

Query: 593 SSLGFVYKEKVWRLPIGSP-----QARGKALINILSLNQGERITTIMP------------ 635
           SS G V +     +          +    AL N L+ ++       +             
Sbjct: 697 SSQGRVVRFSESAVRAMGRLATGVRGIKLALTNDLNDDESAVEIEDVSDDNAEETLDLNI 756

Query: 636 --FPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAMKLD---SRDEILSVETC 690
                     NN  ++ AT++G  +R KL ++   +R+ K  + +       ++++    
Sbjct: 757 DKVVSLVIPKNNGEILTATQNGYGKRTKLDEYPTKSRNTKGVISIKVSERNGKVVAAAQV 816

Query: 691 TQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDE 750
            + + I+L T  G  VR  +S +    GRN+ GVR I  ++ + V+S+  +   D +  E
Sbjct: 817 EENDQIMLITNAGTLVRTRVSEV-SIVGRNTQGVRLIRTSEAEHVVSLERICEVDDEESE 875

Query: 751 RICYMKHMSAQR 762
                   +++ 
Sbjct: 876 NPTESAVENSEE 887


>gi|52424913|ref|YP_088050.1| DNA gyrase subunit A [Mannheimia succiniciproducens MBEL55E]
 gi|52306965|gb|AAU37465.1| GyrA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 888

 Score =  937 bits (2421), Expect = 0.0,   Method: Composition-based stats.
 Identities = 419/910 (46%), Positives = 585/910 (64%), Gaps = 40/910 (4%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
            E  + IT VSI +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M Q G  +NK
Sbjct: 2   TELVQDITPVSIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFSMNQSGNTYNK 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            YVK AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGS+DGD PAA R
Sbjct: 62  SYVKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDAPAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE R+Q+    LL DL K+TVDF PNYDG    P VL  + P++LVNG  GIAVGMATN
Sbjct: 122 YTEVRMQRITQELLTDLDKETVDFSPNYDGKEMIPDVLPTKIPSLLVNGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNLGEV+DGC+A +DN DI +D LM+ I GPDFPT A+I GR GI+ AY TGRG + 
Sbjct: 182 IPPHNLGEVMDGCLAYMDNEDISIDELMQFIPGPDFPTAALINGRRGIEEAYKTGRGKVY 241

Query: 250 IRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYR 309
           +R  + +E     REQI++TEIPYQVNKA ++EKI ELVR+K+I  IA + D S+++G R
Sbjct: 242 VRAKASVEINDKGREQIIITEIPYQVNKAKLVEKIGELVRDKKIEGIAGVLDLSNKEGIR 301

Query: 310 VVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVV 369
           + I++KR A  +V+LN LY  T +Q  F +NMVAL+  +P  F L  I++AFV  R EVV
Sbjct: 302 LEIDIKRDAVGEVVLNHLYALTQMQVTFGINMVALDHGQPRLFNLKQIIEAFVKHRREVV 361

Query: 370 VRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKD 429
            RRT Y L KAR+RAH+L GLAIA+AN+D V+ +IR S   + AR  L+ R+W+  ++  
Sbjct: 362 TRRTVYELRKARERAHILEGLAIALANIDPVIELIRASKTADEARENLLSRAWSLGNVAP 421

Query: 430 LIDLIDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLG 481
           +++     +             DG  +LSE Q RAILELRL RLTGL  + I  E + + 
Sbjct: 422 MLEAAGVDASRPDGLAAELGAHDGQYFLSETQARAILELRLHRLTGLEHEKIVEEYHEIL 481

Query: 482 IEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVT 541
           ++I E + IL+S  RL  +I++EL  VK   +  RRT I     D+  ED I +ED+VVT
Sbjct: 482 LQIGELIRILTSSVRLNEVIREELELVKSTYNDERRTEITAASGDINLEDLIAQEDVVVT 541

Query: 542 VSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKE 601
           +SH GYVK  PL+ Y AQRRGGKG+S   M+++DF+  L + +TH ++L FSS G +Y  
Sbjct: 542 LSHEGYVKYQPLTDYEAQRRGGKGKSATKMKEDDFIERLLVANTHDTILCFSSRGRLYWL 601

Query: 602 KVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNK 661
           KV++LP  S  ARG+ ++NIL L   ERIT I+P    +    + +VV AT  G V++  
Sbjct: 602 KVYQLPEASRGARGRPIVNILPLEDNERITAILPVASYD---EDKFVVMATACGIVKKTA 658

Query: 662 LSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNS 721
           L++F +   +G IA+ L   DE++ V+     N+I+L +  G+ VRF  +A+R   GR +
Sbjct: 659 LTEFSRPRANGIIAVNLRDEDELIGVDITDGSNEIMLFSSQGRVVRFAEAAVRAM-GRTA 717

Query: 722 VGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSV 781
            GVRGI LA                                   + + EEI+    + ++
Sbjct: 718 TGVRGIKLA-------------------------LTNDISDDESAVEIEEISDDNAEDTL 752

Query: 782 EGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGAL 841
           + NI +     +   E  ILT ++ G+GKRT+  ++   +R+ KG+ +  VS+ N  G +
Sbjct: 753 DLNIDKVVSLVIPKNEGAILTATQNGYGKRTALNEYPTKSRNTKGVISIKVSERN--GKV 810

Query: 842 VAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESE 901
           VA   V + DQI+L++D GTL+R  V+E+ I  R T+GV +  TA+DE VVS+ER+ E E
Sbjct: 811 VAATQVEETDQIMLITDAGTLVRTRVSEVSIVGRNTQGVRLIRTAEDEHVVSLERVAEPE 870

Query: 902 IVD-EAESTE 910
             + +AES E
Sbjct: 871 EDEFDAESPE 880


>gi|83647663|ref|YP_436098.1| DNA gyrase subunit A [Hahella chejuensis KCTC 2396]
 gi|83635706|gb|ABC31673.1| DNA gyrase, A subunit [Hahella chejuensis KCTC 2396]
          Length = 879

 Score =  936 bits (2420), Expect = 0.0,   Method: Composition-based stats.
 Identities = 407/915 (44%), Positives = 564/915 (61%), Gaps = 74/915 (8%)

Query: 11  EEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKK 70
           E  K I  V+I DE++ SYL YA++VI+GRA+PD RDGLKPVHRR+LF M ++G +WNK 
Sbjct: 3   ELAKEILPVNIEDELKQSYLDYAMSVIVGRALPDARDGLKPVHRRVLFAMNELGNDWNKS 62

Query: 71  YVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERY 130
           Y K AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR  L++GQGNFGS+DGD  AA RY
Sbjct: 63  YKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYTLVDGQGNFGSIDGDSAAAMRY 122

Query: 131 TECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNI 190
           TE R++K AH +L DL K+TVDF PNYDGS Q PVVL  + PN+LVNG  GIAVGMATNI
Sbjct: 123 TEIRMEKIAHEMLADLDKETVDFAPNYDGSEQIPVVLPTKVPNLLVNGSSGIAVGMATNI 182

Query: 191 PTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVI 250
           P HNL EVV+GC+A +DN DI +D LME I GPDFPT A+I GR GI  AY TGRG I I
Sbjct: 183 PPHNLTEVVNGCLAYLDNSDITIDELMEFIPGPDFPTAAIINGRAGILEAYRTGRGRIYI 242

Query: 251 RGVSHIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYR 309
           R    IE      +E IV+TEIPYQVNKA ++EKIAELV+EK++  I +LRDES ++G R
Sbjct: 243 RARYEIEQDKKTSKETIVITEIPYQVNKAKLVEKIAELVKEKKVEGITELRDESSKEGMR 302

Query: 310 VVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVV 369
           VVIEL+RG +ADV++N L+  T L+++F +NMVAL   +P+   L   ++ FV  R EVV
Sbjct: 303 VVIELRRGENADVLMNNLFALTPLETVFGINMVALINGEPKLLNLKDCIECFVRHRREVV 362

Query: 370 VRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKD 429
            RRT Y L KAR+R H+L G A+A+AN+D V+ +I+ S     A+  LM + W    +  
Sbjct: 363 TRRTIYELRKARERGHILEGQAVALANIDPVIAVIKASSTGAEAKERLMAQGWAPGAVTG 422

Query: 430 LIDLIDDSSYTIGS--------DGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLG 481
           +++   + +             +G  YLSEVQ ++IL+LRL +LTGL  + I +E  S+ 
Sbjct: 423 MLERAGEDACRPDDLAPEFGLREGLYYLSEVQAQSILDLRLQKLTGLEIEKINDEYRSII 482

Query: 482 IEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVT 541
            +I E L+IL +  RL+ +I++EL +V++E    R T I     D+   D I  EDMVVT
Sbjct: 483 EQIAELLEILQNPERLMAVIREELEAVREEFGDVRVTEITASKRDLTIADLIAEEDMVVT 542

Query: 542 VSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKE 601
           +SH GY K  PL  Y+AQ+RGGKG++   +RDEDFV  L I ++H ++L F+S G +Y  
Sbjct: 543 LSHKGYAKTQPLEAYQAQKRGGKGKAATAIRDEDFVEKLLIANSHDTILCFTSHGKLYWL 602

Query: 602 KVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNK 661
           K + +P  S  +RG+ ++NIL L + ERITT++P  E      + YV  AT+ G V++  
Sbjct: 603 KTYEIPQASRISRGRPIVNILPLAENERITTMLPVREYT---ADHYVFMATRQGTVKKTP 659

Query: 662 LSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNS 721
           L +F +   SG IA+ LD  D ++       + D++L +  G+ +RF    +R   GR +
Sbjct: 660 LENFSRPRSSGLIALALDEGDMLIGAAITDGKKDVMLFSSSGKAIRFNEDDVRPM-GRTA 718

Query: 722 VGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSV 781
            GVRGI LA+G  V+S+ I                                         
Sbjct: 719 RGVRGIRLAQGQTVVSLII----------------------------------------- 737

Query: 782 EGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGAL 841
                         ++ +ILT S KG+GKRT+  +F +  R G+G+ A   S+ N  G L
Sbjct: 738 ------------PQEDAYILTASRKGYGKRTAVSEFPVYGRGGQGVIAIQCSERN--GDL 783

Query: 842 VAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESE 901
           V+   V   DQ++L+S++GTL+R   +E+ I  R T+GV +   ++ E +V VERI E E
Sbjct: 784 VSAVQVISGDQLMLISNQGTLVRTRSDEVSIVGRNTQGVRLIRLSESEDLVGVERIAEPE 843

Query: 902 IV------DEAESTE 910
                   +E E  E
Sbjct: 844 EDESDFQGEEGEGVE 858



 Score = 74.1 bits (180), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 46/243 (18%), Positives = 89/243 (36%), Gaps = 17/243 (6%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  V   +  G VK+ PL  +   R  G     + + + D +    I      V+ F
Sbjct: 640 YTADHYVFMATRQGTVKKTPLENFSRPRSSG--LIALALDEGDMLIGAAITDGKKDVMLF 697

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           SS G   +     +      ARG   I         R+              + Y++ A+
Sbjct: 698 SSSGKAIRFNEDDVRPMGRTARGVRGI---------RLAQGQTVVSLIIPQEDAYILTAS 748

Query: 653 KHGNVRRNKLSDFIQINR--SGKIAMKLDS--RDEILSVETCTQENDILLTTKLGQCVRF 708
           + G  +R  +S+F    R   G IA++      D + +V+  +  + ++L +  G  VR 
Sbjct: 749 RKGYGKRTAVSEFPVYGRGGQGVIAIQCSERNGDLVSAVQVISG-DQLMLISNQGTLVRT 807

Query: 709 PISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGD 768
               +    GRN+ GVR I L++ + ++ +  +   + D  +                 D
Sbjct: 808 RSDEV-SIVGRNTQGVRLIRLSESEDLVGVERIAEPEEDESDFQGEEGEGVEAVDGDDLD 866

Query: 769 TEE 771
           + +
Sbjct: 867 SGD 869


>gi|82703307|ref|YP_412873.1| DNA gyrase subunit A [Nitrosospira multiformis ATCC 25196]
 gi|82411372|gb|ABB75481.1| DNA gyrase subunit A [Nitrosospira multiformis ATCC 25196]
          Length = 893

 Score =  936 bits (2420), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/905 (42%), Positives = 563/905 (62%), Gaps = 70/905 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++  K    +S+ +EM+ SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++  +WN+
Sbjct: 34  DQFAKETLQISLEEEMRRSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHELSNDWNR 93

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K AR+ G+V+GKYHPHG+ A+YD + RMAQ++SLR +L++GQGNFGSVDGD PAA R
Sbjct: 94  PYKKSARVVGDVIGKYHPHGDTAVYDTIVRMAQNFSLRYMLVDGQGNFGSVDGDNPAAMR 153

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE R+ + AH +L DL K+TVDF PNYDG+ +EP++L  + PN+L+NG  GIAVGMATN
Sbjct: 154 YTEIRMSRIAHEMLADLDKETVDFGPNYDGTEKEPLILPTKIPNLLINGSSGIAVGMATN 213

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL EV D C+A++ NP+I ++ L+E+I GPDFPT A+I G TG+K  Y TGRG ++
Sbjct: 214 IPPHNLNEVTDACLALLKNPEIAIEDLIELIPGPDFPTAALIYGVTGVKEGYRTGRGRVI 273

Query: 250 IRGVSHIEKTSG--DREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQG 307
           +R  +H E       R+ IV+ E+PYQVNKA +L +I ELVR+K+I  I+DLRDESD+ G
Sbjct: 274 MRARTHFEDMEKGGGRQSIVIDELPYQVNKANLLIRIGELVRDKKIEGISDLRDESDKSG 333

Query: 308 YRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREE 367
            RVVIEL+R    +V+LN LY+ T +Q  F +NMVAL   +P    L  +L+AF+  R E
Sbjct: 334 MRVVIELRRNEVPEVVLNNLYKETQMQDTFGMNMVALLDGQPRLLNLKQMLEAFLRHRRE 393

Query: 368 VVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDI 427
           VV RR+ + L KAR+R HVL GLA+A++N+DEV+ +I+ +  P  A+  LM R W +  +
Sbjct: 394 VVTRRSVFELKKARERGHVLEGLAVALSNVDEVIALIKAAQTPAAAKEALMSRVWRSRLV 453

Query: 428 KDLIDLIDDSSYTIGSDGT----------MYLSEVQTRAILELRLARLTGLGRDDIRNEL 477
           + ++      +     +G            +LS+ Q +AILELRL RLTGL +D I +E 
Sbjct: 454 EQMLARAAVDAKQFRPEGLAPEYGLFDDGYHLSDGQAQAILELRLQRLTGLEQDKIVSEY 513

Query: 478 NSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVRED 537
             +   I + LDIL+   R+  II +EL+++K +    RR+ IV    D+  ED I  ED
Sbjct: 514 RDVMERIADLLDILARPERITAIITEELVAMKQQFGDKRRSEIVINTQDLSMEDLIASED 573

Query: 538 MVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGF 597
           +VVT+SH GY+K  PL  YRAQ+RGG+G+     +D+DF+ +LFI +TH  +L FSS G 
Sbjct: 574 VVVTLSHNGYIKSQPLDDYRAQKRGGRGKQATGTKDDDFIDNLFIANTHDYILCFSSRGR 633

Query: 598 VYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNV 657
           VY  KV+ +P G   +RG+ ++N++ L  GE+I  ++P    +   +N YV  AT  G V
Sbjct: 634 VYWIKVYSVPQGGRASRGRPIVNLMQLEYGEKINAVLPIKTFD---DNRYVFMATSLGTV 690

Query: 658 RRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFA 717
           ++  LS+F +   SG IA+ LD  D ++ V     ++D++L +  G+ VRF  + +R   
Sbjct: 691 KKTPLSEFSRPRASGIIAVGLDEDDFLIGVALTEGKHDVMLFSDGGKAVRFDENDVRPM- 749

Query: 718 GRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKN 777
           GR + GVRG++L KG +VIS+ +                                     
Sbjct: 750 GRGARGVRGMTLGKGQKVISLLVAESE--------------------------------- 776

Query: 778 DSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINE 837
                              EQ +LT +E G+GKRT   ++    R  +G+ A   ++ N 
Sbjct: 777 -------------------EQAVLTATENGYGKRTPISEYTRHGRGSQGMIAIKTTQRN- 816

Query: 838 IGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERI 897
            G +V    V ++D+I+L++  G LIR  V E+R  SRAT+GV++ +  + E++  +ER+
Sbjct: 817 -GKVVGARLVREDDEIMLITTGGVLIRTRVKEVREMSRATQGVILINLDEGEKLAGLERV 875

Query: 898 RESEI 902
            E++ 
Sbjct: 876 VETDE 880



 Score = 79.1 bits (193), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 43/214 (20%), Positives = 97/214 (45%), Gaps = 14/214 (6%)

Query: 538 MVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGF 597
            V   + LG VK+ PLS +   R  G     V + ++DF+  + +      V+ FS  G 
Sbjct: 680 YVFMATSLGTVKKTPLSEFSRPRASG--IIAVGLDEDDFLIGVALTEGKHDVMLFSDGGK 737

Query: 598 VYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNV 657
             +     +      ARG   +  ++L +G+++ +++      +      V+ AT++G  
Sbjct: 738 AVRFDENDVRPMGRGARG---VRGMTLGKGQKVISLL-----VAESEEQAVLTATENGYG 789

Query: 658 RRNKLSDFIQINRSGKIAMKLD---SRDEILSVETCTQENDILLTTKLGQCVRFPISAIR 714
           +R  +S++ +  R  +  + +       +++      ++++I+L T  G  +R  +  +R
Sbjct: 790 KRTPISEYTRHGRGSQGMIAIKTTQRNGKVVGARLVREDDEIMLITTGGVLIRTRVKEVR 849

Query: 715 VFAGRNSVGVRGISLAKGDQVISMAIVLHADADY 748
             + R + GV  I+L +G+++  +  V+  D   
Sbjct: 850 EMS-RATQGVILINLDEGEKLAGLERVVETDEAP 882


>gi|221134590|ref|ZP_03560895.1| DNA gyrase, A subunit [Glaciecola sp. HTCC2999]
          Length = 885

 Score =  936 bits (2420), Expect = 0.0,   Method: Composition-based stats.
 Identities = 407/909 (44%), Positives = 576/909 (63%), Gaps = 67/909 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
            +  K I  ++I +E++NSYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++  ++NK
Sbjct: 2   TDRAKEILPINIEEELKNSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNELKNDFNK 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K AR+ G+V+GKYHPHG+ A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA R
Sbjct: 62  PYKKSARVVGDVIGKYHPHGDTAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE R+ K AH LL DL K+TV+F PNYDG+ + P V+  R PN+LVNG  GIAVGMATN
Sbjct: 122 YTEVRMSKIAHELLADLDKETVNFVPNYDGTEKIPEVMPTRVPNLLVNGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL EV++GCVA+I+NP   ++ L+E I GPDFPT A+I GR GI+ AY TGRG I 
Sbjct: 182 IPPHNLTEVINGCVALIENPACTIEELIEYIPGPDFPTAAIISGRKGIEEAYRTGRGKIY 241

Query: 250 IRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYR 309
           +R  + IE+    +E I+V E+PYQVNKA ++EKIAELV+EKRI  ++ LRDESD+ G R
Sbjct: 242 LRARAEIEREDNGKETIIVNELPYQVNKAKLIEKIAELVKEKRIEGVSALRDESDKDGMR 301

Query: 310 VVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVV 369
           +VIE+KR  SA+V+LN LY  T LQ++F +NMVAL+  +P+ F L   L+ F+  R EVV
Sbjct: 302 IVIEVKRNESAEVLLNHLYANTQLQTVFGINMVALDNNQPKVFNLKDTLECFILHRREVV 361

Query: 370 VRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKD 429
            RRT Y L KARDRAH+L GLAIA+AN+D V+ +I+ SP+P  A+ +L  + W   D+ +
Sbjct: 362 TRRTVYELKKARDRAHLLEGLAIALANIDPVIELIKASPSPSEAKLKLTAQGWALGDVAE 421

Query: 430 LIDLIDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLG 481
           +++   D +             DG  YL+E Q +AIL+LRL +LTGL  D I +E   L 
Sbjct: 422 MLERAGDDAARPDWLEPEYGIRDGLYYLTEQQAQAILDLRLHKLTGLEHDKILSEYKDLL 481

Query: 482 IEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVT 541
             I E L IL S  RL+ +I++EL +++DE    RRT I     D++ ED I RED+VVT
Sbjct: 482 DVIAELLRILGSSERLMEVIREELEAIRDEFGDDRRTEITAASHDIDLEDLIEREDVVVT 541

Query: 542 VSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKE 601
           +SH GYVK   LS Y AQ+RGGKG+S   M+DEDF+  L + +TH  +L FS+ G +Y  
Sbjct: 542 LSHEGYVKYQKLSDYEAQKRGGKGKSATKMKDEDFIEKLLVANTHDHILCFSTRGRLYWL 601

Query: 602 KVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNK 661
           KV++LP+ S  ARG+ ++NIL L +GERIT I+P  E     +  YV  AT +G V++ +
Sbjct: 602 KVYQLPLASRNARGRPIVNILPLEEGERITAILPIKEFV---DGKYVFMATTNGTVKKTE 658

Query: 662 LSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNS 721
           L+ + +   +G IA+ L+  +E++ V+    +++I+L +  G+ VRF    +R   GR +
Sbjct: 659 LTQYSRPRANGIIAVNLNDGNELIGVDLTDGDSEIMLFSDAGKVVRFHEEQVRPM-GRTA 717

Query: 722 VGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSV 781
            GVRGI L +  +V+S+ +                                         
Sbjct: 718 TGVRGIRLEEDQKVVSLIV----------------------------------------- 736

Query: 782 EGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGAL 841
                          E  +LT +E G+GKRT   ++   +R+ KG+ +  VS+ N  G +
Sbjct: 737 ------------PQGEGAVLTATENGYGKRTDIAEYPAKSRATKGVVSIKVSERN--GLV 782

Query: 842 VAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESE 901
           V    VN++D+I+L+SD+GTL+R    E+    R T+GV +  T ++E VV ++RI E E
Sbjct: 783 VGAVQVNEDDEIMLISDQGTLVRTRATEVSTVGRNTQGVTLIRTGENENVVGLQRIDEVE 842

Query: 902 IVDEAESTE 910
             +     E
Sbjct: 843 SSNIETDEE 851



 Score = 72.9 bits (177), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 44/255 (17%), Positives = 101/255 (39%), Gaps = 15/255 (5%)

Query: 537 DMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLG 596
             V   +  G VK+  L+ Y   R  G     +   +E    DL      + ++ FS  G
Sbjct: 643 KYVFMATTNGTVKKTELTQYSRPRANGIIAVNLNDGNELIGVDL--TDGDSEIMLFSDAG 700

Query: 597 FVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGN 656
            V +    ++      A G   +  + L + +++ +++             V+ AT++G 
Sbjct: 701 KVVRFHEEQVRPMGRTATG---VRGIRLEEDQKVVSLI------VPQGEGAVLTATENGY 751

Query: 657 VRRNKLSDFIQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVRFPISAI 713
            +R  ++++   +R+ K  + +   +     +      ++++I+L +  G  VR   + +
Sbjct: 752 GKRTDIAEYPAKSRATKGVVSIKVSERNGLVVGAVQVNEDDEIMLISDQGTLVRTRATEV 811

Query: 714 RVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEIT 773
               GRN+ GV  I   + + V+ +  +   ++   E       + A    ++ D +   
Sbjct: 812 STV-GRNTQGVTLIRTGENENVVGLQRIDEVESSNIETDEEGNVIEADAVTVTTDIDSAQ 870

Query: 774 SLKNDSSVEGNISEE 788
            L +D+   G+   E
Sbjct: 871 PLASDNESTGSDDTE 885


>gi|299532465|ref|ZP_07045856.1| DNA gyrase subunit A [Comamonas testosteroni S44]
 gi|298719550|gb|EFI60516.1| DNA gyrase subunit A [Comamonas testosteroni S44]
          Length = 898

 Score =  936 bits (2420), Expect = 0.0,   Method: Composition-based stats.
 Identities = 386/924 (41%), Positives = 560/924 (60%), Gaps = 69/924 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
            +  K    +S+ +EM+ SYL YA++VI+GRA+PD RDGLKPVHRR+L+ M ++  +WN+
Sbjct: 2   TQFAKETLPISLEEEMRRSYLDYAMSVIVGRALPDARDGLKPVHRRVLYAMHELNNDWNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG++A+YD + RMAQD+SLR +L++GQGNFGSVDGD  AA R
Sbjct: 62  PYKKSARIVGDVIGKYHPHGDSAVYDTIVRMAQDFSLRHMLVDGQGNFGSVDGDSAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE RL K AH +L D+ K+TVDF PNYDGS  EP+VL +R PN+LVNG  GIAVGMATN
Sbjct: 122 YTEIRLSKIAHEMLGDIDKETVDFGPNYDGSESEPLVLPSRLPNLLVNGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL EVVDGC+ ++ NP+  +D LMEII  PDFPT  +I G  G+K  Y TGRG +V
Sbjct: 182 IPPHNLNEVVDGCLHLLQNPEASIDELMEIIPAPDFPTAGIIYGINGVKEGYRTGRGRVV 241

Query: 250 IRGVSHIEKTSGDREQ-IVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R   H E     + Q I+V E+PYQVNK  + E++AELV EK+I  I+ ++DESD+ G 
Sbjct: 242 MRAKCHFEDIDKGQRQSIIVDELPYQVNKKTLQERMAELVHEKKIEGISHIQDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           R+VIELKRG   +V+LN LY+ T LQ  F +NMVAL   +P+   L  +++ F+  R EV
Sbjct: 302 RLVIELKRGEVPEVVLNNLYKLTQLQDTFGMNMVALVNGQPKLCNLKDLIQVFLEHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KARDR HVL GLA+A+AN+D+ + IIR +P P  A+  LM++SW++  ++
Sbjct: 362 VTRRTVFELRKARDRGHVLEGLAVALANIDDFIAIIRNAPTPPVAKAALMEKSWDSKLVR 421

Query: 429 DLIDLIDDS----------------SYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDD 472
           +++                       + +  +G   LSE Q + IL++RL RLTGL +D 
Sbjct: 422 EMLTRTRTDGGVVNADDYRPEGLEVEFGMQQNGLYRLSETQAQEILQMRLQRLTGLEQDK 481

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTP----RRTRIVEGLLDME 528
           I  E   +   I++ LDIL+   R+  II +EL +VK E        RR+ +     D+ 
Sbjct: 482 IVAEYKDVMSVIEDLLDILAKPERVSIIIGEELNAVKAEFGQSKKGERRSTVEYSAQDLS 541

Query: 529 DEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTS 588
            ED I   DMVVT+SH GY+K  PLS YR+Q+RGG+G+     +++D++  LFI +TH  
Sbjct: 542 TEDLITPTDMVVTLSHTGYIKSQPLSEYRSQKRGGRGKQATATKEDDWIDQLFIANTHDY 601

Query: 589 VLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFP-EDESSWNNLY 647
           +L FS+ G +Y  KVW +P GS  +RG+ ++N+  L +GE+I  ++P   E+ S   + +
Sbjct: 602 LLCFSNRGRMYWLKVWEVPSGSRGSRGRPIVNMFPLQEGEKINVVLPLTGENRSFPEDHF 661

Query: 648 VVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVR 707
           V  AT  G V++  L++F    ++G IA+ LD  D ++       ++D++L +  G+ VR
Sbjct: 662 VFMATSMGTVKKTALTEFSNPRKAGIIAVGLDEGDYLIGAALTDGKHDVMLFSDGGKAVR 721

Query: 708 FPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISG 767
           F  + +R   GRN+ GVRG+++ +   VI+M +    D   +                  
Sbjct: 722 FDENDVRPM-GRNARGVRGMNIEEHQNVIAMLVAEADDGTGNVV---------------- 764

Query: 768 DTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGI 827
                                         Q +LT +E G+GKRT+  ++    R  KG+
Sbjct: 765 ---------------------------AGSQSVLTATENGYGKRTAISEYTRHGRGTKGM 797

Query: 828 RATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAK 887
            A   S+ N  G +VA   V   D+I+L++D G L+R  V EIR   RAT+GV + +  +
Sbjct: 798 IAIQQSERN--GKVVAATLVAPEDEIMLITDTGVLVRTRVAEIRELGRATQGVTLINLDE 855

Query: 888 DERVVSVERIRESEIVDEA-ESTE 910
             +++ ++RI E++  D A E  E
Sbjct: 856 GAKLIGLQRIVENDANDNAGEDGE 879



 Score = 79.5 bits (194), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 50/249 (20%), Positives = 104/249 (41%), Gaps = 13/249 (5%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  V   + +G VK+  L+ +   R+ G     V + + D++    +      V+ F
Sbjct: 656 FPEDHFVFMATSMGTVKKTALTEFSNPRKAG--IIAVGLDEGDYLIGAALTDGKHDVMLF 713

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWN----NLYV 648
           S  G   +     +      ARG   +N   + + + +  ++    D+ + N    +  V
Sbjct: 714 SDGGKAVRFDENDVRPMGRNARGVRGMN---IEEHQNVIAMLVAEADDGTGNVVAGSQSV 770

Query: 649 VFATKHGNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQC 705
           + AT++G  +R  +S++ +  R   G IA++      ++++      E++I+L T  G  
Sbjct: 771 LTATENGYGKRTAISEYTRHGRGTKGMIAIQQSERNGKVVAATLVAPEDEIMLITDTGVL 830

Query: 706 VRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLI 765
           VR  ++ IR   GR + GV  I+L +G ++I +  ++  DA+ +         S      
Sbjct: 831 VRTRVAEIREL-GRATQGVTLINLDEGAKLIGLQRIVENDANDNAGEDGEADDSGSAGAE 889

Query: 766 SGDTEEITS 774
                   S
Sbjct: 890 GAAESGDAS 898


>gi|54294303|ref|YP_126718.1| DNA gyrase, subunit A, type II topoisomerase [Legionella
           pneumophila str. Lens]
 gi|53754135|emb|CAH15608.1| DNA gyrase, subunit A, type II topoisomerase [Legionella
           pneumophila str. Lens]
          Length = 863

 Score =  936 bits (2420), Expect = 0.0,   Method: Composition-based stats.
 Identities = 412/906 (45%), Positives = 570/906 (62%), Gaps = 68/906 (7%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
           K +  V+I DE++ SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++G +WNK Y K
Sbjct: 6   KEVLPVNIEDELKQSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMSELGNDWNKPYKK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            AR+ G+V+GKYHPHG+ A+YD + RMAQ +S+R +LI+GQGNFGSVDGD PAA RYTE 
Sbjct: 66  SARVVGDVIGKYHPHGDTAVYDTIVRMAQPFSMRYMLIDGQGNFGSVDGDAPAAMRYTEV 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K AH LL DL K+TVDF PNYD +   PVVL +R PN+LVNG  GIAVGMATNIP H
Sbjct: 126 RMSKVAHALLADLDKETVDFSPNYDETEFAPVVLPSRIPNLLVNGSSGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NL EV++ C+A++D PD  L+ LMEII GPDFPT A+I GR GI   Y TG+G +VIR  
Sbjct: 186 NLTEVINACIALVDEPDTSLEDLMEIIPGPDFPTAAIINGRAGIIEGYRTGKGRVVIRAR 245

Query: 254 SHIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVI 312
           + IE   S  R+ I++ E+PYQVNKA ++E+IAELVR+K+I  I+ LRDESD+QG RVVI
Sbjct: 246 TEIETDESSGRQSIIIQELPYQVNKARLIERIAELVRDKKIEGISGLRDESDKQGMRVVI 305

Query: 313 ELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRR 372
           ELKR   ADV+LN L+ +T +Q++F +NMVAL   +P    L  IL+ F+  R EVV RR
Sbjct: 306 ELKRNEVADVVLNNLFAHTQMQNVFGINMVALVDGQPRTLNLKQILEYFIKHRREVVTRR 365

Query: 373 TKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLID 432
           T + L KAR+RAH+L GL IA+AN+DE++ +I+ S  P+ A+  L+ + W    +K +++
Sbjct: 366 TIFELKKARNRAHLLEGLGIALANIDEMIALIKQSSTPQDAKSALLSKIWQPGLVKAMLE 425

Query: 433 LIDDSSYTIGS--------DGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEI 484
               ++             +    LSE Q +AILELRL RLT L +D I NE   L   I
Sbjct: 426 KAGSNASRPDDLTEEYGLHENGYKLSEAQAQAILELRLHRLTALEQDKIINEFEELLNLI 485

Query: 485 KECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSH 544
           KE LDIL+S  RL+ +I+ EL+ +K +    RRT I     D+  ED I  ED+VVT+SH
Sbjct: 486 KELLDILASPERLMQVIRDELIEIKSQFGDERRTEITASQEDLTIEDLITEEDVVVTLSH 545

Query: 545 LGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVW 604
            GYVK  P++ Y+AQRRGGKG+S   ++DEDFV  L I STH ++L FS+ G +Y  K +
Sbjct: 546 QGYVKYQPITAYQAQRRGGKGKSATHVKDEDFVERLVIASTHDTLLCFSNHGKLYWLKAY 605

Query: 605 RLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSD 664
           +LP  S  +RG+ +INIL L +GE I  ++P  E +   +  YV  ATK G V++  L+ 
Sbjct: 606 QLPQASRASRGRPIINILPLAEGEEINAMLPVREYK---DGSYVFMATKKGTVKKVPLNA 662

Query: 665 FIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGV 724
           F +   +G IA+ L+  D ++ V+      DI+L T  G+ +RF  S +R   GR + GV
Sbjct: 663 FSRPRSNGIIAVDLEEDDSLVGVDITDGARDIMLFTDAGKVIRFDESKVRPM-GRTARGV 721

Query: 725 RGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGN 784
           RGI + K   V S+ +V                                           
Sbjct: 722 RGIRVEKDQAVKSLVVVDP----------------------------------------- 740

Query: 785 ISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAV 844
                          ILT +E G+GKRT   ++R+S R G+G+ +  V++ N  G +V  
Sbjct: 741 -----------SGGTILTATENGYGKRTHIDEYRVSGRGGQGVISIQVTERN--GKVVRS 787

Query: 845 FPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE-SEIV 903
             V DND+ +L++DKGTL+R  VNE+ +  R T+GV + + +  E VV +++I +  E +
Sbjct: 788 LQVTDNDEAMLITDKGTLVRFKVNELSVIGRNTQGVRLINVSSGEAVVGMQKIVDLGEEL 847

Query: 904 DEAEST 909
           +EAE +
Sbjct: 848 EEAEDS 853


>gi|30248349|ref|NP_840419.1| DNA gyrase subunit A [Nitrosomonas europaea ATCC 19718]
 gi|30138235|emb|CAD84243.1| DNA gyrase/topoisomerase IV, subunit A [Nitrosomonas europaea ATCC
           19718]
          Length = 848

 Score =  936 bits (2420), Expect = 0.0,   Method: Composition-based stats.
 Identities = 385/905 (42%), Positives = 565/905 (62%), Gaps = 69/905 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           E+  K    VS+ DEM+ SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M ++  +WN+
Sbjct: 2   EQFAKETLPVSLEDEMRRSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMHELSNDWNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG+ A+YD + RMAQ +SLR +L++GQGNFGS+DGD  AA R
Sbjct: 62  PYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDNAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE R+ + AH LL DL K+TVDF PNYDGS QEP++L A+ PN+L+NG  GIAVGMATN
Sbjct: 122 YTEIRMSRIAHELLADLDKNTVDFGPNYDGSEQEPLILPAKIPNLLINGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNLGEV+D C+ ++ +PD+D+  LM  I  PDFPT  +I G +GIK+ Y TGRG ++
Sbjct: 182 IPPHNLGEVIDACLLLLRDPDVDIAELMACIPAPDFPTAGIIYGISGIKDGYQTGRGRVI 241

Query: 250 IRGVSHIEK-TSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R  +H E+   G+R  I++ E+PYQVNKA +L +I ELVR+KRI  I+DLRDESD+ G 
Sbjct: 242 MRARTHFEELDKGNRHSIIIDELPYQVNKANLLVRIGELVRDKRIEGISDLRDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVIELKRG   +V+LN LY+ T +Q  F +NMVAL   +P    L  +L  F+  R EV
Sbjct: 302 RVVIELKRGEVPEVVLNNLYKETQMQDTFGINMVALVDGQPRLLNLKQMLDHFLRHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KAR+R H+L GLA+A++N+DE++ +I+ +P P  A++ LM R+W +S ++
Sbjct: 362 VTRRTLFELRKARERGHLLEGLAVALSNVDEIIALIKAAPTPAEAKKGLMARTWRSSLVE 421

Query: 429 DLIDLIDDSSYTIG----------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELN 478
           +++      +              SD    LS+ Q +AIL+LRL RLTGL ++ I +E  
Sbjct: 422 EMLLRAMIDAAVFRPETLAAGFGMSDQGYRLSDAQAQAILDLRLQRLTGLEQEKIVSEYR 481

Query: 479 SLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDM 538
            +  +I++ LDIL++  R+  II +EL ++K +   PRR+ +V    ++  ED I   DM
Sbjct: 482 EILDKIRDLLDILANPERITTIIVEELTAIKGQFGDPRRSEVVIDAQNLNTEDLITPADM 541

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           VVT+SH GY+K   L  YRAQ+RGG+G+  +  R++DF+ +LFI +TH  +L FSSLG V
Sbjct: 542 VVTLSHAGYIKSQLLDDYRAQKRGGRGKQAITTREDDFIDNLFIANTHDFILCFSSLGRV 601

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVR 658
           Y  KV+ +P GS  +RG+ + N++ L Q E+I  ++P    +   +  YV  +T  G V+
Sbjct: 602 YWIKVYNVPQGSRTSRGRPVNNLVPLEQNEKINAVLPVKSFD---DTRYVFMSTAGGTVK 658

Query: 659 RNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAG 718
           +  LS+F +   +G IA+ LD  D ++ V     ++D++L +  G+ +RF  + +R   G
Sbjct: 659 KTPLSEFSRPRTNGIIAIDLDEGDYLIGVALTEGKHDVMLFSDAGKAMRFDENDVRP-TG 717

Query: 719 RNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKND 778
           RN+ GVRG+ L  G QVIS+ +  + +                                 
Sbjct: 718 RNARGVRGMKLGAGQQVISLLVADNENMA------------------------------- 746

Query: 779 SSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEI 838
                                +LT +E G+GKRT   ++   NR  +G+ A + +  N  
Sbjct: 747 ---------------------VLTATENGYGKRTPITEYTRHNRGTQGMIAINTNVRN-- 783

Query: 839 GALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
           G +VA   V  +D+I+L++  G +IR  V+EIR   RAT+GV + +    E++  +ERI 
Sbjct: 784 GKVVAAQLVESSDEIMLITTGGVMIRTRVSEIREMGRATQGVTLINLDAGEKLAGLERIV 843

Query: 899 ESEIV 903
           E++  
Sbjct: 844 ETDED 848


>gi|157827322|ref|YP_001496386.1| DNA gyrase subunit A [Rickettsia bellii OSU 85-389]
 gi|157802626|gb|ABV79349.1| DNA gyrase subunit A [Rickettsia bellii OSU 85-389]
          Length = 905

 Score =  936 bits (2418), Expect = 0.0,   Method: Composition-based stats.
 Identities = 460/900 (51%), Positives = 634/900 (70%), Gaps = 15/900 (1%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           MT++           +  V+I DEM+ SYL YA++VI+ RAIPD+RDGLKPVHRRI++ M
Sbjct: 1   MTDN-------NSSNLVPVNIEDEMKVSYLDYAMSVIVSRAIPDVRDGLKPVHRRIIYSM 53

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            + G   N+ Y K ARI G+VMGKYHPHG++AIYD+L RMAQD+SLRL L++GQGNFGS+
Sbjct: 54  HEAGNHANRAYRKSARIVGDVMGKYHPHGDSAIYDSLVRMAQDFSLRLPLVDGQGNFGSL 113

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGD  AA RYTE R+ K AH L++D+ K+TV F PNYDGS +EP VL + +PN+LVNG G
Sbjct: 114 DGDAAAAMRYTESRMAKVAHKLIEDIDKETVSFNPNYDGSEEEPSVLPSMFPNLLVNGSG 173

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNLGEV+D C   +DN DI++  L+E+++GPDFPT  +ILG  GIK+A
Sbjct: 174 GIAVGMATNIPPHNLGEVIDACCLYVDNNDIEILDLLEVVKGPDFPTSGIILGVNGIKSA 233

Query: 241 YATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLR 300
           Y TGRGSI IRG + IE     R+ I++TEIPY VNKA ++EKIAE+V+EKRI  I+DLR
Sbjct: 234 YLTGRGSIAIRGRAEIENLGNGRQAIIITEIPYMVNKARLVEKIAEMVKEKRIEGISDLR 293

Query: 301 DESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKA 360
           DES++ G R+ IELK+   A+V+LNQ+Y  T LQ+ F V M+AL    P+   L  ++ A
Sbjct: 294 DESNKNGIRIYIELKKDIVAEVVLNQIYSCTQLQTSFGVIMLALKDGLPKVMNLKEVIAA 353

Query: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420
           FV+FRE V+  RT YLLNKARD+AH+L+GL IAV+N+DE++RII+ + +P  A++ELM R
Sbjct: 354 FVSFREVVITNRTIYLLNKARDKAHILLGLTIAVSNIDEIIRIIKAASDPNAAKQELMAR 413

Query: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
           SW+A +I  L+ L+DD +  +  +G    +E Q +AILE+RL RLT + ++ +  +L +L
Sbjct: 414 SWDALNILPLVKLVDDKAM-LNEEGKCSFTEAQAKAILEMRLQRLTAMEKNKLEEDLKNL 472

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
             EI E L+IL SR RLL I+K+EL+ VK+E  TPR T I  G  D + ED I RE+MVV
Sbjct: 473 ATEITEYLNILGSRERLLEILKEELIKVKEEFATPRLTSIEFGEFDQDIEDLIQREEMVV 532

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           TV+  GY+KRVPLS YRAQ+RGGKGRSG+ MRDED  T +F+ STHT +LFFS++G VY 
Sbjct: 533 TVTLGGYIKRVPLSSYRAQKRGGKGRSGLSMRDEDITTQVFVGSTHTPMLFFSNIGQVYS 592

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
            K+++LP+ +PQ +G+ ++NIL L   E IT IMP PE++  W+NL ++FAT  GN+RR+
Sbjct: 593 LKLYKLPLSNPQGKGRPMVNILPLKGDEHITNIMPLPENQDEWDNLNIMFATAKGNIRRS 652

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
            L DF +I  +GKIA++LD  D+++ V+ C ++  ILL TK G+ +RFP+ ++RV   R 
Sbjct: 653 DLLDFKKIQSNGKIAIRLDEDDKLIDVKPCKEDEHILLATKSGKALRFPVESLRVIKSRT 712

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSS 780
           S GVRG+ LA+ D VISM ++    A  +ER  Y+     +R  I+   E      N   
Sbjct: 713 SDGVRGMRLAEDDSVISMTVLKGIKATREERDAYLSVSWEKRLEIAKGEE-----FNSEE 767

Query: 781 VEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGA 840
           +  +++ E   E+   E+FILTV+E GFGKR+S+Y +RI++RSG GI   D++  ++ G 
Sbjct: 768 LGVDLTAESILEMANSEEFILTVTENGFGKRSSAYGYRITDRSGSGIINMDIN--DKTGL 825

Query: 841 LVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900
           +V V PV  +D+++L+++ G LIR  +  +RI  R T GV +F     E+VVS   I ES
Sbjct: 826 VVGVMPVKMDDELMLITNSGKLIRCKLETVRITGRNTSGVTLFRLDDGEKVVSASLIAES 885


>gi|271499645|ref|YP_003332670.1| DNA gyrase subunit A [Dickeya dadantii Ech586]
 gi|270343200|gb|ACZ75965.1| DNA gyrase, A subunit [Dickeya dadantii Ech586]
          Length = 877

 Score =  936 bits (2418), Expect = 0.0,   Method: Composition-based stats.
 Identities = 405/903 (44%), Positives = 574/903 (63%), Gaps = 68/903 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMSVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGS+DGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEVR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL K+TVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLSDLDKETVDFVPNYDGTEQIPDVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV++GC+A ID+ +I ++ LM  I GPDFPT A+I G+ GI+ AY TGRG + IR  +
Sbjct: 187 LSEVINGCLAYIDDENISVEGLMAHIPGPDFPTAAIINGKRGIEEAYRTGRGKVYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV++KRI  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKDKRIDGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T +Q  F +NMVAL+  +P+  TL  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNHLYSQTQMQVSFGINMVALHQGQPKLMTLKDILAAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KAR+RAH+L GLAIA+ N+D ++ +IR +  P  A+  L+ ++W    +  +++ 
Sbjct: 367 IFELRKARERAHILEGLAIALVNIDPIIELIRHASTPADAKTALVAQAWELGSVAAMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG   L+E Q +AIL+LRL +LTGL  + + +E   L  +I 
Sbjct: 427 AGDDAARPEWLEPEFGIHDGKYRLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLTQIA 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E L IL S  RL+ +I++EL +++++ +  RRT I     D+  ED I +E++VVT+SH 
Sbjct: 487 ELLFILRSPERLMEVIREELEAIREQYNDARRTEITHNSADINIEDLISQENVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PL+ Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWLKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ +IN+L L Q ERIT I+P  E E   N   V  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIINLLPLEQDERITAILPVREYEEGMN---VFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L +  G+ VRF  SA+R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNDGDELIGVDLTDGSNEVMLFSAEGKVVRFSESAVRTM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+V+S+ +                                             
Sbjct: 723 GINLQDDDRVVSLIVPRGDGD--------------------------------------- 743

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                         ILTV++ GFGKRT+  ++ + +R+ KG+ +  VS+ N  G +V   
Sbjct: 744 --------------ILTVTQNGFGKRTAVTEYPVKSRATKGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V+  DQI++++D GTL+R  V+E+ I  R T+GV +  TA++ERVV ++R+ E    DE
Sbjct: 788 QVDTADQIMMITDAGTLVRTRVSEVSIVGRNTQGVTLIRTAEEERVVGLQRVAEPVEDDE 847

Query: 906 AES 908
            +S
Sbjct: 848 LDS 850



 Score = 69.8 bits (169), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 43/245 (17%), Positives = 88/245 (35%), Gaps = 15/245 (6%)

Query: 538 MVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGF 597
            V   +  G VK+  L+ +   R  G     +   DE    DL        V+ FS+ G 
Sbjct: 645 NVFMATASGTVKKTALTEFSRPRSAGIIAVNLNDGDELIGVDL--TDGSNEVMLFSAEGK 702

Query: 598 VYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNV 657
           V +     +      A G   IN+   ++                  +  ++  T++G  
Sbjct: 703 VVRFSESAVRTMGRTATGVRGINLQDDDR---------VVSLIVPRGDGDILTVTQNGFG 753

Query: 658 RRNKLSDFIQINRSGKIAMKLD---SRDEILSVETCTQENDILLTTKLGQCVRFPISAIR 714
           +R  ++++   +R+ K  + +       +++        + I++ T  G  VR  +S + 
Sbjct: 754 KRTAVTEYPVKSRATKGVISIKVSERNGKVVGAVQVDTADQIMMITDAGTLVRTRVSEV- 812

Query: 715 VFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITS 774
              GRN+ GV  I  A+ ++V+ +  V     D +            +  I     +  +
Sbjct: 813 SIVGRNTQGVTLIRTAEEERVVGLQRVAEPVEDDELDSVVPVDGELPQEDIDEPESDDDA 872

Query: 775 LKNDS 779
             +D 
Sbjct: 873 PADDE 877


>gi|239996349|ref|ZP_04716873.1| DNA gyrase, A subunit [Alteromonas macleodii ATCC 27126]
          Length = 904

 Score =  936 bits (2418), Expect = 0.0,   Method: Composition-based stats.
 Identities = 412/927 (44%), Positives = 574/927 (61%), Gaps = 87/927 (9%)

Query: 11  EEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKK 70
           +  K I  V+I +E++NSYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++  ++NK 
Sbjct: 3   DNAKEILPVNIEEELKNSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNELKNDFNKP 62

Query: 71  YVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERY 130
           Y K AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RY
Sbjct: 63  YKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRY 122

Query: 131 TECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNI 190
           TE R+ K AH LL DL K+TVDF PNYDG+   P VL  + PN+LVNG  GIAVGMATNI
Sbjct: 123 TEVRMAKIAHELLADLDKETVDFVPNYDGTEHIPEVLPTKVPNLLVNGSSGIAVGMATNI 182

Query: 191 PTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVI 250
           P HNL EV++GCVA+I +P I +D LM  I GPDFPT A+I GR GI++AY TGRG I +
Sbjct: 183 PPHNLTEVINGCVALIQDPSITIDDLMTHIPGPDFPTAAMISGRKGIEDAYRTGRGKIYL 242

Query: 251 RGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRV 310
           R  + IE  S  +E IVV EIPYQVNKA ++EKIAELV+EKRI  ++ LRDESD+ G R+
Sbjct: 243 RAKAEIETDSNGKETIVVNEIPYQVNKARLIEKIAELVKEKRIEGVSALRDESDKDGMRI 302

Query: 311 VIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVV 370
           VIE+KR  SA+V+LN LY  T LQ++F +NMVAL+  +P+ F L   L+ F+  R EVV 
Sbjct: 303 VIEVKRNESAEVLLNHLYANTQLQTVFGINMVALDNGQPKVFNLKETLECFILHRREVVT 362

Query: 371 RRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDL 430
           RRT + L KARDRAH+L GLAIA+AN+D ++ +I+ S +P  A++ L+ + W+  D+  +
Sbjct: 363 RRTVFELRKARDRAHILEGLAIALANIDPIIELIKASQSPADAKKSLVAQGWDLGDVAQM 422

Query: 431 IDLIDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGI 482
           ++   D +             DG  YL+E Q +AIL+LRL +LTGL  + I  E   L  
Sbjct: 423 LERAGDDAARPDWLMPEFGIRDGKYYLTEQQAQAILDLRLHKLTGLEHEKILEEYKQLLE 482

Query: 483 EIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTV 542
            I E L IL+S  RL+ +I++EL  V+DE    RRT I     D++ ED I +ED+VVT+
Sbjct: 483 IIAELLHILNSPERLMEVIQEELEKVRDEFGDERRTEITAASHDIDIEDLIEQEDVVVTL 542

Query: 543 SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEK 602
           S  GYVK   L+ Y AQRRGG+G+S   M+DEDF+  L + +TH  +L FS+ G +Y  K
Sbjct: 543 SREGYVKYQKLTDYEAQRRGGRGKSATKMKDEDFIERLLVANTHDHILCFSTRGRLYWLK 602

Query: 603 VWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKL 662
           V++LP  S  ARG+ ++NIL L + ERIT I+P  E E      +V+ AT +G V++  L
Sbjct: 603 VYQLPFASRNARGRPIVNILPLEENERITAILPIKEFE---EGKFVLMATANGTVKKTDL 659

Query: 663 SDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPIS----------- 711
           S + +   SG IA+ L+  DE++ V+    ++DI+L +  G+ VRF              
Sbjct: 660 SLYSRPRSSGIIAVNLNEGDELIGVDITHGDDDIMLFSDAGKVVRFNEKLRDSETGEVKR 719

Query: 712 ---------AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQR 762
                    A+R   GR + GVRGI L  G +V+S+ +                      
Sbjct: 720 DPETGEELLALRPM-GRTATGVRGIRLQDGQKVVSLIV---------------------- 756

Query: 763 RLISGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNR 822
                                             +  ILT +E GFGKRT   D+   +R
Sbjct: 757 -------------------------------PKGDGPILTATENGFGKRTPLEDYPAKSR 785

Query: 823 SGKGIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVI 882
           + +G+ +  VS+ N  G +V    V++ ++I+L+SD+GTL+R  V E+ +  R T+GV +
Sbjct: 786 ATQGVVSIKVSERN--GKVVGAVQVDETNEIMLISDQGTLVRTRVGEVSVVGRNTQGVRL 843

Query: 883 FSTAKDERVVSVERIRESEIVDEAEST 909
             T + E VV ++RI E E + E +  
Sbjct: 844 IRTVEGEHVVGLQRIEEVEELQEFDED 870



 Score = 67.9 bits (164), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 65/440 (14%), Positives = 140/440 (31%), Gaps = 38/440 (8%)

Query: 377 LNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDD 436
           L + +    ++  L   + + + ++ +I+     E  +          ++I      ID 
Sbjct: 474 LEEYKQLLEIIAELLHILNSPERLMEVIQE----ELEKVRDEFGDERRTEITAASHDIDI 529

Query: 437 SSYTIGSDGTMYLS-EVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRS 495
                  D  + LS E   +             GR     ++     +  E L + ++  
Sbjct: 530 EDLIEQEDVVVTLSREGYVKYQKLTDYEAQRRGGRGKSATKMKD--EDFIERLLVANTHD 587

Query: 496 RLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTV------------- 542
            +L    +  L        P  +R   G   +        E +   +             
Sbjct: 588 HILCFSTRGRLYWLKVYQLPFASRNARGRPIVNILPLEENERITAILPIKEFEEGKFVLM 647

Query: 543 -SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKE 601
            +  G VK+  LS+Y   R  G     +   DE    D+        ++ FS  G V + 
Sbjct: 648 ATANGTVKKTDLSLYSRPRSSGIIAVNLNEGDELIGVDI--THGDDDIMLFSDAGKVVRF 705

Query: 602 K--VWRLPIGSPQARGKALINILSLNQGERITTIMP---------FPEDESSWNNLYVVF 650
              +     G  +   +    +L+L    R  T +                   +  ++ 
Sbjct: 706 NEKLRDSETGEVKRDPETGEELLALRPMGRTATGVRGIRLQDGQKVVSLIVPKGDGPILT 765

Query: 651 ATKHGNVRRNKLSDFIQINRSGKIAMKLD---SRDEILSVETCTQENDILLTTKLGQCVR 707
           AT++G  +R  L D+   +R+ +  + +       +++      + N+I+L +  G  VR
Sbjct: 766 ATENGFGKRTPLEDYPAKSRATQGVVSIKVSERNGKVVGAVQVDETNEIMLISDQGTLVR 825

Query: 708 FPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISG 767
             +  +    GRN+ GVR I   +G+ V+ +  +   +   +        +S      + 
Sbjct: 826 TRVGEV-SVVGRNTQGVRLIRTVEGEHVVGLQRIEEVEELQEFDEDGNLIISDDAPEQAE 884

Query: 768 DTEEITSLKNDSSVEGNISE 787
              +      +        E
Sbjct: 885 TAVQEQENTAEDGDGSTTEE 904


>gi|325981795|ref|YP_004294197.1| DNA gyrase, A subunit [Nitrosomonas sp. AL212]
 gi|325531314|gb|ADZ26035.1| DNA gyrase, A subunit [Nitrosomonas sp. AL212]
          Length = 852

 Score =  936 bits (2418), Expect = 0.0,   Method: Composition-based stats.
 Identities = 389/906 (42%), Positives = 559/906 (61%), Gaps = 69/906 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
            +  K    +S+ +EM+ SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++  +WN+
Sbjct: 2   NQFAKETLPISLEEEMRRSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHELSNDWNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG+ A+YD + RMAQD+SLR +LI+GQGNFGSVDGD  AA R
Sbjct: 62  PYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQDFSLRYMLIDGQGNFGSVDGDNAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE R+ + AH LL DL K+TVDF PNYD S +EP++L A+ PN+L+NG  GIAVGMATN
Sbjct: 122 YTEIRMSRIAHELLVDLDKETVDFGPNYDDSEKEPLILPAKIPNLLINGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL EVV+ C+A++ N +I +D L+++I  PDFPT  +I G  G+++ Y TGRG +V
Sbjct: 182 IPPHNLSEVVEACLALLKNSNISIDELIDLIPAPDFPTAGIIYGVNGVRDGYRTGRGRVV 241

Query: 250 IRGVSHIEKTSGDREQ-IVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R  +H E       Q I++ E+PYQVNKA +L +I ELVR+K+I  I+DLRDESD+ G 
Sbjct: 242 MRARTHFEDLEKGNRQSIIIDELPYQVNKANLLIRIGELVRDKKIEGISDLRDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVIELKRG   +VILN LY+ T +Q  F +NMVAL   +P    L  IL AF+  R EV
Sbjct: 302 RVVIELKRGEVPEVILNNLYKETQMQDTFGMNMVALLDGQPRLLNLKQILDAFLRHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KAR+R H+L GLA+A++N+DE++ +I+ +P P  A+  LM ++W++  ++
Sbjct: 362 VTRRTVFELKKARERGHLLEGLAVALSNVDEIIALIKAAPTPADAKEALMAKAWHSQLVE 421

Query: 429 DLIDLIDDSSYTIGSDGT----------MYLSEVQTRAILELRLARLTGLGRDDIRNELN 478
           +++      +  +  +G            +LS+ Q +AILELRL RLTGL ++ I  E  
Sbjct: 422 EMLTRAMADANALRPEGLDDMFGLKAQGYHLSDAQAQAILELRLQRLTGLEQEKIVAEYK 481

Query: 479 SLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDM 538
            +  +I + LDIL++  R+  II +EL ++K +    RR+ IV    D+  ED I   D+
Sbjct: 482 DVIEKIIDYLDILANPERITQIITEELDAIKLQFGDERRSEIVVDTQDLSMEDLITPADV 541

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           VVT+SH GY+K   L  YRAQ+RGG+G+     +++DF+  LFI +TH  +L FSSLG V
Sbjct: 542 VVTLSHTGYIKSQLLDDYRAQKRGGRGKLATSTKEDDFIDKLFIANTHDYILCFSSLGRV 601

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVR 658
           Y  KV+ +P G  Q+RGK +IN + L +GE+I  I+P    +    N +V  AT  G V+
Sbjct: 602 YWIKVYEVPQGGRQSRGKPIINWVQLEEGEKINAILPVKTFD---ENRFVFMATSFGTVK 658

Query: 659 RNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAG 718
           +  LS+F +   +G IA+ LD  D ++ VE    ++D++L +  G+ +RF  + +R   G
Sbjct: 659 KTPLSEFSRPRNNGIIAIGLDEGDFLIGVELTEGKHDVMLFSDNGKAMRFSENDVRPM-G 717

Query: 719 RNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKND 778
           R + GVRG+ L  G +VISM +  + D                                 
Sbjct: 718 RTARGVRGMKLGPGHKVISMLVAENEDLA------------------------------- 746

Query: 779 SSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEI 838
                                +LT +E G+GKRT   ++   NR  +G+ A   S  N  
Sbjct: 747 ---------------------VLTATENGYGKRTPISEYTRHNRGTQGMIAIITSARN-- 783

Query: 839 GALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
           G +V    V  +D+I+L++  G LIR  VNE+R  SRAT+GV + +    E++  +ER+ 
Sbjct: 784 GKVVTAKLVKPDDEIMLITSGGVLIRTRVNEVREMSRATQGVTLINLDAGEKLAGLERVV 843

Query: 899 ESEIVD 904
           ESE  D
Sbjct: 844 ESEDDD 849



 Score = 85.2 bits (209), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 43/216 (19%), Positives = 98/216 (45%), Gaps = 14/216 (6%)

Query: 538 MVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGF 597
            V   +  G VK+ PLS +   R  G     + + + DF+  + +      V+ FS  G 
Sbjct: 647 FVFMATSFGTVKKTPLSEFSRPRNNG--IIAIGLDEGDFLIGVELTEGKHDVMLFSDNGK 704

Query: 598 VYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNV 657
             +     +      ARG   +  + L  G ++ +++          +L V+ AT++G  
Sbjct: 705 AMRFSENDVRPMGRTARG---VRGMKLGPGHKVISMLVAEN-----EDLAVLTATENGYG 756

Query: 658 RRNKLSDFIQINRSGKIAMKL---DSRDEILSVETCTQENDILLTTKLGQCVRFPISAIR 714
           +R  +S++ + NR  +  + +       ++++ +    +++I+L T  G  +R  ++ +R
Sbjct: 757 KRTPISEYTRHNRGTQGMIAIITSARNGKVVTAKLVKPDDEIMLITSGGVLIRTRVNEVR 816

Query: 715 VFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDE 750
             + R + GV  I+L  G+++  +  V+ ++ D  +
Sbjct: 817 EMS-RATQGVTLINLDAGEKLAGLERVVESEDDDGD 851


>gi|241662455|ref|YP_002980815.1| DNA gyrase subunit A [Ralstonia pickettii 12D]
 gi|240864482|gb|ACS62143.1| DNA gyrase, A subunit [Ralstonia pickettii 12D]
          Length = 889

 Score =  936 bits (2418), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/910 (42%), Positives = 559/910 (61%), Gaps = 65/910 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++  K    VS+ +EM++SYL YA++VI+GRA+PD+RDGLKPVHRR L+ M ++  +WN+
Sbjct: 2   DQFAKETLPVSLEEEMRSSYLAYAMSVIVGRALPDVRDGLKPVHRRALYSMHELNNDWNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG+ A+YD + RMAQ++SLR +L++GQGNFGSVDGD  AA R
Sbjct: 62  PYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQNFSLRYMLVDGQGNFGSVDGDNAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE RL K AH LL DL K+TV+F PNYDGS  EP VL AR PN+L+NG  GIAVGMATN
Sbjct: 122 YTEIRLSKIAHELLADLDKETVNFEPNYDGSETEPSVLPARIPNLLINGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL EVVDGC+ ++ NP+  +D L+E+I  PDFPT  +I G +G++  Y TGRG +V
Sbjct: 182 IPPHNLNEVVDGCLHLLRNPEATVDELIELIPAPDFPTAGIIYGISGVREGYRTGRGRVV 241

Query: 250 IRGVSHIEKTSGDR-EQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R  +H E     + + I+V E+PYQVNK  +LE+IAELV EKRI  I+D+RDESD+ G 
Sbjct: 242 MRAKTHFEDIDRGQRQAIIVDELPYQVNKRTLLERIAELVTEKRIEGISDIRDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVIELKRG   +V+LN LY+ T LQ  F +NMVAL   +P    L  +L+ F+  R EV
Sbjct: 302 RVVIELKRGEVPEVVLNNLYKNTQLQDTFGMNMVALVDGQPRLLNLRQMLECFLLHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KAR+R H+L GLA+A+AN+DE + II+ +P P  A+ ELM RSW++  ++
Sbjct: 362 VTRRTVFDLRKARERGHILEGLAVALANIDEFIAIIKAAPTPPVAKAELMNRSWDSGLVR 421

Query: 429 DLIDLIDD---------------SSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDI 473
           D++   +                  + +  DG   LS+ Q + IL++RL RLTGL +D I
Sbjct: 422 DMLVRAESETSGGGAAYRPEGLLPVFGMQGDGLYRLSDTQAQEILQMRLQRLTGLEQDKI 481

Query: 474 RNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCI 533
             E   +  +I + LDIL+   R+  II +EL +++ E    RR++I     +++ ED I
Sbjct: 482 VQEYREVMAQIADLLDILAKPERITAIIVEELTAIRAEFGDERRSQIEHNATELDTEDLI 541

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
             +D+VVT+SH GY+K  P+S YRAQ+RGG+G+     +++D++  LF+ +TH  +L FS
Sbjct: 542 TPQDLVVTLSHSGYMKSQPISEYRAQKRGGRGKQAAATKEDDWIDTLFVANTHDYILCFS 601

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           + G +Y  KVW +P GS  +RG+ ++N+  L+ GE+I  I+P  + +      +V  AT 
Sbjct: 602 NRGRLYWLKVWEVPQGSRNSRGRPIVNMFPLSPGEKINVILPVKQFD---EQHFVFMATS 658

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAI 713
            G V++  L++F    ++G IA+ LD  D ++  +    ++D++L +  G+ VRF  + +
Sbjct: 659 KGTVKKTALTEFSNPRKAGIIAVDLDEGDFLIGADITDGQHDVMLFSDAGKAVRFDENDV 718

Query: 714 RVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEIT 773
           R   GR + GVRG++L +  QVI+M +     A    +                      
Sbjct: 719 RPM-GRQARGVRGMNLEENQQVIAMLVAPAETAGEGAQSGAGS----------------- 760

Query: 774 SLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVS 833
                                     +LT +E G+GKRT   ++    R  KG+ A   S
Sbjct: 761 --------------------------VLTATENGYGKRTPISEYTRHGRGTKGMIAIQTS 794

Query: 834 KINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVS 893
           + N  G +VA   V   D+I+L++  G LIR  V+EIR   RAT+GV + S  +  ++  
Sbjct: 795 ERN--GKVVAAALVAPEDEIMLITTGGVLIRTRVDEIREMGRATQGVTLISVGEGNKLSG 852

Query: 894 VERIRESEIV 903
           ++R+ ES+  
Sbjct: 853 LQRVMESDAE 862



 Score = 75.6 bits (184), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 49/249 (19%), Positives = 104/249 (41%), Gaps = 13/249 (5%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  V   +  G VK+  L+ +   R+ G     +   + DF+    I      V+ F
Sbjct: 647 FDEQHFVFMATSKGTVKKTALTEFSNPRKAGIIAVDLD--EGDFLIGADITDGQHDVMLF 704

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMP----FPEDESSWNNLYV 648
           S  G   +     +     QARG   +N   L + +++  ++        + +      V
Sbjct: 705 SDAGKAVRFDENDVRPMGRQARGVRGMN---LEENQQVIAMLVAPAETAGEGAQSGAGSV 761

Query: 649 VFATKHGNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQC 705
           + AT++G  +R  +S++ +  R   G IA++      ++++      E++I+L T  G  
Sbjct: 762 LTATENGYGKRTPISEYTRHGRGTKGMIAIQTSERNGKVVAAALVAPEDEIMLITTGGVL 821

Query: 706 VRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLI 765
           +R  +  IR   GR + GV  IS+ +G+++  +  V+ +DA+  + +       A     
Sbjct: 822 IRTRVDEIREM-GRATQGVTLISVGEGNKLSGLQRVMESDAEGADAVEGADAADAAPGAD 880

Query: 766 SGDTEEITS 774
           +   +   +
Sbjct: 881 AQSDDSSET 889


>gi|317048908|ref|YP_004116556.1| DNA gyrase subunit A [Pantoea sp. At-9b]
 gi|316950525|gb|ADU70000.1| DNA gyrase, A subunit [Pantoea sp. At-9b]
          Length = 879

 Score =  936 bits (2418), Expect = 0.0,   Method: Composition-based stats.
 Identities = 408/905 (45%), Positives = 582/905 (64%), Gaps = 68/905 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E++NSYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++G +WNK Y K 
Sbjct: 7   EITPVNIEEELKNSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMSELGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGS+DGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEVR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL K+TVDF PNYDG+ Q P VL  + PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MAKIAHDLLADLEKETVDFVPNYDGTEQIPEVLPTKIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV++GC+A ID+ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG I IR   
Sbjct: 187 LREVINGCLAYIDDENISVEGLMEHIPGPDFPTAAIINGRRGIEEAYRTGRGKIYIRARG 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I++ E+PYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKSGRETIIIHELPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  IL+AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQVSFGINMVALHQGQPKIMALKEILEAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L GLAI++AN+D ++ +IR +P P  A+  L+ +SW+  ++  +++ 
Sbjct: 367 IFELRKARDRAHILEGLAISLANIDPIIELIRRAPTPAEAKAGLIAQSWDLGNVAAMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  YL+E Q +AIL+LRL +LTGL  + + +E   L  +I 
Sbjct: 427 AGDDAARPEWLEAEFGIRDGRYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLEQIA 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E L IL+S  RL+ +I++EL +++D+    RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELLHILASAERLMEVIREELEAMRDQFGDDRRTEITANSADINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PLS Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E    +N   +  AT  G V++  L +F
Sbjct: 607 LPEASRGARGRPIVNLLPLEANERITAILPVREYTEGFN---IFMATADGTVKKTALQEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L   DE++ V      ++ +L +  G+ VRF  +A+R   GR++ GVR
Sbjct: 664 SRPRSAGIIAINLREDDELIGVALTNGSDETMLFSAAGKVVRFAEAAVRAM-GRSASGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI LA+GD+V+S+ +     A                                       
Sbjct: 723 GIKLAEGDKVVSLIVPREEGA--------------------------------------- 743

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                         ILTV++ G+GKRT++ ++   +R+ +G+ +  V++ N  G +V   
Sbjct: 744 --------------ILTVTQNGYGKRTANSEYPTKSRATQGVISIKVTERN--GPVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V+D+DQI++++D GTL+R  V+E+ +  R T+GV++  TA+DE VV ++R+ E    +E
Sbjct: 788 QVDDSDQIMMITDAGTLVRTRVSEVSVVGRNTQGVILIRTAEDENVVGLQRVAEPVEEEE 847

Query: 906 AESTE 910
            +S +
Sbjct: 848 LDSID 852



 Score = 70.2 bits (170), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/222 (15%), Positives = 86/222 (38%), Gaps = 15/222 (6%)

Query: 543 SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEK 602
           +  G VK+  L  +   R  G     + +R++D +  + + +     + FS+ G V +  
Sbjct: 650 TADGTVKKTALQEFSRPRSAG--IIAINLREDDELIGVALTNGSDETMLFSAAGKVVRFA 707

Query: 603 VWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKL 662
              +      A   + +  + L +G+++ +++             ++  T++G  +R   
Sbjct: 708 EAAVRAMGRSA---SGVRGIKLAEGDKVVSLI------VPREEGAILTVTQNGYGKRTAN 758

Query: 663 SDFIQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
           S++   +R+ +  + +   +     +        + I++ T  G  VR  +S +    GR
Sbjct: 759 SEYPTKSRATQGVISIKVTERNGPVVGAVQVDDSDQIMMITDAGTLVRTRVSEV-SVVGR 817

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQ 761
           N+ GV  I  A+ + V+ +  V     + +            
Sbjct: 818 NTQGVILIRTAEDENVVGLQRVAEPVEEEELDSIDGSVAEGD 859


>gi|127512877|ref|YP_001094074.1| DNA gyrase, A subunit [Shewanella loihica PV-4]
 gi|126638172|gb|ABO23815.1| DNA gyrase subunit A [Shewanella loihica PV-4]
          Length = 879

 Score =  936 bits (2418), Expect = 0.0,   Method: Composition-based stats.
 Identities = 413/905 (45%), Positives = 572/905 (63%), Gaps = 69/905 (7%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
             IT ++I DE++NSYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++  +WNK Y K
Sbjct: 6   SSITPINIEDELKNSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNELKNDWNKPYKK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            AR+ G+V+GKYHPHG++A+YD + RMAQ +S+R  L++GQGNFGSVDGD  AA RYTE 
Sbjct: 66  SARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSMRYTLVDGQGNFGSVDGDAAAAMRYTEI 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K AH LL DL K+TVD+ PNYDG+ Q P VL  R P +LVNG  GIAVGMATNIP H
Sbjct: 126 RMDKLAHQLLADLEKETVDYVPNYDGTEQIPAVLPTRIPALLVNGSSGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NL EV+ GC+A+ID P + ++ LME I GPDFPT A++ GR GI++AY TGRG  V+R  
Sbjct: 186 NLSEVISGCLALIDEPSLSIEQLMEHIPGPDFPTAAIVNGRKGIEDAYKTGRGKAVMRAR 245

Query: 254 SHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
           + +E     RE+I+VTEIPYQVNKA ++EKIAELV++K+I  I+ LRDESD+ G R+VIE
Sbjct: 246 ATVETEDNGRERIIVTEIPYQVNKARLIEKIAELVKDKKIEGISGLRDESDKDGMRIVIE 305

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KRG   +VILN LY  T LQ+ F +NMVAL   +P+ F L  +L+ F+  R EVV RRT
Sbjct: 306 VKRGEVGEVILNNLYAQTQLQTSFGINMVALTNGQPKLFNLKEMLECFILHRREVVTRRT 365

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KAR+RAH+L  LAIA+AN+D ++ +I+ SP P  A+ +L+ + W   +++ +++ 
Sbjct: 366 VFELRKARERAHILEALAIALANIDPIIALIKASPTPAEAKTKLVSQGWALGNVQGMLEK 425

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  YL+E Q +AIL+LRL +LTGL  + I +E   L   I 
Sbjct: 426 AGDDAARPEWLSAEFGIRDGLYYLTEQQAQAILDLRLHKLTGLEHEKILSEYEELLELIA 485

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
             L IL S  RL+ +IK+EL  V +     RRT +    +D+  ED I  ED+VVT+SHL
Sbjct: 486 ALLYILRSPERLMEVIKEELQEVLEVFGDERRTELNASAVDISLEDLINEEDVVVTLSHL 545

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GY K  PLS Y+AQRRGGKG++   ++DEDFV  L + +TH ++L FS  G +Y  KV++
Sbjct: 546 GYAKYQPLSDYQAQRRGGKGKAATKVKDEDFVEKLLVANTHDTILCFSDFGKMYWLKVYQ 605

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP+ S QARG+ +IN+L L +GERIT I+P  E +    + YV+ AT HG V++  L  +
Sbjct: 606 LPLASRQARGRPIINLLPLAEGERITAILPVREYD---ADKYVIMATSHGTVKKTSLDQY 662

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L   D+++ V+    +N+++L +  G+ VRF    +R   GR + GVR
Sbjct: 663 SRPRANGIIAVNLKDGDQLIGVDITNGDNEVMLFSNEGKVVRFSEDQVRGM-GRTATGVR 721

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI L  G  V+S+ +                                             
Sbjct: 722 GIKLEDGQSVVSLIV--------------------------------------------- 736

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV+E G+GKRT   ++   +R+ KG+ +  VS+ N  GA+V   
Sbjct: 737 --------PKNDGAILTVTENGYGKRTELDEYPAKSRATKGVVSIKVSERN--GAVVGAV 786

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V +ND+I+L+SDKGTL+R P + +    R T+GV I  TA DE VV ++RI   EI DE
Sbjct: 787 QVLENDEIMLISDKGTLVRTPASGVSTIGRNTQGVTIIRTATDETVVGLQRI--DEIQDE 844

Query: 906 AESTE 910
            E  E
Sbjct: 845 QEFDE 849



 Score = 67.5 bits (163), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 45/253 (17%), Positives = 95/253 (37%), Gaps = 15/253 (5%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  V+  +  G VK+  L  Y   R  G     V ++D D +  + I +    V+ F
Sbjct: 639 YDADKYVIMATSHGTVKKTSLDQYSRPRANG--IIAVNLKDGDQLIGVDITNGDNEVMLF 696

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           S+ G V +    ++      A G   +  + L  G+               N+  ++  T
Sbjct: 697 SNEGKVVRFSEDQVRGMGRTATG---VRGIKLEDGQ------SVVSLIVPKNDGAILTVT 747

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVRFP 709
           ++G  +R +L ++   +R+ K  + +   +     +      + ++I+L +  G  VR P
Sbjct: 748 ENGYGKRTELDEYPAKSRATKGVVSIKVSERNGAVVGAVQVLENDEIMLISDKGTLVRTP 807

Query: 710 ISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT 769
            S +    GRN+ GV  I  A  + V+ +  +     + +        ++        + 
Sbjct: 808 ASGVSTI-GRNTQGVTIIRTATDETVVGLQRIDEIQDEQEFDEEGNPIITDTVEEQQVEG 866

Query: 770 EEITSLKNDSSVE 782
           E   +  +    E
Sbjct: 867 EAPEAEPDVEPNE 879


>gi|304408849|ref|ZP_07390470.1| DNA gyrase, A subunit [Shewanella baltica OS183]
 gi|307302852|ref|ZP_07582607.1| DNA gyrase, A subunit [Shewanella baltica BA175]
 gi|304352670|gb|EFM17067.1| DNA gyrase, A subunit [Shewanella baltica OS183]
 gi|306913212|gb|EFN43634.1| DNA gyrase, A subunit [Shewanella baltica BA175]
          Length = 916

 Score =  936 bits (2418), Expect = 0.0,   Method: Composition-based stats.
 Identities = 410/926 (44%), Positives = 572/926 (61%), Gaps = 88/926 (9%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
             I+ ++I DE++NSYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++  +WNK Y K
Sbjct: 6   SSISPINIEDELKNSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMSELKNDWNKPYKK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR  L++GQGNFGSVDGD  AA RYTE 
Sbjct: 66  SARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYTLVDGQGNFGSVDGDSAAAMRYTEI 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K AH LL DL K+TVDF PNYDG+   P VL  R PN+L+NG  GIAVGMATNIP H
Sbjct: 126 RMDKLAHQLLADLEKETVDFVPNYDGTELIPAVLPTRVPNLLINGSSGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NL EVV GC+A+I+ P + ++ LME I GPDFPT A+I GR GI +AY TGRG  ++R +
Sbjct: 186 NLTEVVKGCLALIEEPSLSIEQLMEYIPGPDFPTAAIINGRKGIIDAYKTGRGRAIMRAL 245

Query: 254 SHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
           + +E     RE+I+VTEIPYQVNKA ++EKIAELV++K++  I+ LRDESD+ G R+VIE
Sbjct: 246 ADVETEDNGRERIIVTEIPYQVNKARLIEKIAELVKDKKLEGISGLRDESDKDGMRIVIE 305

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KRG   +V+LN LY  T +Q  F +NMVAL   +P+ F L  +L+ F+  R EVV RRT
Sbjct: 306 IKRGEVGEVVLNNLYAQTQMQCSFGINMVALTNGQPKLFNLKEMLECFILHRREVVTRRT 365

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KAR+RAH+L  LA+A+AN+D ++ +I+ SP P  A+ +L+++ W    ++ +++ 
Sbjct: 366 VFELRKARERAHILEALAVALANIDPIIALIKASPTPADAKVKLVEQGWELGHVQGMLEK 425

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  +L+E Q +AILELRL RLTGL  D I  E   L   I 
Sbjct: 426 AGDDAARPEWLEPQYGIRDGQYFLTEQQAQAILELRLHRLTGLEHDKIIAEYEELLEFIA 485

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
             L IL S  RL+ +IK+EL+ + DE    RRT I    +DM  ED I  ED+VVT+SHL
Sbjct: 486 GLLFILRSPERLMEVIKEELVQILDEYGDARRTVINANEVDMSLEDLINEEDVVVTLSHL 545

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GY K  PL+ Y+AQRRGGKG++   ++DEDFV  L + +TH ++L FS  G +Y  KV++
Sbjct: 546 GYAKYQPLTDYQAQRRGGKGKAATKVKDEDFVEKLLVANTHDTILCFSDFGKMYWLKVYQ 605

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP+ S  ARG+ ++N+L L+ GERIT I+P  E      + Y++ AT HG V++  L+ +
Sbjct: 606 LPLASRTARGRPIVNLLPLSDGERITAILPVREYA---ADKYIIMATSHGTVKKTALTAY 662

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPIS-------------- 711
                +G IA+ L   D+++ V+    +++I+L +  G+ VRF                 
Sbjct: 663 SNPRANGIIAVNLKDGDQLIGVDITNGDDEIMLFSNEGKVVRFGEKVRDSETGEVKTDPE 722

Query: 712 ------AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLI 765
                 ++R   GR + GVRGI L +G +V+S+ +     A                   
Sbjct: 723 TGEEVLSLRPM-GRTATGVRGIRLEEGQKVVSLIVPKGDGA------------------- 762

Query: 766 SGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGK 825
                                             ILTV+E G+GKRT   ++   +R+ K
Sbjct: 763 ----------------------------------ILTVTENGYGKRTQLSEYPAKSRATK 788

Query: 826 GIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFST 885
           G+ +  VS+ N  GA+V    V  ND+++L+SDKGTL+R P   + I  R T+GV I  T
Sbjct: 789 GVVSIKVSERN--GAVVGAVQVGLNDELMLISDKGTLVRTPAGGVSIIGRNTQGVTIIRT 846

Query: 886 AKDERVVSVERIRE-SEIVDEAESTE 910
           A DE+VV ++RI E     DE E  E
Sbjct: 847 AGDEKVVGLQRIDEIQSDEDEVELDE 872



 Score = 62.5 bits (150), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 50/250 (20%), Positives = 101/250 (40%), Gaps = 17/250 (6%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  ++  +  G VK+  L+ Y   R  G     V ++D D +  + I +    ++ F
Sbjct: 639 YAADKYIIMATSHGTVKKTALTAYSNPRANG--IIAVNLKDGDQLIGVDITNGDDEIMLF 696

Query: 593 SSLGFVYKE--KVWRLPIGSPQARGKALINILSLNQGERITTIMP---------FPEDES 641
           S+ G V +   KV     G  +   +    +LSL    R  T +                
Sbjct: 697 SNEGKVVRFGEKVRDSETGEVKTDPETGEEVLSLRPMGRTATGVRGIRLEEGQKVVSLIV 756

Query: 642 SWNNLYVVFATKHGNVRRNKLSDFIQINR--SGKIAMKLDSRDEILSVETCTQ-ENDILL 698
              +  ++  T++G  +R +LS++   +R   G +++K+  R+  +         ++++L
Sbjct: 757 PKGDGAILTVTENGYGKRTQLSEYPAKSRATKGVVSIKVSERNGAVVGAVQVGLNDELML 816

Query: 699 TTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHM 758
            +  G  VR P   +    GRN+ GV  I  A  ++V+ +  +    +D DE       +
Sbjct: 817 ISDKGTLVRTPAGGV-SIIGRNTQGVTIIRTAGDEKVVGLQRIDEIQSDEDEVELDENGL 875

Query: 759 SAQRRLISGD 768
                +I G+
Sbjct: 876 PIVPVIIEGE 885


>gi|114327883|ref|YP_745040.1| DNA gyrase subunit A [Granulibacter bethesdensis CGDNIH1]
 gi|114316057|gb|ABI62117.1| DNA gyrase subunit A [Granulibacter bethesdensis CGDNIH1]
          Length = 940

 Score =  935 bits (2417), Expect = 0.0,   Method: Composition-based stats.
 Identities = 471/902 (52%), Positives = 641/902 (71%), Gaps = 9/902 (0%)

Query: 16  ITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKCA 75
           +  V++ +EM  SYL YA++VI+ RA+PD RDGLKPVHRRIL+GM + G   +K Y K A
Sbjct: 22  LMPVTLEEEMSRSYLDYAMSVIVSRALPDARDGLKPVHRRILYGMQESGYTADKPYRKSA 81

Query: 76  RISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECRL 135
           RI+G+VMGKYHPHG+AAIYDAL R+AQ +SLR+ LI+GQGNFGS+DGDP AA RYTE RL
Sbjct: 82  RINGDVMGKYHPHGDAAIYDALVRLAQPFSLRVPLIDGQGNFGSMDGDPAAAPRYTEARL 141

Query: 136 QKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHNL 195
            ++A FLL+D+ +DTVDF+PNYD S  EP VL A YPN+LVNG  GIAVGMAT IPTHN 
Sbjct: 142 ARSASFLLNDIDRDTVDFQPNYDDSEMEPRVLPASYPNLLVNGADGIAVGMATKIPTHNP 201

Query: 196 GEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVSH 255
            EV+D  +A+IDNPDI LD LM +I GPDFPTG +ILGR+GI++A+ TG+GSI +R  + 
Sbjct: 202 TEVIDATLAMIDNPDITLDELMTVIPGPDFPTGGLILGRSGIRSAFETGKGSITVRARTD 261

Query: 256 IEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIELK 315
            E+  G R+ IV++EIPYQVNKA + E++AELVR K+I  I+D+RDESDR G RVVIELK
Sbjct: 262 FEEVRGGRQAIVISEIPYQVNKATLQERMAELVRAKQIEGISDIRDESDRSGVRVVIELK 321

Query: 316 RGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRTKY 375
           R A+ DV+LN L+R+T LQ  + +NM+AL+G +P    L  +L  F+ FRE+V++RR ++
Sbjct: 322 RDATPDVVLNHLFRFTQLQISYGINMLALDGGQPRLMGLRDVLSTFIRFREDVILRRARF 381

Query: 376 LLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLID 435
            LNKARDRAH+LVGLAIAVAN+DEV+R+IR SP+  +AR  LM+R W A+D+  L+ LID
Sbjct: 382 ELNKARDRAHLLVGLAIAVANIDEVIRLIRQSPDSTSARIALMERDWPAADVAPLLTLID 441

Query: 436 DSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRS 495
           D    +    T+ L+EVQ R ILELRL RLTGL RD I NE+  +   I E L+I+ S  
Sbjct: 442 DGGNVLTEAQTVRLTEVQARGILELRLQRLTGLERDKIHNEMQEVAARIGELLEIIGSHI 501

Query: 496 RLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVKRVPLSV 555
           R + ++++EL  ++ EL++PRR+ I + L D +DE  I    MVVT++  G++KR PL V
Sbjct: 502 RRMEVMREELAVIRAELNSPRRSEINDSLADQDDESLIEPGQMVVTITRDGFIKRTPLDV 561

Query: 556 YRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARG 615
           +R Q RGG+GR+   MR +D VT  F   TH  VLFFSS G  Y++KVWRLP   P A+G
Sbjct: 562 FRQQHRGGRGRAAASMRGDDIVTRSFNAHTHQWVLFFSSGGKAYRQKVWRLPEAGPTAKG 621

Query: 616 KALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIA 675
           +AL+N+L     + IT ++P P+DES W  L++VFAT  G +RRN+LSDF  +  SG IA
Sbjct: 622 RALVNLLPELGSDGITAVLPLPQDESLWEGLHLVFATASGGIRRNRLSDFKNVRASGLIA 681

Query: 676 MKLDSRDEILSVETCTQENDILLTTKLGQCVRF--PISAIRVFAGRNSVGVRGISLAKGD 733
           MKLD  D ++ V TC + +DI+L ++LG+C+RF      +RVFAGR S GVRG+ LA+GD
Sbjct: 682 MKLDEGDRLIGVATCREGDDIMLASRLGRCIRFQANEDTLRVFAGRESSGVRGMKLAQGD 741

Query: 734 QVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEIT------SLKNDSSVEGNISE 787
           +VIS++++ H +A  +ER  Y+++ SA+RR  +G+ ++I            +  +  +S 
Sbjct: 742 EVISLSVLRHVEATPEERAAYLRYASARRRSAAGEEDQIDAEVMEADDSEVTVDDTALSP 801

Query: 788 ERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPV 847
           ER   L+  E+F+LTV+  GFGKR+S+YD+R+S R G+GI   +++  N   A+ A FPV
Sbjct: 802 ERIAGLEEAEEFLLTVTIAGFGKRSSAYDYRVSGRGGQGIANINLAPRNGR-AVAATFPV 860

Query: 848 NDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDEAE 907
              D ++LV+D G LIRVP +++RI  R+T GV +F   KDE V SV  + E+E VD+  
Sbjct: 861 RPGDDVMLVTDAGRLIRVPADQVRITGRSTMGVTLFRVDKDEVVTSVFPVLETESVDDNG 920

Query: 908 ST 909
             
Sbjct: 921 DD 922



 Score = 57.5 bits (137), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 54/131 (41%), Gaps = 5/131 (3%)

Query: 645 NLYVVFATKHGNVRRNKLSDF-IQINRSGKIA-MKL--DSRDEILSVETCTQENDILLTT 700
             +++  T  G  +R+   D+ +       IA + L   +   + +       +D++L T
Sbjct: 811 EEFLLTVTIAGFGKRSSAYDYRVSGRGGQGIANINLAPRNGRAVAATFPVRPGDDVMLVT 870

Query: 701 KLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSA 760
             G+ +R P   +R   GR+++GV    + K + V S+  VL  ++  D          A
Sbjct: 871 DAGRLIRVPADQVR-ITGRSTMGVTLFRVDKDEVVTSVFPVLETESVDDNGDDADSVAPA 929

Query: 761 QRRLISGDTEE 771
                  D+++
Sbjct: 930 APDGQVTDSDD 940


>gi|160875516|ref|YP_001554832.1| DNA gyrase subunit A [Shewanella baltica OS195]
 gi|160861038|gb|ABX49572.1| DNA gyrase, A subunit [Shewanella baltica OS195]
 gi|315267703|gb|ADT94556.1| DNA gyrase, A subunit [Shewanella baltica OS678]
          Length = 916

 Score =  935 bits (2417), Expect = 0.0,   Method: Composition-based stats.
 Identities = 409/926 (44%), Positives = 572/926 (61%), Gaps = 88/926 (9%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
             I+ ++I DE++NSYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++  +WNK Y K
Sbjct: 6   SSISPINIEDELKNSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMSELKNDWNKPYKK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR  L++GQGNFGSVDGD  AA RYTE 
Sbjct: 66  SARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYTLVDGQGNFGSVDGDSAAAMRYTEI 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K AH LL DL K+TVDF PNYDG+   P VL  R PN+L+NG  GIAVGMATNIP H
Sbjct: 126 RMDKLAHQLLADLEKETVDFVPNYDGTELIPAVLPTRVPNLLINGSSGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NL EVV GC+A+I+ P + ++ LME I GPDFPT A+I GR GI +AY TGRG  ++R +
Sbjct: 186 NLTEVVKGCLALIEEPSLSIEQLMEYIPGPDFPTAAIINGRKGIIDAYKTGRGRAIMRAL 245

Query: 254 SHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
           + +E     RE+I+VTEIPYQVNKA ++EKIAELV++K++  I+ LRDESD+ G R+VIE
Sbjct: 246 ADVETEDNGRERIIVTEIPYQVNKARLIEKIAELVKDKKLEGISGLRDESDKDGMRIVIE 305

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KRG   +V+LN LY  T +Q  F +NMVAL   +P+ F L  +L+ F+  R EVV RRT
Sbjct: 306 IKRGEVGEVVLNNLYAQTQMQCSFGINMVALTNGQPKLFNLKEMLECFILHRREVVTRRT 365

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KAR+RAH+L  LA+A+AN+D ++ +I+ SP P  A+ +L+++ W    ++ +++ 
Sbjct: 366 VFELRKARERAHILEALAVALANIDPIIALIKASPTPADAKVKLVEQGWELGHVQGMLEK 425

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  +L+E Q +AILELRL RLTGL  D I  E   L   I 
Sbjct: 426 AGDDAARPEWLEPQYGIRDGQYFLTEQQAQAILELRLHRLTGLEHDKIIAEYEELLEFIA 485

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
             L IL S  RL+ +IK+EL+ + +E    RRT I    +DM  ED I  ED+VVT+SHL
Sbjct: 486 GLLFILRSPERLMEVIKEELVQILEEYGDARRTVINANEVDMSLEDLINEEDVVVTLSHL 545

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GY K  PL+ Y+AQRRGGKG++   ++DEDFV  L + +TH ++L FS  G +Y  KV++
Sbjct: 546 GYAKYQPLTDYQAQRRGGKGKAATKVKDEDFVEKLLVANTHDTILCFSDFGKMYWLKVYQ 605

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP+ S  ARG+ ++N+L L+ GERIT I+P  E      + Y++ AT HG V++  L+ +
Sbjct: 606 LPLASRTARGRPIVNLLPLSDGERITAILPVREYA---ADKYIIMATSHGTVKKTALTAY 662

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPIS-------------- 711
                +G IA+ L   D+++ V+    +++I+L +  G+ VRF                 
Sbjct: 663 SNPRANGIIAVNLKDGDQLIGVDITNGDDEIMLFSNEGKVVRFGEKVRDSETGEVKTDPE 722

Query: 712 ------AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLI 765
                 ++R   GR + GVRGI L +G +V+S+ +     A                   
Sbjct: 723 TGEEVLSLRPM-GRTATGVRGIRLEEGQKVVSLIVPKGDGA------------------- 762

Query: 766 SGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGK 825
                                             ILTV+E G+GKRT   ++   +R+ K
Sbjct: 763 ----------------------------------ILTVTENGYGKRTQLSEYPAKSRATK 788

Query: 826 GIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFST 885
           G+ +  VS+ N  GA+V    V  ND+++L+SDKGTL+R P   + I  R T+GV I  T
Sbjct: 789 GVVSIKVSERN--GAVVGAVQVGLNDELMLISDKGTLVRTPAGGVSIIGRNTQGVTIIRT 846

Query: 886 AKDERVVSVERIRE-SEIVDEAESTE 910
           A DE+VV ++RI E     DE E  E
Sbjct: 847 AGDEKVVGLQRIDEIQSDEDEVELDE 872



 Score = 62.1 bits (149), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 50/249 (20%), Positives = 100/249 (40%), Gaps = 17/249 (6%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  ++  +  G VK+  L+ Y   R  G     V ++D D +  + I +    ++ F
Sbjct: 639 YAADKYIIMATSHGTVKKTALTAYSNPRANG--IIAVNLKDGDQLIGVDITNGDDEIMLF 696

Query: 593 SSLGFVYKE--KVWRLPIGSPQARGKALINILSLNQGERITTIMP---------FPEDES 641
           S+ G V +   KV     G  +   +    +LSL    R  T +                
Sbjct: 697 SNEGKVVRFGEKVRDSETGEVKTDPETGEEVLSLRPMGRTATGVRGIRLEEGQKVVSLIV 756

Query: 642 SWNNLYVVFATKHGNVRRNKLSDFIQINR--SGKIAMKLDSRDEILSVETCTQ-ENDILL 698
              +  ++  T++G  +R +LS++   +R   G +++K+  R+  +         ++++L
Sbjct: 757 PKGDGAILTVTENGYGKRTQLSEYPAKSRATKGVVSIKVSERNGAVVGAVQVGLNDELML 816

Query: 699 TTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHM 758
            +  G  VR P   +    GRN+ GV  I  A  ++V+ +  +    +D DE       +
Sbjct: 817 ISDKGTLVRTPAGGV-SIIGRNTQGVTIIRTAGDEKVVGLQRIDEIQSDEDEVELDENGL 875

Query: 759 SAQRRLISG 767
                +I G
Sbjct: 876 PIVPVIIEG 884


>gi|126174283|ref|YP_001050432.1| DNA gyrase subunit A [Shewanella baltica OS155]
 gi|153000807|ref|YP_001366488.1| DNA gyrase subunit A [Shewanella baltica OS185]
 gi|217973234|ref|YP_002357985.1| DNA gyrase subunit A [Shewanella baltica OS223]
 gi|125997488|gb|ABN61563.1| DNA gyrase subunit A [Shewanella baltica OS155]
 gi|151365425|gb|ABS08425.1| DNA gyrase, A subunit [Shewanella baltica OS185]
 gi|217498369|gb|ACK46562.1| DNA gyrase, A subunit [Shewanella baltica OS223]
          Length = 916

 Score =  935 bits (2417), Expect = 0.0,   Method: Composition-based stats.
 Identities = 410/926 (44%), Positives = 572/926 (61%), Gaps = 88/926 (9%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
             I+ ++I DE++NSYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++  +WNK Y K
Sbjct: 6   SSISPINIEDELKNSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMSELKNDWNKPYKK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR  L++GQGNFGSVDGD  AA RYTE 
Sbjct: 66  SARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYTLVDGQGNFGSVDGDSAAAMRYTEI 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K AH LL DL K+TVDF PNYDG+   P VL  R PN+L+NG  GIAVGMATNIP H
Sbjct: 126 RMDKLAHQLLADLEKETVDFVPNYDGTELIPAVLPTRVPNLLINGSSGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NL EVV GC+A+I+ P + ++ LME I GPDFPT A+I GR GI +AY TGRG  ++R +
Sbjct: 186 NLTEVVKGCLALIEEPSLSIEQLMEYIPGPDFPTAAIINGRKGIIDAYKTGRGRAIMRAL 245

Query: 254 SHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
           + +E     RE+I+VTEIPYQVNKA ++EKIAELV++K++  I+ LRDESD+ G R+VIE
Sbjct: 246 ADVETEDNGRERIIVTEIPYQVNKARLIEKIAELVKDKKLEGISGLRDESDKDGMRIVIE 305

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KRG   +V+LN LY  T +Q  F +NMVAL   +P+ F L  +L+ F+  R EVV RRT
Sbjct: 306 IKRGEVGEVVLNNLYAQTQMQCSFGINMVALTNGQPKLFNLKEMLECFILHRREVVTRRT 365

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KAR+RAH+L  LA+A+AN+D ++ +I+ SP P  A+ +L+++ W    ++ +++ 
Sbjct: 366 VFELRKARERAHILEALAVALANIDPIIALIKASPTPADAKVKLVEQGWELGHVQGMLEK 425

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  +L+E Q +AILELRL RLTGL  D I  E   L   I 
Sbjct: 426 AGDDAARPEWLEPQYGIRDGQYFLTEQQAQAILELRLHRLTGLEHDKIIAEYEELLEFIA 485

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
             L IL S  RL+ +IK+EL+ + DE    RRT I    +DM  ED I  ED+VVT+SHL
Sbjct: 486 GLLFILRSPERLMEVIKEELVQILDEYGDARRTVINANEVDMSLEDLINEEDVVVTLSHL 545

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GY K  PL+ Y+AQRRGGKG++   ++DEDFV  L + +TH ++L FS  G +Y  KV++
Sbjct: 546 GYAKYQPLTDYQAQRRGGKGKAATKVKDEDFVEKLLVANTHDTILCFSDFGKMYWLKVYQ 605

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP+ S  ARG+ ++N+L L+ GERIT I+P  E      + Y++ AT HG V++  L+ +
Sbjct: 606 LPLASRTARGRPIVNLLPLSDGERITAILPVREYA---ADKYIIMATSHGTVKKTALTAY 662

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPIS-------------- 711
                +G IA+ L   D+++ V+    +++I+L +  G+ VRF                 
Sbjct: 663 SNPRANGIIAVNLKDGDQLIGVDITNGDDEIMLFSNEGKVVRFGEKVRDSETGEVKTDPE 722

Query: 712 ------AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLI 765
                 ++R   GR + GVRGI L +G +V+S+ +     A                   
Sbjct: 723 TGEEVLSLRPM-GRTATGVRGIRLEEGQKVVSLIVPKGDGA------------------- 762

Query: 766 SGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGK 825
                                             ILTV+E G+GKRT   ++   +R+ K
Sbjct: 763 ----------------------------------ILTVTENGYGKRTQLSEYPAKSRATK 788

Query: 826 GIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFST 885
           G+ +  VS+ N  GA+V    V  ND+++L+SDKGTL+R P   + I  R T+GV I  T
Sbjct: 789 GVVSIKVSERN--GAVVGAVQVGLNDELMLISDKGTLVRTPAGGVSIIGRNTQGVTIIRT 846

Query: 886 AKDERVVSVERIRE-SEIVDEAESTE 910
           A DE+VV ++RI E     DE E  E
Sbjct: 847 AGDEKVVGLQRIDEIQSDEDEVELDE 872



 Score = 62.1 bits (149), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 50/249 (20%), Positives = 100/249 (40%), Gaps = 17/249 (6%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  ++  +  G VK+  L+ Y   R  G     V ++D D +  + I +    ++ F
Sbjct: 639 YAADKYIIMATSHGTVKKTALTAYSNPRANG--IIAVNLKDGDQLIGVDITNGDDEIMLF 696

Query: 593 SSLGFVYKE--KVWRLPIGSPQARGKALINILSLNQGERITTIMP---------FPEDES 641
           S+ G V +   KV     G  +   +    +LSL    R  T +                
Sbjct: 697 SNEGKVVRFGEKVRDSETGEVKTDPETGEEVLSLRPMGRTATGVRGIRLEEGQKVVSLIV 756

Query: 642 SWNNLYVVFATKHGNVRRNKLSDFIQINR--SGKIAMKLDSRDEILSVETCTQ-ENDILL 698
              +  ++  T++G  +R +LS++   +R   G +++K+  R+  +         ++++L
Sbjct: 757 PKGDGAILTVTENGYGKRTQLSEYPAKSRATKGVVSIKVSERNGAVVGAVQVGLNDELML 816

Query: 699 TTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHM 758
            +  G  VR P   +    GRN+ GV  I  A  ++V+ +  +    +D DE       +
Sbjct: 817 ISDKGTLVRTPAGGV-SIIGRNTQGVTIIRTAGDEKVVGLQRIDEIQSDEDEVELDENGL 875

Query: 759 SAQRRLISG 767
                +I G
Sbjct: 876 PIVPVIIEG 884


>gi|227114440|ref|ZP_03828096.1| DNA gyrase subunit A [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 879

 Score =  935 bits (2417), Expect = 0.0,   Method: Composition-based stats.
 Identities = 409/903 (45%), Positives = 575/903 (63%), Gaps = 68/903 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMSVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+Y+ + RMAQ +SLR +L++GQGNFGS+DGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYETIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL K+TVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKETVDFVPNYDGTEQIPDVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EVV+GC+A ID+ +I L+ LME I+GPDFPT A+I GR GI+ AY TGRG I IR  +
Sbjct: 187 LTEVVNGCLAYIDDENISLEGLMEHIKGPDFPTAAIINGRRGIEEAYRTGRGKIYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV++KRI  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKDKRIEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ+ F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSQTQLQTSFGINMVALHQGQPKIMPLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L GLAIA+AN+D ++ +IR +P+P  A+  L+ ++W    +  +++ 
Sbjct: 367 IFELRKARDRAHILEGLAIALANIDPIIELIRRAPSPAEAKAALIAQAWELGSVAAMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  YL+E Q +AIL+LRL +LTG+  + + +E  +L  EI 
Sbjct: 427 AGDDAARPEWLEPEYGIRDGRYYLTEQQAQAILDLRLQKLTGMEHEKLLDEYKALLAEIA 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E L IL+S  RL+ +I++EL ++K +    RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELLYILNSPERLMEVIREELEAIKTQYSDERRTEITANTADINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PLS Y AQRRGG+G+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLSDYEAQRRGGRGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      ++  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYE---EGRHIFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     ++ +L +  G+ VRF   A+R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGSDEAMLFSAEGKVVRFSEQAVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+V+S+ I                                             
Sbjct: 723 GINLQGEDRVVSLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      E  ILTV++ GFGKRT+  ++   +R+ KG+ +  VS+ N  G +V   
Sbjct: 738 --------PRGEGDILTVTQNGFGKRTAVSEYPTKSRATKGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V+  DQI++++D GTL+R  V+E+ I  R T+GV +  TA+DE VV ++R+ E    +E
Sbjct: 788 QVDAADQIMMITDAGTLVRTRVSEVSIVGRNTQGVTLIRTAEDEHVVGLQRVAEPVEDEE 847

Query: 906 AES 908
            + 
Sbjct: 848 LDG 850


>gi|237653702|ref|YP_002890016.1| DNA gyrase subunit A [Thauera sp. MZ1T]
 gi|237624949|gb|ACR01639.1| DNA gyrase, A subunit [Thauera sp. MZ1T]
          Length = 883

 Score =  935 bits (2416), Expect = 0.0,   Method: Composition-based stats.
 Identities = 387/904 (42%), Positives = 558/904 (61%), Gaps = 67/904 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
            +  K    +S+ +EM++SYL YA++VI+GRA+PD RDGLKPVHRR+LF M ++  +WN+
Sbjct: 2   TQFAKETLPISLEEEMRHSYLDYAMSVIVGRALPDARDGLKPVHRRVLFAMHELSNDWNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG+ A+YD + RMAQD+SLR +L++GQGNFGSVDGD  AA R
Sbjct: 62  AYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQDFSLRYMLVDGQGNFGSVDGDNAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE R+ +  H LL D+ K+TVDF PNYDGS +EP+VL AR PN+L+NG  GIAVGMATN
Sbjct: 122 YTEIRMARIGHELLADIDKETVDFGPNYDGSEKEPLVLPARIPNLLINGSAGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNLGE+VD C+ ++  PD D++AL++I++ PDFPT  +I G  G++  Y TGRG ++
Sbjct: 182 IPPHNLGEIVDACLKLLAEPDTDIEALIDIVQAPDFPTAGLIYGLAGVREGYRTGRGRVI 241

Query: 250 IRGVSHIEKT-SGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R  +H E     DR+ I+V E+PYQVNK  + E++AELV EK+I  I+++RDESD+ G 
Sbjct: 242 MRARTHFEPIGKTDRQAIIVDELPYQVNKRTLQERMAELVNEKKIEGISEIRDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           R+VIELKRG   +V+LN+L+++T LQ  F +NMVAL   KP    L  +L  F+  R EV
Sbjct: 302 RLVIELKRGEMPEVVLNKLFKHTQLQDSFGMNMVALVDGKPRLLNLKQMLVCFLEHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KARDR H+L GLA+A++N+DE++ +I+ +P P  A+RELM R W ++ ++
Sbjct: 362 VTRRTIFELRKARDRGHILEGLAVALSNVDEIIALIKAAPTPADAKRELMAREWRSALVE 421

Query: 429 DLIDLIDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
           +++      SY                 LSE Q +AILELRL RLTGL +D I  E   +
Sbjct: 422 EMLSRALADSYRPEGLDPQYGLQAQGYRLSEAQAQAILELRLQRLTGLEQDKIVGEYREV 481

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
              I + LDIL+   R+  II +EL +++++   PRR+ +V    ++  ED I  EDMVV
Sbjct: 482 MDVITDLLDILARPERITAIIVEELGAIRNQFGDPRRSELVMNTAEINIEDLITPEDMVV 541

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           T+SH GY KR PL+ YRAQRRGG+G+    M+DEDF+  LF+ +TH +VL FS+ G  Y 
Sbjct: 542 TLSHTGYFKRQPLADYRAQRRGGRGKQATSMKDEDFIDHLFVANTHDTVLCFSNRGRCYW 601

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
            KV+ +P G+  +RGK ++N+  L +GE+IT ++P  E +      +V  AT  G V++ 
Sbjct: 602 LKVYEVPEGTRNSRGKPIVNLFPLVEGEKITAVLPIKEFD---EEHFVFMATSEGTVKKT 658

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
            L+ F    ++G IA+ LD  D ++ V     + D++L +  G+ VRF  + +R   GR+
Sbjct: 659 ALTAFSNPRKAGIIAVNLDDGDHLIGVAITDGQCDVMLFSDAGKAVRFAETDVRPM-GRD 717

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSS 780
           + GVRG++L  G  VI+M +                                        
Sbjct: 718 ARGVRGMTLEDGQAVIAMLVAKD------------------------------------- 740

Query: 781 VEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGA 840
                          + Q +LT +E G+GKRT   ++    R  KG+ A   S  N  G 
Sbjct: 741 ---------------ESQSVLTATENGYGKRTPVAEYTRHGRGTKGMIAIQTSDRN--GR 783

Query: 841 LVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900
           LV    V  +D+++L+S  G LIR  V  IR   R+T+GV + +  +   + S+E++ ES
Sbjct: 784 LVGAVLVEPSDEVMLISTGGVLIRTSVESIREMGRSTQGVTLINLDEGTFLASIEKVAES 843

Query: 901 EIVD 904
           E  +
Sbjct: 844 ESDE 847



 Score = 75.2 bits (183), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 42/252 (16%), Positives = 93/252 (36%), Gaps = 14/252 (5%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              E  V   +  G VK+  L+ +   R+ G     +   D      +        V+ F
Sbjct: 640 FDEEHFVFMATSEGTVKKTALTAFSNPRKAGIIAVNLDDGDHLIGVAI--TDGQCDVMLF 697

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           S  G   +     +      ARG   +  ++L  G+ +  ++   +      +  V+ AT
Sbjct: 698 SDAGKAVRFAETDVRPMGRDARG---VRGMTLEDGQAVIAMLVAKD-----ESQSVLTAT 749

Query: 653 KHGNVRRNKLSDFIQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVRFP 709
           ++G  +R  ++++ +  R  K  + + + D     +        ++++L +  G  +R  
Sbjct: 750 ENGYGKRTPVAEYTRHGRGTKGMIAIQTSDRNGRLVGAVLVEPSDEVMLISTGGVLIRTS 809

Query: 710 ISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT 769
           + +IR   GR++ GV  I+L +G  + S+  V  +++D   R         +    +   
Sbjct: 810 VESIREM-GRSTQGVTLINLDEGTFLASIEKVAESESDESMRASGEGAEGGEAEGGAQAA 868

Query: 770 EEITSLKNDSSV 781
                       
Sbjct: 869 PGEGEAPAADEE 880


>gi|152979411|ref|YP_001345040.1| DNA gyrase subunit A [Actinobacillus succinogenes 130Z]
 gi|150841134|gb|ABR75105.1| DNA gyrase, A subunit [Actinobacillus succinogenes 130Z]
          Length = 890

 Score =  935 bits (2416), Expect = 0.0,   Method: Composition-based stats.
 Identities = 419/908 (46%), Positives = 578/908 (63%), Gaps = 39/908 (4%)

Query: 11  EEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKK 70
           E  + IT VSI DE+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M Q G   NK 
Sbjct: 3   ELSQDITPVSIEDELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFSMDQSGNTHNKA 62

Query: 71  YVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERY 130
           YVK AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGS+DGD PAA RY
Sbjct: 63  YVKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDAPAAMRY 122

Query: 131 TECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNI 190
           TE R+QK    LL DL K+TVDF PNYDG    P VL  + P +LVNG  GIAVGMATNI
Sbjct: 123 TEVRMQKITQELLTDLDKETVDFSPNYDGKEMIPDVLPTKIPALLVNGSSGIAVGMATNI 182

Query: 191 PTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVI 250
           P HNLGEV+DGC+A IDN DI +D LM+ I GPDFPT A+I GR GI+ AY TGRG + +
Sbjct: 183 PPHNLGEVMDGCLAYIDNEDISIDELMQFIPGPDFPTAALINGRRGIEEAYKTGRGKVYV 242

Query: 251 RGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRV 310
           R  + I      REQIVVTEIPYQVNKA ++EKI EL+REK+I  I+ + D S+++G R+
Sbjct: 243 RAKAEIVTNDKGREQIVVTEIPYQVNKAKLVEKIGELIREKKIEGISGILDLSNKEGIRL 302

Query: 311 VIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVV 370
            I++KR A  +V+LN LY  T +Q  F +NMVAL+  +P+ F L  I++AFV  R EVV 
Sbjct: 303 EIDIKRDAVGEVVLNHLYALTQMQVTFGINMVALDHGQPKLFNLKQIIEAFVKHRREVVT 362

Query: 371 RRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDL 430
           RRT Y L KAR+RAH+L GLAIA+AN+D V+ +IR S   + AR  L+ R+W   ++  +
Sbjct: 363 RRTVYELRKARERAHILEGLAIALANIDPVINLIRASKTADEAREGLLARAWELGNVAPM 422

Query: 431 IDLIDDSSYTIGS--------DGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGI 482
           ++                   +G  YLSE Q RAILELRL RLTGL  + I +E   + +
Sbjct: 423 LEAAGVDVSRPDDLPAECGVREGQYYLSETQARAILELRLHRLTGLEHEKIVSEYQEILV 482

Query: 483 EIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTV 542
           +I E L IL+S  RL  +I++EL  VK   +  RRT I     D+  ED I +ED+VVT+
Sbjct: 483 QIGEYLHILTSIERLREVIREELELVKTNFNDARRTEITTASSDINLEDLIAQEDVVVTL 542

Query: 543 SHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEK 602
           SH GYVK  PL+ Y AQRRGGKG+S   M+++DF+  L + +TH ++L FSS G +Y  K
Sbjct: 543 SHEGYVKYQPLTDYEAQRRGGKGKSATKMKEDDFIEKLLVANTHDTILCFSSRGRLYWLK 602

Query: 603 VWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKL 662
           V++LP  S  ARG+ ++NIL L + ERIT I+P    +    + +V+ AT  G V++  L
Sbjct: 603 VYQLPEASRGARGRPIVNILPLEENERITAILPVASYD---EDKFVLMATAGGIVKKTAL 659

Query: 663 SDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSV 722
           ++F +   +G IA+ L   DE++ V+     N+I+L +  G+ VRF  SA+R   GR + 
Sbjct: 660 TEFSRPRSNGIIAVNLRDEDELIGVDITDGSNEIMLFSSQGRVVRFAESAVRAM-GRTAT 718

Query: 723 GVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVE 782
           GVRGI LA                                   + + EE++   +  S++
Sbjct: 719 GVRGIKLA-------------------------LTNDLSDEESAVEIEEVSEDNSQESLD 753

Query: 783 GNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALV 842
            NI +     +   +  ILT ++ G+GKRT   ++   +R+ KG+ +  VS+ N  G +V
Sbjct: 754 LNIDKVVSLVVPKNDGEILTATQNGYGKRTKLEEYPTKSRNTKGVISIKVSERN--GKVV 811

Query: 843 AVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEI 902
           A   V + DQI+L++D GTL+R  V E+ +  R T+GV +  TA+DE+VVS+ER+ E + 
Sbjct: 812 AATQVEEADQIMLITDAGTLVRTRVTEVSVVGRNTQGVRLIRTAEDEQVVSLERVAEPDD 871

Query: 903 VDEAESTE 910
             + E  E
Sbjct: 872 EFDGEDVE 879


>gi|322832014|ref|YP_004212041.1| DNA gyrase, A subunit [Rahnella sp. Y9602]
 gi|321167215|gb|ADW72914.1| DNA gyrase, A subunit [Rahnella sp. Y9602]
          Length = 883

 Score =  935 bits (2416), Expect = 0.0,   Method: Composition-based stats.
 Identities = 410/903 (45%), Positives = 576/903 (63%), Gaps = 68/903 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT ++I +E++NSYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK Y K 
Sbjct: 7   EITPINIEEELKNSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNVLGNDWNKAYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG+ A+YD + RMAQ +SLR +L++GQGNFGSVDGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDTAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL K+TVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKETVDFVPNYDGTEQIPSVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV++GC+A I++ +I ++ LME I GPDFPT A+I GR GI+ AY TGRG I IR  +
Sbjct: 187 LTEVINGCLAYIEDENISIEGLMEHIPGPDFPTAAIINGRRGIEEAYRTGRGKIYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ+ F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSLTQLQTSFGINMVALHQGQPKILGLKEILSAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L  LAIA+AN+D ++ +IR +P P  A+  L+ RSW+  ++  ++  
Sbjct: 367 IFELRKARDRAHILEALAIALANIDPIIELIRAAPTPAEAKAGLVARSWDLGNVSAMLAS 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  +L+E Q +AIL+LRL +LTGL  + + +E   L ++I 
Sbjct: 427 AGDDAARPEWLEPQFGIHDGKYFLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLVQIA 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E L ILS+  RL+ +I++EL +++D+ + PRRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELLFILSNPDRLMEVIREELEAIRDQYNDPRRTEITANTSDINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PL+ Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILMFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      +V  AT  G V++  L+DF
Sbjct: 607 LPEASRGARGRPIVNLLPLEPNERITAILPVREYE---EGRHVFMATASGTVKKTALTDF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+    +++++L +  G+ VRF   A+R   GR + GVR
Sbjct: 664 SRPRSAGIIAINLNEGDELIGVDLTDGKDEVMLFSAAGKVVRFSEEAVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI L +GD V+S+ I                                             
Sbjct: 723 GIRLGEGDSVVSLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      +  ILTV++ GFGKRT S ++   +R+ +G+ +  VS+ N  G ++   
Sbjct: 738 --------PRGDGCILTVTQNGFGKRTESTEYPTKSRATQGVISIKVSERN--GPVIGAI 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V++ DQI++++D GTL+R  V+E+    R T+GV +  TA DE VV ++R+ E    +E
Sbjct: 788 QVDEADQIMMITDAGTLVRTRVSEVSTVGRNTQGVTLIRTADDENVVGLQRVAEPVEDEE 847

Query: 906 AES 908
            + 
Sbjct: 848 LDG 850



 Score = 72.9 bits (177), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 41/249 (16%), Positives = 87/249 (34%), Gaps = 15/249 (6%)

Query: 539 VVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFV 598
           V   +  G VK+  L+ +   R  G     +   DE    DL        V+ FS+ G V
Sbjct: 646 VFMATASGTVKKTALTDFSRPRSAGIIAINLNEGDELIGVDL--TDGKDEVMLFSAAGKV 703

Query: 599 YKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVR 658
            +     +      A G   I         R+              +  ++  T++G  +
Sbjct: 704 VRFSEEAVRSMGRTATGVRGI---------RLGEGDSVVSLIIPRGDGCILTVTQNGFGK 754

Query: 659 RNKLSDFIQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVRFPISAIRV 715
           R + +++   +R+ +  + +   +     +      + + I++ T  G  VR  +S +  
Sbjct: 755 RTESTEYPTKSRATQGVISIKVSERNGPVIGAIQVDEADQIMMITDAGTLVRTRVSEVST 814

Query: 716 FAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSL 775
             GRN+ GV  I  A  + V+ +  V     D +      +    +    +   ++  S 
Sbjct: 815 V-GRNTQGVTLIRTADDENVVGLQRVAEPVEDEELDGVATEAGELEAAQAADLPDDAESE 873

Query: 776 KNDSSVEGN 784
            +  + +  
Sbjct: 874 DDQPADDEE 882


>gi|52841647|ref|YP_095446.1| DNA gyrase, subunit A, type II topoisomerase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|52628758|gb|AAU27499.1| DNA gyrase, A subunit [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
          Length = 871

 Score =  935 bits (2416), Expect = 0.0,   Method: Composition-based stats.
 Identities = 414/919 (45%), Positives = 573/919 (62%), Gaps = 68/919 (7%)

Query: 1   MTEHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGM 60
           M++  I       K +  V+I DE++ SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M
Sbjct: 1   MSKGYIQIMVYLAKEVLPVNIEDELKQSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAM 60

Query: 61  MQMGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSV 120
            ++  +WNK Y K AR+ G+V+GKYHPHG+ A+YD + RMAQ +S+R +LI+GQGNFGSV
Sbjct: 61  SELSNDWNKPYKKSARVVGDVIGKYHPHGDTAVYDTIVRMAQPFSMRYMLIDGQGNFGSV 120

Query: 121 DGDPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGG 180
           DGD PAA RYTE R+ K AH LL DL K+TVDF PNYD +   PVVL +R PN+LVNG  
Sbjct: 121 DGDAPAAMRYTEVRMSKVAHALLADLDKETVDFSPNYDETEFAPVVLPSRIPNLLVNGSS 180

Query: 181 GIAVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNA 240
           GIAVGMATNIP HNL EV++ C+A++D PD  L+ LMEII GPDFPT A+I GR GI   
Sbjct: 181 GIAVGMATNIPPHNLTEVINACIALVDEPDTSLEDLMEIIPGPDFPTAAIINGRAGIIEG 240

Query: 241 YATGRGSIVIRGVSHIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADL 299
           Y TG+G +VIR  + IE   S  R+ I++ E+PYQVNKA ++E+IAELVR+K+I  I+ L
Sbjct: 241 YRTGKGRVVIRARTEIETDESSGRQSIIIQELPYQVNKARLIERIAELVRDKKIEGISGL 300

Query: 300 RDESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILK 359
           RDESD+QG RVVIELKR   ADV+LN L+ +T +Q++F +NMVAL   +P    L  IL+
Sbjct: 301 RDESDKQGMRVVIELKRNEVADVVLNNLFAHTQMQNVFGINMVALVDGQPRTLNLKQILE 360

Query: 360 AFVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQ 419
            F+  R EVV RRT + L KAR RAH+L GL IA+AN+DE++ +I+ SP P+ A+  L+ 
Sbjct: 361 YFIKHRREVVTRRTIFELKKARSRAHLLEGLGIALANIDEMIALIKQSPTPQDAKSALLS 420

Query: 420 RSWNASDIKDLIDLIDDSSYTIGS--------DGTMYLSEVQTRAILELRLARLTGLGRD 471
           + W    +K +++    ++             +    LSE Q +AILELRL RLT L +D
Sbjct: 421 KIWQPGLVKAMLEKAGSNASRPDDLTEEYGLHESGYKLSEAQAQAILELRLHRLTALEQD 480

Query: 472 DIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDED 531
            I NE   L   IKE LDIL+S  RL+ +I+ EL+ +K +    RRT I     D+  ED
Sbjct: 481 KIINEFEELLNLIKELLDILASPERLMQVIRDELIEIKSQFGDERRTEITASQEDLTIED 540

Query: 532 CIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLF 591
            I  ED+VVT+SH GYVK  P++ Y+AQRRGGKG+S   ++DEDFV  L I STH ++L 
Sbjct: 541 LITEEDVVVTLSHQGYVKYQPITAYQAQRRGGKGKSATHVKDEDFVERLVIASTHDTLLC 600

Query: 592 FSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFA 651
           FS+ G +Y  K ++LP  S  +RG+ +INIL L +GE I  ++P  E +   +  YV  A
Sbjct: 601 FSNHGKLYWLKAYQLPQASRASRGRPIINILPLAEGEEINAMLPVREYK---DGSYVFMA 657

Query: 652 TKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPIS 711
           TK G V++  L+ F +   +G IA+ L+  D ++ V+      DI+L T  G+ +RF  S
Sbjct: 658 TKKGTVKKVPLNAFSRPRSNGIIAVDLEEDDSLVGVDITDGARDIMLFTDAGKVIRFDES 717

Query: 712 AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEE 771
            +R   GR + GVRGI + K   V S+ +V                              
Sbjct: 718 KVRPM-GRTARGVRGIRVEKDQAVKSLVVVDP---------------------------- 748

Query: 772 ITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATD 831
                                       ILT +E G+GKRT   ++R+S R G+G+ +  
Sbjct: 749 ------------------------SGGTILTATENGYGKRTHIDEYRVSGRGGQGVISIQ 784

Query: 832 VSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERV 891
           V++ N  G +V    V DND+ +L++DKGTL+R  VNE+ +  R T+GV + + +  E V
Sbjct: 785 VTERN--GKVVRSLQVTDNDEAMLITDKGTLVRFKVNELSVIGRNTQGVRLINVSSGEAV 842

Query: 892 VSVERIRE-SEIVDEAEST 909
           V +++I +  E ++EAE +
Sbjct: 843 VGMQKIVDLGEELEEAEDS 861


>gi|293604169|ref|ZP_06686577.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Achromobacter
           piechaudii ATCC 43553]
 gi|292817394|gb|EFF76467.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Achromobacter
           piechaudii ATCC 43553]
          Length = 891

 Score =  934 bits (2415), Expect = 0.0,   Method: Composition-based stats.
 Identities = 386/921 (41%), Positives = 550/921 (59%), Gaps = 78/921 (8%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           +   K    VS+ +EM+ SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M ++  +WN+
Sbjct: 2   DSFAKETLPVSLEEEMRRSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMHELNNDWNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG+ ++YD + RMAQD+S+R +L++GQGNFGS+DGD  AA R
Sbjct: 62  AYKKSARIVGDVIGKYHPHGDQSVYDTIVRMAQDFSMRYMLVDGQGNFGSIDGDNAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE RL K AH LL D+ ++TVDF PNYDGS QEP++L +R PN+LVNG  GIAVGMATN
Sbjct: 122 YTEIRLAKIAHELLADIDQETVDFGPNYDGSEQEPLLLPSRLPNLLVNGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL EVVDGC+  + NP   +D L+EII  PDFPTG +I G +G++  Y TGRG ++
Sbjct: 182 IPPHNLQEVVDGCLYCLRNPACTVDELIEIIPAPDFPTGGIIYGMSGVREGYRTGRGRVI 241

Query: 250 IRGVSHIEKTSGDR-EQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R  +H E       + IV+  IPYQVNK  + E+IAELV +K+I  I+D+RDESD+ G 
Sbjct: 242 MRAKTHFEDMEKGNRQAIVIDAIPYQVNKKTLQERIAELVNDKKIEGISDIRDESDKDGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           R+VIELKRG   +V+LN LY+ T LQ  F +N+VAL   +P    L  ++  F+  R EV
Sbjct: 302 RLVIELKRGEVPEVVLNNLYKNTQLQDTFGMNLVALVDGQPRLLNLKQMIDYFLQHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KAR+R HVL GLA+A+AN+D+ + II+ +P P  AR+ELM +SW++S ++
Sbjct: 362 VTRRTVFQLRKARERGHVLEGLAVALANIDDFIAIIKAAPTPPVARQELMAKSWDSSLVR 421

Query: 429 DLIDLIDDS---------------SYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDI 473
           D++   D                  + +  DG   LS+ Q + IL +RL RLTGL +D I
Sbjct: 422 DMLSRADGDTPGGRAAFRPDDLGTEFGLQGDGMYRLSDTQAQEILNMRLQRLTGLEQDKI 481

Query: 474 RNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDEL----DTPRRTRIVEGLLDMED 529
             E   +   I + LDIL+   R+  II  EL ++K E        RR+ I     +++ 
Sbjct: 482 VGEYKDIMSTIADLLDILARPERITTIISDELQAIKAEFSTNTKDSRRSEIELNATELDT 541

Query: 530 EDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSV 589
           ED I   DMVVT+SH GY+K  PLS YR+Q+RGG+G+    M++ D++  LFI +TH  +
Sbjct: 542 EDLITPTDMVVTLSHGGYIKSQPLSEYRSQKRGGRGKQATAMKENDWIDQLFIANTHDYL 601

Query: 590 LFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVV 649
           L FS+ G VY  KVW +P G+  +RGK ++N+  L  GE+IT ++P  E      + YV 
Sbjct: 602 LCFSNRGRVYWLKVWEVPQGTRNSRGKPIVNMFPLADGEKITVVLPVKEFS---EDHYVF 658

Query: 650 FATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFP 709
            AT  G V++  LSDF    ++G IA+ LD  D ++  +    ++D++L +  G+ VRF 
Sbjct: 659 MATSRGTVKKTPLSDFSNPRKAGIIAVDLDDGDYLIGADLTDGKHDVMLFSDSGKAVRFD 718

Query: 710 ISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT 769
            + +R   GRN+ GVRG+ L +   VI++ +                             
Sbjct: 719 ENDVRPM-GRNARGVRGMMLEETQTVIALLV----------------------------- 748

Query: 770 EEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRA 829
                                     + Q +LT +E G+GKRT   ++    R  KG+ A
Sbjct: 749 -----------------------AGDETQTVLTATENGYGKRTPIGEYTRHGRGTKGMIA 785

Query: 830 TDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDE 889
              +  N  G +V    VN  D+I+L++  G L+R  V EIR   RAT+GV + +     
Sbjct: 786 IQTTSRN--GKVVGAVLVNPTDEIMLITTGGVLVRTRVAEIREMGRATQGVTLINVDDGS 843

Query: 890 RVVSVERIRESEIVDEAESTE 910
            +  V R+ ES+  D+ E  E
Sbjct: 844 TLSGVRRVVESDADDDGELDE 864



 Score = 73.7 bits (179), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 69/408 (16%), Positives = 136/408 (33%), Gaps = 27/408 (6%)

Query: 390 LAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDLIDDSSYTIGSDGTMYL 449
           L   +A  + +  II        A      +    S+I+     +D       +D  + L
Sbjct: 495 LLDILARPERITTIISDELQAIKAEFSTNTKDSRRSEIELNATELDTEDLITPTDMVVTL 554

Query: 450 S-----EVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQE 504
           S     + Q  +    +     G     ++       + I    D L   S    +   +
Sbjct: 555 SHGGYIKSQPLSEYRSQKRGGRGKQATAMKENDWIDQLFIANTHDYLLCFSNRGRVYWLK 614

Query: 505 LLSVKDELDTPRRTRIVEGLLDMEDEDC--------IVREDMVVTVSHLGYVKRVPLSVY 556
           +  V       R   IV      + E             +  V   +  G VK+ PLS +
Sbjct: 615 VWEVPQGTRNSRGKPIVNMFPLADGEKITVVLPVKEFSEDHYVFMATSRGTVKKTPLSDF 674

Query: 557 RAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIGSPQARGK 616
              R+ G     +   D D++    +      V+ FS  G   +     +      ARG 
Sbjct: 675 SNPRKAGIIAVDLD--DGDYLIGADLTDGKHDVMLFSDSGKAVRFDENDVRPMGRNARG- 731

Query: 617 ALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQINRSGKIAM 676
             +  + L + + +  ++   +         V+ AT++G  +R  + ++ +  R  K  +
Sbjct: 732 --VRGMMLEETQTVIALLVAGD-----ETQTVLTATENGYGKRTPIGEYTRHGRGTKGMI 784

Query: 677 KLD---SRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISLAKGD 733
            +       +++        ++I+L T  G  VR  ++ IR   GR + GV  I++  G 
Sbjct: 785 AIQTTSRNGKVVGAVLVNPTDEIMLITTGGVLVRTRVAEIREM-GRATQGVTLINVDDGS 843

Query: 734 QVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSV 781
            +  +  V+ +DAD D  +         +     DT         +  
Sbjct: 844 TLSGVRRVVESDADDDGELDEDVQAEDGQAQGGDDTNGAADSTEPTEQ 891


>gi|187927867|ref|YP_001898354.1| DNA gyrase subunit A [Ralstonia pickettii 12J]
 gi|187724757|gb|ACD25922.1| DNA gyrase, A subunit [Ralstonia pickettii 12J]
          Length = 889

 Score =  934 bits (2415), Expect = 0.0,   Method: Composition-based stats.
 Identities = 387/917 (42%), Positives = 566/917 (61%), Gaps = 66/917 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++  K    VS+ +EM++SYL YA++VI+GRA+PD+RDGLKPVHRR L+ M ++  +WN+
Sbjct: 2   DQFAKETLPVSLEEEMRSSYLAYAMSVIVGRALPDVRDGLKPVHRRALYSMHELNNDWNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG+ A+YD + RMAQ++SLR +L++GQGNFGSVDGD  AA R
Sbjct: 62  PYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQNFSLRYMLVDGQGNFGSVDGDNAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE RL K AH LL DL K+TV+F PNYDGS  EP VL AR PN+L+NG  GIAVGMATN
Sbjct: 122 YTEIRLSKIAHELLADLDKETVNFEPNYDGSETEPSVLPARIPNLLINGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL EVVDGC+ ++ NP+  +D L+E+I  PDFPT  +I G +G++  Y TGRG +V
Sbjct: 182 IPPHNLNEVVDGCLHLLRNPEATVDELIELIPAPDFPTAGIIYGISGVREGYRTGRGRVV 241

Query: 250 IRGVSHIEKTSGDR-EQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R  +H E     + + I+V E+PYQVNK  +LE+IAELV EKRI  I+D+RDESD+ G 
Sbjct: 242 MRAKTHFEDIDRGQRQAIIVDELPYQVNKRTLLERIAELVTEKRIEGISDIRDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVIELKRG   +V+LN LY+ T LQ  F +NMVAL   +P    L  +L+ F+  R EV
Sbjct: 302 RVVIELKRGEVPEVVLNNLYKNTQLQDTFGMNMVALVDGQPRLLNLRQMLECFLLHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KAR+R H+L GLA+A+AN+DE + II+ +P P  A+ ELM RSW++  ++
Sbjct: 362 VTRRTVFDLRKARERGHILEGLAVALANIDEFIAIIKAAPTPPVAKAELMNRSWDSGLVR 421

Query: 429 DLIDLIDD---------------SSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDI 473
           D++   +                  + +  DG   LS+ Q + IL++RL RLTGL +D I
Sbjct: 422 DMLVRAESETSGGGAAYRPEGLLPVFGMQGDGLYRLSDTQAQEILQMRLQRLTGLEQDKI 481

Query: 474 RNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCI 533
             E   +  +I + LDIL+   R+  II +EL +++ E    RR++I     +++ ED I
Sbjct: 482 VQEYREVMAQIADLLDILARPERITAIIVEELTAIRAEFGDERRSQIEHNATELDTEDLI 541

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
             +D+VVT+SH GY+K  P+S YRAQ+RGG+G+     +++D++  LF+ +TH  +L FS
Sbjct: 542 TPQDLVVTLSHSGYMKSQPISEYRAQKRGGRGKQAAATKEDDWIDTLFVANTHDYILCFS 601

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           + G +Y  KVW +P GS  +RG+ ++N+  L+ GE+I  I+P  + +      +V  AT 
Sbjct: 602 NRGRLYWLKVWEVPQGSRNSRGRPIVNMFPLSPGEKINVILPVKQFD---EQHFVFMATS 658

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAI 713
            G V++  L++F    ++G IA+ LD  D ++  +    ++D++L +  G+ VRF  + +
Sbjct: 659 KGTVKKTALTEFSNPRKAGIIAVDLDEGDFLIGADITDGQHDVMLFSDAGKAVRFDENDV 718

Query: 714 RVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEIT 773
           R   GR + GVRG++L +  QVI+M +                                 
Sbjct: 719 RPM-GRQARGVRGMNLEETQQVIAMLVAP------------------------------- 746

Query: 774 SLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVS 833
                       +E   +  +     +LT +E G+GKRT   ++    R  KG+ A   S
Sbjct: 747 ------------AETEGEGAQSVAGSVLTATENGYGKRTPISEYTRHGRGTKGMIAIQTS 794

Query: 834 KINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVS 893
           + N  G +VA   V   D+I+L++  G LIR  V+EIR   RAT+GV + S  +  ++  
Sbjct: 795 ERN--GKVVAAALVAPEDEIMLITTGGVLIRTRVDEIREMGRATQGVTLISVGEGNKLSG 852

Query: 894 VERIRESEIVDEAESTE 910
           ++R+ ES+  + AES E
Sbjct: 853 LQRVMESDA-EGAESIE 868



 Score = 75.6 bits (184), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 52/249 (20%), Positives = 104/249 (41%), Gaps = 13/249 (5%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  V   +  G VK+  L+ +   R+ G     +   + DF+    I      V+ F
Sbjct: 647 FDEQHFVFMATSKGTVKKTALTEFSNPRKAGIIAVDLD--EGDFLIGADITDGQHDVMLF 704

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYV---- 648
           S  G   +     +     QARG   +N   L + +++  ++  P +        V    
Sbjct: 705 SDAGKAVRFDENDVRPMGRQARGVRGMN---LEETQQVIAMLVAPAETEGEGAQSVAGSV 761

Query: 649 VFATKHGNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQC 705
           + AT++G  +R  +S++ +  R   G IA++      ++++      E++I+L T  G  
Sbjct: 762 LTATENGYGKRTPISEYTRHGRGTKGMIAIQTSERNGKVVAAALVAPEDEIMLITTGGVL 821

Query: 706 VRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLI 765
           +R  +  IR   GR + GV  IS+ +G+++  +  V+ +DA+  E I       A     
Sbjct: 822 IRTRVDEIREM-GRATQGVTLISVGEGNKLSGLQRVMESDAEGAESIEGADAADAAPDAD 880

Query: 766 SGDTEEITS 774
           +   +   +
Sbjct: 881 AQADDSSET 889


>gi|282600302|ref|ZP_05973771.2| DNA gyrase, A subunit [Providencia rustigianii DSM 4541]
 gi|282565780|gb|EFB71315.1| DNA gyrase, A subunit [Providencia rustigianii DSM 4541]
          Length = 874

 Score =  934 bits (2415), Expect = 0.0,   Method: Composition-based stats.
 Identities = 411/909 (45%), Positives = 577/909 (63%), Gaps = 68/909 (7%)

Query: 11  EEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKK 70
           E  + IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M  +G +WNK 
Sbjct: 9   EIAREITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMNVLGNDWNKP 68

Query: 71  YVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERY 130
           Y K ARI G+V+GKYHPHG++A+Y+ + R+AQ +S+R +L++GQGNFGSVDGD  AA RY
Sbjct: 69  YKKSARIVGDVIGKYHPHGDSAVYETIVRLAQPFSMRYMLVDGQGNFGSVDGDSAAAMRY 128

Query: 131 TECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNI 190
           TE R+ K AH +L DL K+TVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNI
Sbjct: 129 TEIRMAKIAHEMLADLEKETVDFVPNYDGTEQIPAVMPTRIPNLLVNGSSGIAVGMATNI 188

Query: 191 PTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVI 250
           P HNLGEV++GC+A I++ DI ++ LME I GPDFPT A+I GR GI +AY TGRG + I
Sbjct: 189 PPHNLGEVINGCLAYIEDEDISIEGLMEHIPGPDFPTAAIINGRRGIIDAYRTGRGKVYI 248

Query: 251 RGVSHIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYR 309
           R  + +E      RE I+V+EIPYQVNKA ++EKIAELV+EKR+  I+ LRDESD+ G R
Sbjct: 249 RARAEVEVDEKNGRETIIVSEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMR 308

Query: 310 VVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVV 369
           +VIE+KR A  +V+LN LY  T LQ  F +NMVAL+  +P+   L  I+ AFV  R EVV
Sbjct: 309 IVIEIKRDAVGEVVLNNLYSLTQLQVSFGINMVALHQGQPKILNLKDIIAAFVRHRREVV 368

Query: 370 VRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKD 429
            RRT + L KARDRAH+L  LA+A+AN+D ++ +IR +P P  A+  L+ RSW    +  
Sbjct: 369 TRRTIFELRKARDRAHILEALAVALANIDPIIELIRKAPTPAEAKAGLISRSWALGTVAA 428

Query: 430 LIDLIDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLG 481
           +++   D +             +G  +L+E Q +AIL+LRL +LTGL  + +  E   L 
Sbjct: 429 MLERAGDDAARPEWLEPQYGVHNGEYFLTEQQAQAILDLRLQKLTGLEHEKLLEEYRDLL 488

Query: 482 IEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVT 541
            +I+E L IL S  RL+ +I++EL ++++  +  RRT I E   D+  ED I +ED+VVT
Sbjct: 489 KQIEELLFILRSPDRLMEVIREELEAIRNVYNDARRTEITENTADINIEDLINQEDVVVT 548

Query: 542 VSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKE 601
           +SH GYVK  PLS Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  
Sbjct: 549 LSHQGYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIERLLVANTHDTILCFSSRGRLYWM 608

Query: 602 KVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNK 661
           KV++LP  S  ARG+ ++N+L L Q ERIT I+P  E E      YV  AT  G V++  
Sbjct: 609 KVYQLPEASRGARGRPIVNLLPLEQDERITAILPVREYE---EGYYVFMATASGTVKKTP 665

Query: 662 LSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNS 721
           L DF +   +G IA+ L+  DE++ V+     N+++L +  G+ VRF   A+R   GR +
Sbjct: 666 LQDFSRPRSAGIIAVNLNEGDELIGVDLTNGSNEVMLFSAQGKVVRFAEDAVRAM-GRTA 724

Query: 722 VGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSV 781
            GVRGI L   D+V+S+ I                                         
Sbjct: 725 TGVRGIKLMDDDKVVSLII----------------------------------------- 743

Query: 782 EGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGAL 841
                          E  ILTV+E G+GKRT   ++   +R+ +G+ +  VS+ N  G +
Sbjct: 744 ------------PRGEGHILTVTENGYGKRTEEAEYPTKSRATQGVISIKVSERN--GHV 789

Query: 842 VAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESE 901
           V    V D DQI++++D GTL+R  V+E+ +  R T+GV +  TA+DE+VV ++R+ E+E
Sbjct: 790 VGAIQVEDTDQIMMITDAGTLVRTRVSEVSVVGRNTQGVTLIRTAEDEKVVGLQRVAETE 849

Query: 902 IVDEAESTE 910
             D   + +
Sbjct: 850 DDDNDSNDQ 858



 Score = 76.8 bits (187), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 67/420 (15%), Positives = 141/420 (33%), Gaps = 35/420 (8%)

Query: 365 REEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNA 424
             E ++   + LL +  +   +L      +  + E +  IR   N   ARR  +  +   
Sbjct: 476 EHEKLLEEYRDLLKQIEELLFILRSPDRLMEVIREELEAIRNVYN--DARRTEITENTAD 533

Query: 425 SDIKDLIDLIDDSSYTIGSDGTMY--LSEVQTRAILELRLARLTGLGRDDIRNELNSLGI 482
            +I+DLI+  D            Y  LS+ + +       +       D I   L +   
Sbjct: 534 INIEDLINQEDVVVTLSHQGYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIERLLVANTH 593

Query: 483 E---------IKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCI 533
           +             + +        G   + ++++       R T I+            
Sbjct: 594 DTILCFSSRGRLYWMKVYQLPEASRGARGRPIVNLLPLEQDERITAILPVRE-------Y 646

Query: 534 VREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFS 593
                V   +  G VK+ PL  +   R  G     +   DE    DL   +    V+ FS
Sbjct: 647 EEGYYVFMATASGTVKKTPLQDFSRPRSAGIIAVNLNEGDELIGVDL--TNGSNEVMLFS 704

Query: 594 SLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATK 653
           + G V +     +      A G   I ++  ++                    +++  T+
Sbjct: 705 AQGKVVRFAEDAVRAMGRTATGVRGIKLMDDDK---------VVSLIIPRGEGHILTVTE 755

Query: 654 HGNVRRNKLSDFIQINRSGKIAMKLD---SRDEILSVETCTQENDILLTTKLGQCVRFPI 710
           +G  +R + +++   +R+ +  + +        ++        + I++ T  G  VR  +
Sbjct: 756 NGYGKRTEEAEYPTKSRATQGVISIKVSERNGHVVGAIQVEDTDQIMMITDAGTLVRTRV 815

Query: 711 SAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTE 770
           S +    GRN+ GV  I  A+ ++V+ +  V   + D ++               + + E
Sbjct: 816 SEV-SVVGRNTQGVTLIRTAEDEKVVGLQRVAETEDDDNDSNDQEDADDVNVDNETNNEE 874


>gi|253996361|ref|YP_003048425.1| DNA gyrase subunit A [Methylotenera mobilis JLW8]
 gi|253983040|gb|ACT47898.1| DNA gyrase, A subunit [Methylotenera mobilis JLW8]
          Length = 862

 Score =  934 bits (2415), Expect = 0.0,   Method: Composition-based stats.
 Identities = 389/909 (42%), Positives = 565/909 (62%), Gaps = 67/909 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++  K    +S+ DEM+ SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M ++  ++NK
Sbjct: 2   DQFAKETLPISLEDEMRRSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMHELSNDYNK 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG+ A+YD + RMAQD+SLR +L++GQGNFGSVDGD  AA R
Sbjct: 62  PYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQDFSLRYMLVDGQGNFGSVDGDNAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE R+ K AH LL D+ K+TVDF PNYDGS  EP+++ AR PN+L+NG  GIAVGMATN
Sbjct: 122 YTEIRMAKIAHELLADIDKETVDFGPNYDGSEHEPLIMPARIPNLLINGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL EV+D C +++ NP+  ++ L+E++  PDFPT  +I G  G+K  Y TGRG +V
Sbjct: 182 IPPHNLNEVLDACFSLLKNPETTVEELIELVPAPDFPTAGIIYGTVGVKEGYRTGRGRVV 241

Query: 250 IRGVSHIEKT-SGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +RG +H E    G R+ I++ E+PYQVNK  ++EKIAELV EK+I  I+DLRDESD+ G 
Sbjct: 242 MRGRTHFEDMDKGGRQSIIIDELPYQVNKKTLIEKIAELVNEKKIEGISDLRDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           RVVIELKRG   DV+LN LY+ T LQ  F +NMVAL   +P    L  +L+AF+  R EV
Sbjct: 302 RVVIELKRGEIPDVVLNNLYKQTQLQDTFGMNMVALLDGQPRLLNLKQMLEAFLRHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KAR+R HVL GLA+A+AN+DE++ II+ +P P  A+++LM +SW +  ++
Sbjct: 362 VTRRTVFELRKARERGHVLEGLAVALANVDEMIAIIKAAPTPPEAKKDLMAKSWQSPVVE 421

Query: 429 DLIDLIDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480
           +++      +            +     LS+VQ + IL++RL RLTGL +D I NE   +
Sbjct: 422 EMLKRAAMEAARPEGLAVNFGLTPNGYKLSDVQAQEILQMRLQRLTGLEQDKIVNEYKEV 481

Query: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVV 540
              I + LDIL++ +R+  II  EL  ++ +    RR+ IVE   D+  ED I  +D+VV
Sbjct: 482 MDVIADLLDILATAARVTAIITDELTEIRRQFGDKRRSEIVENAQDLSLEDLIAPQDVVV 541

Query: 541 TVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYK 600
           T+SH GY+K  PL  YRAQ+RGG+G+     +++DF+  +F+ +TH  +L FS+ G VY 
Sbjct: 542 TLSHTGYIKSQPLDEYRAQKRGGRGKQAAATKEDDFIDKMFVANTHDYILCFSNRGRVYW 601

Query: 601 EKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRN 660
            KV+ +P GS  +RGK ++N+  L + E+I  I+     +    N ++  AT  G V++ 
Sbjct: 602 LKVYEVPQGSRTSRGKPIVNLFPLEENEKINAILSVKSFD---ENHFIFMATSLGTVKKT 658

Query: 661 KLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRN 720
            L++F    RSG IA+ LD  D ++  E     ND++L +  G+ V F    +R   GR 
Sbjct: 659 ALTEFANPRRSGIIAINLDEGDYLIGAEITNGSNDVVLVSNGGKAVWFDEDEVRQM-GRA 717

Query: 721 SVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSS 780
           + GVRG+ LA+  QV+S+ I  +                                     
Sbjct: 718 TRGVRGMKLAEDQQVLSLLIASN------------------------------------- 740

Query: 781 VEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGA 840
                           +Q ++  +E G+GKRT   DFR S R  +G++A  VS+ N  G 
Sbjct: 741 ---------------DQQTVMVATENGYGKRTVLADFRRSGRGTQGVKAIAVSERN--GL 783

Query: 841 LVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRES 900
           +VA   V+D D+I+L++  G LIR  V+EIR   RAT+GV + +  + E++  +E+I E+
Sbjct: 784 VVAAKLVSDEDEIMLITTGGVLIRTRVSEIRELGRATQGVTLINLGEGEKLSGIEKIVET 843

Query: 901 EIVDEAEST 909
           +  ++ E+ 
Sbjct: 844 DDEEDGETE 852



 Score = 68.3 bits (165), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 101/234 (43%), Gaps = 14/234 (5%)

Query: 531 DCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVL 590
                   +   + LG VK+  L+ +   RR G     + + + D++    I +    V+
Sbjct: 638 KSFDENHFIFMATSLGTVKKTALTEFANPRRSG--IIAINLDEGDYLIGAEITNGSNDVV 695

Query: 591 FFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVF 650
             S+ G         +       RG   +  + L + +++ +++    D+ +     V+ 
Sbjct: 696 LVSNGGKAVWFDEDEVRQMGRATRG---VRGMKLAEDQQVLSLLIASNDQQT-----VMV 747

Query: 651 ATKHGNVRRNKLSDFIQ--INRSGKIAMKLDSRDEILSV-ETCTQENDILLTTKLGQCVR 707
           AT++G  +R  L+DF +      G  A+ +  R+ ++   +  + E++I+L T  G  +R
Sbjct: 748 ATENGYGKRTVLADFRRSGRGTQGVKAIAVSERNGLVVAAKLVSDEDEIMLITTGGVLIR 807

Query: 708 FPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQ 761
             +S IR   GR + GV  I+L +G+++  +  ++  D + D        +  +
Sbjct: 808 TRVSEIREL-GRATQGVTLINLGEGEKLSGIEKIVETDDEEDGETEADNEVGGE 860


>gi|251790599|ref|YP_003005320.1| DNA gyrase subunit A [Dickeya zeae Ech1591]
 gi|247539220|gb|ACT07841.1| DNA gyrase, A subunit [Dickeya zeae Ech1591]
          Length = 877

 Score =  934 bits (2415), Expect = 0.0,   Method: Composition-based stats.
 Identities = 407/903 (45%), Positives = 575/903 (63%), Gaps = 68/903 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR +L++GQGNFGS+DGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEVR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL K+TVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLSDLDKETVDFVPNYDGTEQIPDVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EV++GC+A ID+ +I ++ LME I GPDFPT A+I G+ GI+ AY TGRG + IR  +
Sbjct: 187 LSEVINGCLAYIDDENISVEGLMEHIPGPDFPTAAIINGKRGIEEAYRTGRGKVYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV+EKRI  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKSGRETIIVHEIPYQVNKARLIEKIAELVKEKRIEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T +Q  F +NMVAL+  +P+  TL  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNHLYSQTQMQVSFGINMVALHQGQPKLMTLKEILAAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KAR+RAH+L GLAIA+ N+D ++ +IR +  P  A+  L+ ++W    +  +++ 
Sbjct: 367 IFELRKARERAHILEGLAIALVNIDPIIELIRHASTPAEAKIALVAQAWELGSVAAMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  +L++ Q +AIL+LRL +LTGL  + + +E   L  +I 
Sbjct: 427 AGDDAARPEWLEPEFGIHDGKYHLTDQQAQAILDLRLQKLTGLEHEKLLDEYKELLTQIA 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E L IL S  RL+ +I++EL+++++  +  RRT I     D+  ED I  E++VVT+SH 
Sbjct: 487 ELLFILRSPERLMEVIREELVAIRELYNDARRTEITHNSADINIEDLISEENVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PL+ Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWLKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ +IN+L L Q ERIT I+P  E E   N   V  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIINLLPLEQDERITAILPVREYEEGMN---VFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     N+++L +  G+ VRF  SA+R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNDGDELIGVDLTDGSNEVMLFSAEGKVVRFSESAVRTM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+V+S+ +                                             
Sbjct: 723 GINLQDDDRVVSLIVPRGEGD--------------------------------------- 743

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                         ILTV++ GFGKRT+  ++ + +R+ KG+ +  VS+ N  G +V   
Sbjct: 744 --------------ILTVTQNGFGKRTAVTEYPVKSRATKGVISIKVSERN--GNVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V+  DQI++++D GTL+R  V+E+ I  R T+GV +  TA+DERVV ++R+ E    DE
Sbjct: 788 QVDSADQIMMITDAGTLVRTRVSEVSIVGRNTQGVTLIRTAEDERVVGLQRVAEPVEDDE 847

Query: 906 AES 908
            +S
Sbjct: 848 LDS 850



 Score = 69.4 bits (168), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 43/245 (17%), Positives = 86/245 (35%), Gaps = 15/245 (6%)

Query: 538 MVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGF 597
            V   +  G VK+  L+ +   R  G     +   DE    DL        V+ FS+ G 
Sbjct: 645 NVFMATASGTVKKTALTEFSRPRSAGIIAVNLNDGDELIGVDL--TDGSNEVMLFSAEGK 702

Query: 598 VYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNV 657
           V +     +      A G   IN+   ++                     ++  T++G  
Sbjct: 703 VVRFSESAVRTMGRTATGVRGINLQDDDR---------VVSLIVPRGEGDILTVTQNGFG 753

Query: 658 RRNKLSDFIQINRSGKIAMKLDSRDEI---LSVETCTQENDILLTTKLGQCVRFPISAIR 714
           +R  ++++   +R+ K  + +   +     +        + I++ T  G  VR  +S + 
Sbjct: 754 KRTAVTEYPVKSRATKGVISIKVSERNGNVVGAVQVDSADQIMMITDAGTLVRTRVSEV- 812

Query: 715 VFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITS 774
              GRN+ GV  I  A+ ++V+ +  V     D +               I     +  +
Sbjct: 813 SIVGRNTQGVTLIRTAEDERVVGLQRVAEPVEDDELDSVVPVDGELPEEDIDEPESDDDT 872

Query: 775 LKNDS 779
            ++D 
Sbjct: 873 PEDDE 877


>gi|221068230|ref|ZP_03544335.1| DNA gyrase, A subunit [Comamonas testosteroni KF-1]
 gi|220713253|gb|EED68621.1| DNA gyrase, A subunit [Comamonas testosteroni KF-1]
          Length = 898

 Score =  934 bits (2415), Expect = 0.0,   Method: Composition-based stats.
 Identities = 388/924 (41%), Positives = 558/924 (60%), Gaps = 69/924 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
            +  K    +S+ +EM+ SYL YA++VI+GRA+PD RDGLKPVHRR+L+ M ++  +WN+
Sbjct: 2   TQFAKETLPISLEEEMRRSYLDYAMSVIVGRALPDARDGLKPVHRRVLYAMHELNNDWNR 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG++A+YD + RMAQD+SLR +L++GQGNFGSVDGD  AA R
Sbjct: 62  PYKKSARIVGDVIGKYHPHGDSAVYDTIVRMAQDFSLRHMLVDGQGNFGSVDGDSAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE RL K AH +L D+ K+TVDF PNYDGS  EP+VL +R PN+LVNG  GIAVGMATN
Sbjct: 122 YTEIRLSKIAHEMLGDIDKETVDFGPNYDGSESEPLVLPSRLPNLLVNGSSGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNL EVVDGC+ ++ NPD  +D LMEII  PDFPT  +I G  G+K  Y TGRG +V
Sbjct: 182 IPPHNLNEVVDGCLHLLQNPDASIDELMEIIPAPDFPTAGIIYGINGVKEGYRTGRGRVV 241

Query: 250 IRGVSHIEKTSGDREQ-IVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGY 308
           +R   H E     + Q I+V E+PYQVNK  + E++AELV EK+I  I+ ++DESD+ G 
Sbjct: 242 MRAKCHFEDIDKGQRQSIIVDELPYQVNKKTLQERMAELVHEKKIEGISHIQDESDKSGM 301

Query: 309 RVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEV 368
           R+VIELKRG   +V+LN LY+ T LQ  F +NMVAL   +P+   L  +++ F+  R EV
Sbjct: 302 RLVIELKRGEVPEVVLNNLYKLTQLQDTFGMNMVALVNGQPKLCNLKDLIQVFLEHRREV 361

Query: 369 VVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIK 428
           V RRT + L KARDR HVL GLA+A+AN+D+ + IIR +P P  A+  LM++SW++  ++
Sbjct: 362 VTRRTVFELRKARDRGHVLEGLAVALANIDDFIAIIRNAPTPPVAKAALMEKSWDSKLVR 421

Query: 429 DLIDLIDDS----------------SYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDD 472
           +++                       + +  +G   LSE Q + IL++RL RLTGL +D 
Sbjct: 422 EMLTRTRTDGGVVNADDYRPEGLEVEFGMQGNGLYRLSETQAQEILQMRLQRLTGLEQDK 481

Query: 473 IRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTP----RRTRIVEGLLDME 528
           I  E   +   I++ LDIL+   R+  II +EL +VK E        RR+ +     D+ 
Sbjct: 482 IVAEYKDIMSVIEDLLDILAKPERVSIIIGEELNAVKAEFGQSKKGERRSTVEYSAQDLS 541

Query: 529 DEDCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTS 588
            ED I   DMVVT+SH GY+K  PLS YR+Q+RGG+G+     +++D++  LFI +TH  
Sbjct: 542 TEDLITPTDMVVTLSHTGYIKSQPLSEYRSQKRGGRGKLATATKEDDWIDQLFIANTHDY 601

Query: 589 VLFFSSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFP-EDESSWNNLY 647
           +L FS+ G +Y  KVW +P GS  +RG+ ++N+  L  GE+I  ++P   E+ S   + Y
Sbjct: 602 LLCFSNRGRMYWLKVWEVPSGSRGSRGRPIVNMFPLQDGEKINVVLPLTGENRSFPEDHY 661

Query: 648 VVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVR 707
           V  AT  G V++  L++F    ++G IA+ LD  D ++       ++D++L +  G+ VR
Sbjct: 662 VFMATSMGTVKKTALTEFSNPRKAGIIAVGLDEGDYLIGAALTDGKHDVMLFSDGGKAVR 721

Query: 708 FPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISG 767
           F  + +R   GRN+ GVRG+++ +   VI+M +    D   +                  
Sbjct: 722 FDENDVRPM-GRNARGVRGMNIEEHQNVIAMLVAEADDGTGNVV---------------- 764

Query: 768 DTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGI 827
                                         Q +LT +E G+GKRT+  ++    R  KG+
Sbjct: 765 ---------------------------AGSQSVLTATENGYGKRTAISEYTRHGRGTKGM 797

Query: 828 RATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAK 887
            A   S+ N  G +VA   V   D+I+L++D G L+R  V EIR   RAT+GV + +   
Sbjct: 798 IAIQQSERN--GKVVAATLVAPEDEIMLITDTGVLVRTRVAEIRELGRATQGVTLINLDA 855

Query: 888 DERVVSVERIRESEIVDEA-ESTE 910
             +++ ++RI E++  D A E  E
Sbjct: 856 GAKLIGLQRIVENDANDGAGEDGE 879



 Score = 77.9 bits (190), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 50/249 (20%), Positives = 102/249 (40%), Gaps = 13/249 (5%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  V   + +G VK+  L+ +   R+ G     V + + D++    +      V+ F
Sbjct: 656 FPEDHYVFMATSMGTVKKTALTEFSNPRKAG--IIAVGLDEGDYLIGAALTDGKHDVMLF 713

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWN----NLYV 648
           S  G   +     +      ARG   +N   + + + +  ++    D+ + N    +  V
Sbjct: 714 SDGGKAVRFDENDVRPMGRNARGVRGMN---IEEHQNVIAMLVAEADDGTGNVVAGSQSV 770

Query: 649 VFATKHGNVRRNKLSDFIQINR--SGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQC 705
           + AT++G  +R  +S++ +  R   G IA++      ++++      E++I+L T  G  
Sbjct: 771 LTATENGYGKRTAISEYTRHGRGTKGMIAIQQSERNGKVVAATLVAPEDEIMLITDTGVL 830

Query: 706 VRFPISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLI 765
           VR  ++ IR   GR + GV  I+L  G ++I +  ++  DA+           S      
Sbjct: 831 VRTRVAEIREL-GRATQGVTLINLDAGAKLIGLQRIVENDANDGAGEDGEAEDSGGAAAE 889

Query: 766 SGDTEEITS 774
                   S
Sbjct: 890 GPAESGDAS 898


>gi|120598757|ref|YP_963331.1| DNA gyrase subunit A [Shewanella sp. W3-18-1]
 gi|146293166|ref|YP_001183590.1| DNA gyrase subunit A [Shewanella putrefaciens CN-32]
 gi|120558850|gb|ABM24777.1| DNA gyrase subunit A [Shewanella sp. W3-18-1]
 gi|145564856|gb|ABP75791.1| DNA gyrase subunit A [Shewanella putrefaciens CN-32]
 gi|319426322|gb|ADV54396.1| DNA gyrase, A subunit [Shewanella putrefaciens 200]
          Length = 917

 Score =  934 bits (2414), Expect = 0.0,   Method: Composition-based stats.
 Identities = 407/914 (44%), Positives = 567/914 (62%), Gaps = 87/914 (9%)

Query: 14  KGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVK 73
             I+ ++I DE++NSYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++  +WNK Y K
Sbjct: 6   SSISPINIEDELKNSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMSELKNDWNKPYKK 65

Query: 74  CARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTEC 133
            AR+ G+V+GKYHPHG++A+YD + RMAQ +SLR  L++GQGNFGSVDGD  AA RYTE 
Sbjct: 66  SARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYTLVDGQGNFGSVDGDSAAAMRYTEI 125

Query: 134 RLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTH 193
           R+ K AH LL DL K+TVDF PNYDG+ Q P VL  R PN+L+NG  GIAVGMATNIP H
Sbjct: 126 RMDKLAHQLLADLEKETVDFVPNYDGTEQIPAVLPTRVPNLLINGSSGIAVGMATNIPPH 185

Query: 194 NLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGV 253
           NL EVV GC+A+I+ P + ++ LME I GPDFPT A+I GR GI +AY TGRG  ++R +
Sbjct: 186 NLTEVVKGCLALIEEPSLSIEQLMEYIPGPDFPTAAIINGRKGIIDAYKTGRGRAIMRAL 245

Query: 254 SHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
           + IE     RE+I+VTEIPYQVNKA ++EKIAELV++K++  I+ LRDESD+ G R+VIE
Sbjct: 246 ADIETEDNGRERIIVTEIPYQVNKARLIEKIAELVKDKKLEGISGLRDESDKDGMRIVIE 305

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KRG   +V+LN LY  T +Q  F +NMVAL   +P+ F L  +L+ F+  R EVV RRT
Sbjct: 306 IKRGEVGEVVLNNLYAQTQMQCSFGINMVALTNGQPKLFNLKEMLECFILHRREVVTRRT 365

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KAR+RAH+L  LA+A+AN+D ++ +I+ SP P  A+ +L+++ W    ++ +++ 
Sbjct: 366 VFELRKARERAHILEALAVALANIDPIIALIKASPTPADAKVKLVEQGWELGHVQGMLEK 425

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  +L+E Q +AILELRL RLTGL  D I  E   L   I 
Sbjct: 426 AGDDAARPEWLEPQYGIRDGQYFLTEQQAQAILELRLHRLTGLEHDKIIAEYEELLEFIA 485

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
             L IL S  RL+ +IK+EL  +  E    RRT I    +DM  ED I  ED+VVT+SHL
Sbjct: 486 GLLFILRSPERLMEVIKEELEEILTEYGDARRTVINANEIDMSLEDLINEEDVVVTLSHL 545

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GY K  PLS Y+AQRRGGKG++   ++DEDFV  L + +TH ++L FS  G +Y  KV++
Sbjct: 546 GYAKYQPLSDYQAQRRGGKGKAATKVKDEDFVEKLLVANTHDTILCFSDFGKMYWLKVYQ 605

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP+ S  ARG+ ++N+L L+ GERIT I+P  E      + Y++ AT +G V++  L+ +
Sbjct: 606 LPLASRTARGRPIVNLLPLSDGERITAILPVREYA---ADKYIIMATSNGTVKKTALTAY 662

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPIS-------------- 711
                +G IA+ L   D+++ V+    +++I+L +  G+ VRF                 
Sbjct: 663 SNPRANGIIAVNLKDGDQLIGVDITNGDDEIMLFSNEGKVVRFGEKVRDSETGEVKTDPE 722

Query: 712 ------AIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLI 765
                 ++R   GR + GVRGI L +G +V+S+ +                         
Sbjct: 723 TGEEVLSLRPM-GRTATGVRGIRLEEGQKVVSLIV------------------------- 756

Query: 766 SGDTEEITSLKNDSSVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGK 825
                                          +  ILTV+E G+GKRT   ++   +R+ K
Sbjct: 757 ----------------------------PKGDGAILTVTENGYGKRTQLSEYPAKSRATK 788

Query: 826 GIRATDVSKINEIGALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFST 885
           G+ +  VS+ N  GA+V    V  ND+I+L+SDKGTL+R P   + I  R T+GV I  T
Sbjct: 789 GVVSIKVSERN--GAVVGAVQVGSNDEIMLISDKGTLVRTPAKGVSIIGRNTQGVTIIRT 846

Query: 886 AKDERVVSVERIRE 899
           A DE+VV ++RI E
Sbjct: 847 ASDEKVVGLQRIDE 860



 Score = 52.9 bits (125), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 74/229 (32%), Gaps = 59/229 (25%)

Query: 731 KGDQVISM-AIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEER 789
           + D++I+    +L   A     +   + +    +    +          + +  N  +  
Sbjct: 469 EHDKIIAEYEELLEFIAGLLFILRSPERLMEVIKEELEEILTEYGDARRTVINANEIDMS 528

Query: 790 CQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALV------- 842
            ++L  +E  ++T+S  G+ K     D++   R GKG  AT V   + +  L+       
Sbjct: 529 LEDLINEEDVVVTLSHLGYAKYQPLSDYQAQRRGGKGKAATKVKDEDFVEKLLVANTHDT 588

Query: 843 -------------------------------------------AVFPVND---NDQIILV 856
                                                      A+ PV +   +  II+ 
Sbjct: 589 ILCFSDFGKMYWLKVYQLPLASRTARGRPIVNLLPLSDGERITAILPVREYAADKYIIMA 648

Query: 857 SDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
           +  GT+ +  +       R   G++  +    ++++ V+    +   DE
Sbjct: 649 TSNGTVKKTALTAYS-NPR-ANGIIAVNLKDGDQLIGVDI---TNGDDE 692


>gi|227328225|ref|ZP_03832249.1| DNA gyrase subunit A [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 879

 Score =  934 bits (2414), Expect = 0.0,   Method: Composition-based stats.
 Identities = 409/903 (45%), Positives = 573/903 (63%), Gaps = 68/903 (7%)

Query: 15  GITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYVKC 74
            IT V+I +E+++SYL YA++VI+GRA+PD+RDGLKPVHRR+L+ M  +G +WNK Y K 
Sbjct: 7   EITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMSVLGNDWNKPYKKS 66

Query: 75  ARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAERYTECR 134
           AR+ G+V+GKYHPHG++A+Y+ + RMAQ +SLR +L++GQGNFGS+DGD  AA RYTE R
Sbjct: 67  ARVVGDVIGKYHPHGDSAVYETIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEIR 126

Query: 135 LQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATNIPTHN 194
           + K AH LL DL K+TVDF PNYDG+ Q P V+  R PN+LVNG  GIAVGMATNIP HN
Sbjct: 127 MSKIAHELLADLEKETVDFVPNYDGTEQIPDVMPTRIPNLLVNGSSGIAVGMATNIPPHN 186

Query: 195 LGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIVIRGVS 254
           L EVV+GC+A ID+ +I L+ LME I+GPDFPT A+I GR GI+ AY TGRG I IR  +
Sbjct: 187 LTEVVNGCLAYIDDENISLEGLMEHIKGPDFPTAAIINGRRGIEEAYRTGRGKIYIRARA 246

Query: 255 HIE-KTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYRVVIE 313
            +E      RE I+V EIPYQVNKA ++EKIAELV++KRI  I+ LRDESD+ G R+VIE
Sbjct: 247 EVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKDKRIEGISALRDESDKDGMRIVIE 306

Query: 314 LKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVVVRRT 373
           +KR A  +V+LN LY  T LQ+ F +NMVAL+  +P+   L  IL AFV  R EVV RRT
Sbjct: 307 IKRDAVGEVVLNNLYSQTQLQTSFGINMVALHQGQPKIMPLKDILVAFVRHRREVVTRRT 366

Query: 374 KYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKDLIDL 433
            + L KARDRAH+L GLAIA+AN+D ++ +IR + +P  A+  L+ ++W    +  +++ 
Sbjct: 367 IFELRKARDRAHILEGLAIALANIDPIIELIRRAASPAEAKASLIAQAWELGSVATMLER 426

Query: 434 IDDSSYTIG--------SDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIK 485
             D +             DG  YL+E Q +AIL+LRL +LTG+  + + +E   L  EI 
Sbjct: 427 AGDDAARPEWLEPEFGIRDGRYYLTEQQAQAILDLRLQKLTGMEHEKLLDEYKELLAEIA 486

Query: 486 ECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHL 545
           E L IL+S  RL+ +I++EL ++K +    RRT I     D+  ED I +ED+VVT+SH 
Sbjct: 487 ELLYILNSPERLMEVIREELEAIKTQYSDERRTEITANTADINIEDLINQEDVVVTLSHQ 546

Query: 546 GYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWR 605
           GYVK  PLS Y AQRRGGKG+S   +++EDF+  L + +TH ++L FSS G +Y  KV++
Sbjct: 547 GYVKYQPLSDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLYWMKVYQ 606

Query: 606 LPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDF 665
           LP  S  ARG+ ++N+L L   ERIT I+P  E E      ++  AT  G V++  L++F
Sbjct: 607 LPEASRGARGRPIVNLLPLEADERITAILPVREYE---EGRHIFMATASGTVKKTALTEF 663

Query: 666 IQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVR 725
            +   +G IA+ L+  DE++ V+     ++ +L +  G+ VRF   A+R   GR + GVR
Sbjct: 664 SRPRSAGIIAVNLNEGDELIGVDLTDGSDEAMLFSAEGKVVRFSEQAVRSM-GRTATGVR 722

Query: 726 GISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNI 785
           GI+L   D+V+S+ I                                             
Sbjct: 723 GINLQGEDRVVSLII--------------------------------------------- 737

Query: 786 SEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVF 845
                      E  ILTV++ GFGKRT+  ++   +R+ KG+ +  VS+ N  G +V   
Sbjct: 738 --------PRGEGDILTVTQNGFGKRTAVSEYPTKSRATKGVISIKVSERN--GKVVGAV 787

Query: 846 PVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRESEIVDE 905
            V+  DQI++++D GTL+R  V+E+ I  R T+GV +  TA+DE VV ++R+ E    +E
Sbjct: 788 QVDAADQIMMITDAGTLVRTRVSEVSIVGRNTQGVTLIRTAEDEHVVGLQRVAEPVEDEE 847

Query: 906 AES 908
            + 
Sbjct: 848 LDG 850


>gi|257094472|ref|YP_003168113.1| DNA gyrase subunit A [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
 gi|257046996|gb|ACV36184.1| DNA gyrase, A subunit [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 872

 Score =  934 bits (2413), Expect = 0.0,   Method: Composition-based stats.
 Identities = 393/906 (43%), Positives = 550/906 (60%), Gaps = 68/906 (7%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           E   K    VS+ DEM+ SYL YA++VI+GRA+PD RDGLKPVHRR+LF M ++  +WNK
Sbjct: 2   EAFAKETLPVSLEDEMRRSYLDYAMSVIVGRALPDARDGLKPVHRRVLFAMHELSNDWNK 61

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+V+GKYHPHG+ A+YD + RMAQ++SLR +L++GQGNFGSVDGD  AA R
Sbjct: 62  PYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQNFSLRYMLVDGQGNFGSVDGDNAAAMR 121

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE R+ +  H LL D+ K+TVDF PNYDGS +EP+V+ AR PN+L+NG  GIAVGMATN
Sbjct: 122 YTEVRMARIGHELLADIDKETVDFGPNYDGSEEEPLVMPARIPNLLINGSAGIAVGMATN 181

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNLGE++D C+A+++N ++ +D L++++ GPDFPT  +I G  G++  Y TGRG +V
Sbjct: 182 IPPHNLGEIIDACLALLNNAEVTIDELIDLVPGPDFPTAGIIYGVAGVREGYRTGRGRVV 241

Query: 250 IRGVSHIEKTSGDR--EQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQG 307
           +RG +H E        + I++ E+PYQVNK  +LEKI ELV EKRI  I+DLRDESD+ G
Sbjct: 242 MRGRTHFEDMDKGNNRQAIIIDELPYQVNKRTLLEKIGELVNEKRIEGISDLRDESDKSG 301

Query: 308 YRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREE 367
            RVVIELKRG  A+V+LN LY+ T LQ  F +NMVAL   +P    L  +L+ F+  R E
Sbjct: 302 MRVVIELKRGEVAEVVLNCLYKQTQLQDTFGMNMVALVDGQPRLLNLKQMLECFLRHRRE 361

Query: 368 VVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDI 427
           V+ RRT + L KAR+RAH+  GLA+A+ N+DE++ +I+ SP P  ARR LM R W +  +
Sbjct: 362 VLTRRTVFELRKARERAHIQEGLAVALDNVDEIIALIKASPTPADARRGLMSRLWTSPTV 421

Query: 428 KDLIDLIDDSSYTIGSDGT--------MYLSEVQTRAILELRLARLTGLGRDDIRNELNS 479
            +++      +      G           LSE Q +AILELRL RLTGL RD I  +   
Sbjct: 422 AEMLQRAALDATRPQGLGLEYGLSASGYLLSEAQAQAILELRLQRLTGLERDKIVADYGE 481

Query: 480 LGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMV 539
           L   I + +DIL+   R+  +I +EL +++ +    RR+ IV    D+  ED I   DMV
Sbjct: 482 LLARIADLMDILARPERITEMIVEELTAIRAQFGDKRRSEIVISTQDLGIEDFITPVDMV 541

Query: 540 VTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVY 599
           VT+SH GY+K  PL+ YRAQRRGG+G+    M+ +DFV  LF+ +TH  +L F++ G VY
Sbjct: 542 VTLSHTGYIKSQPLADYRAQRRGGRGKQAAAMKTDDFVDHLFVANTHDFILCFTNRGRVY 601

Query: 600 KEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRR 659
             KV+ +P G+  +RGK ++N+    +GE+I+ I+P  E     ++ Y+   T  G V++
Sbjct: 602 WLKVYEVPQGTRTSRGKPIVNLFPFEEGEKISAILPVKEFT---DDRYIFMCTAQGTVKK 658

Query: 660 NKLSDFIQINRSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGR 719
             LSDF    ++G IA+ LD  D ++  E      D++L +  G+ V F    +R   GR
Sbjct: 659 TPLSDFSNPRKAGIIAVALDDEDVLIGAEITNGTQDVVLVSDAGKAVWFDEEDVRPM-GR 717

Query: 720 NSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDS 779
            + GVRG+ LA   QV+S+ +  +                                    
Sbjct: 718 TARGVRGMRLADQQQVLSLLVADN------------------------------------ 741

Query: 780 SVEGNISEERCQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIG 839
                            +Q +L  +E GFGKRT   DFR S R  +G+ A   S+ N  G
Sbjct: 742 ----------------DQQTVLVATENGFGKRTVLADFRHSGRGTQGVIAIAGSERN--G 783

Query: 840 ALVAVFPVNDNDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIRE 899
            +VA   V D D+I+L++  G LIR  V EIR   RAT+GV + +    E++  +E+I E
Sbjct: 784 RVVAARLVRDEDEIMLITTGGVLIRTRVREIRELGRATQGVTLIALDAGEKLAGLEKIVE 843

Query: 900 SEIVDE 905
           +E   E
Sbjct: 844 TEDDAE 849



 Score = 72.1 bits (175), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 50/243 (20%), Positives = 96/243 (39%), Gaps = 14/243 (5%)

Query: 533 IVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFF 592
              +  +   +  G VK+ PLS +   R+ G     V + DED +    I +    V+  
Sbjct: 641 FTDDRYIFMCTAQGTVKKTPLSDFSNPRKAG--IIAVALDDEDVLIGAEITNGTQDVVLV 698

Query: 593 SSLGFVYKEKVWRLPIGSPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFAT 652
           S  G         +      ARG   +  + L   +++ +++    D+ +     V+ AT
Sbjct: 699 SDAGKAVWFDEEDVRPMGRTARG---VRGMRLADQQQVLSLLVADNDQQT-----VLVAT 750

Query: 653 KHGNVRRNKLSDFIQ--INRSGKIAMKLDS-RDEILSVETCTQENDILLTTKLGQCVRFP 709
           ++G  +R  L+DF        G IA+        +++      E++I+L T  G  +R  
Sbjct: 751 ENGFGKRTVLADFRHSGRGTQGVIAIAGSERNGRVVAARLVRDEDEIMLITTGGVLIRTR 810

Query: 710 ISAIRVFAGRNSVGVRGISLAKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDT 769
           +  IR   GR + GV  I+L  G+++  +  ++  + D +      +           D 
Sbjct: 811 VREIREL-GRATQGVTLIALDAGEKLAGLEKIVETEDDAEIADLVEQPGEPAAGGQYADP 869

Query: 770 EEI 772
            E 
Sbjct: 870 GEE 872


>gi|157964271|ref|YP_001499095.1| DNA gyrase subunit A [Rickettsia massiliae MTU5]
 gi|157844047|gb|ABV84548.1| DNA gyrase subunit A [Rickettsia massiliae MTU5]
          Length = 906

 Score =  934 bits (2413), Expect = 0.0,   Method: Composition-based stats.
 Identities = 451/889 (50%), Positives = 628/889 (70%), Gaps = 8/889 (0%)

Query: 10  EEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNK 69
           ++    +  V+I DEM+ SYL YA++VI+ RAIPD+RDGLKPVHRRI++ M + G   +K
Sbjct: 4   DKSSSNLVPVNIEDEMKVSYLDYAMSVIVSRAIPDVRDGLKPVHRRIIYSMHEAGNHASK 63

Query: 70  KYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAAER 129
            Y K ARI G+VMGKYHPHG++AIYD+L RMAQD+SLRL L++GQGNFGS+DGD  AA R
Sbjct: 64  PYRKSARIVGDVMGKYHPHGDSAIYDSLVRMAQDFSLRLPLVDGQGNFGSMDGDAAAAMR 123

Query: 130 YTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMATN 189
           YTE R+ K +H L++D+ K+TV F PNYDGS +EP VL A +PN+LVNG GGIAVGMATN
Sbjct: 124 YTESRMAKVSHKLVEDIDKETVSFNPNYDGSEEEPSVLPAMFPNLLVNGSGGIAVGMATN 183

Query: 190 IPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSIV 249
           IP HNLGEV+D C   IDN DI++  L+E+++GPDFPTG++ILG +GI++AY TGRGSI+
Sbjct: 184 IPPHNLGEVIDACCLYIDNNDIEILDLLEVVKGPDFPTGSMILGISGIRSAYLTGRGSII 243

Query: 250 IRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQGYR 309
           +RG + IE    +R+ I++TEIPY VNKA ++EKIAE+V+EKRI  I+DLRDES++ G R
Sbjct: 244 MRGRAEIENIGNNRQAIIITEIPYMVNKARLIEKIAEMVKEKRIEGISDLRDESNKNGVR 303

Query: 310 VVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFREEVV 369
           + IELK+   A+V+LNQ+Y  T LQ+ F V M+AL    P+   L  ++ AFV+FRE V+
Sbjct: 304 IFIELKKDVVAEVVLNQIYACTQLQTSFGVIMLALKDGLPKVMNLKEVIAAFVSFREVVI 363

Query: 370 VRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASDIKD 429
             RT YLLNKARDRAH+L+GL IAV+N+DE++RII+ S +P  A++ELM   W A +I  
Sbjct: 364 TNRTIYLLNKARDRAHILLGLTIAVSNIDEIIRIIKASNDPNAAKQELMACQWEALNILP 423

Query: 430 LIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSLGIEIKECLD 489
           L+ L+DD +  +   G    +EVQ +AILE+RL RLT + ++ +  +L +L  EI E L+
Sbjct: 424 LVKLVDDKAM-LNEQGKCNFTEVQAKAILEMRLQRLTAMEKNKLEEDLKNLATEITEYLN 482

Query: 490 ILSSRSRLLGIIKQELLSVKDELDTPRRTRIVEGLLDMEDEDCIVREDMVVTVSHLGYVK 549
           IL SR+RLL I+K EL+ VK+E  TPR T I  G  D + ED I RE+MVVTV+  GY+K
Sbjct: 483 ILGSRTRLLEILKAELIKVKEEFATPRLTSIEFGEFDQDIEDLIQREEMVVTVTLGGYIK 542

Query: 550 RVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVLFFSSLGFVYKEKVWRLPIG 609
           RVPLS YRAQ+RGGKGRSG+ MRDED  T +F+ STHT +LFFS++G VY  K+++LP+ 
Sbjct: 543 RVPLSSYRAQKRGGKGRSGLSMRDEDITTQVFVGSTHTPMLFFSNIGQVYSLKLYKLPLS 602

Query: 610 SPQARGKALINILSLNQGERITTIMPFPEDESSWNNLYVVFATKHGNVRRNKLSDFIQIN 669
           +PQ +G+ ++NIL L   E IT IMP PE++   +NL ++FAT  GN+RR+ L  F ++ 
Sbjct: 603 NPQGKGRPMVNILPLKANEYITNIMPLPENQDERDNLNIMFATAKGNIRRSDLLAFKKLQ 662

Query: 670 RSGKIAMKLDSRDEILSVETCTQENDILLTTKLGQCVRFPISAIRVFAGRNSVGVRGISL 729
            +GKIA++LD  D+++ V+ C ++  ILL TK G+ +RF + ++RV   R S GVRG+ L
Sbjct: 663 SNGKIAIRLDEDDKLIDVKPCKEDEHILLATKAGKALRFAVESLRVIKSRTSDGVRGMKL 722

Query: 730 AKGDQVISMAIVLHADADYDERICYMKHMSAQRRLISGDTEEITSLKNDSSVEGNISEER 789
           AK D VISM ++    +  ++R  Y+     QR  I+          N   +  +++   
Sbjct: 723 AKEDSVISMTVLKGISSTKEDRDAYLSVPWEQRLEIAKGE-----AFNPEELGVSLTAPA 777

Query: 790 CQELKLKEQFILTVSEKGFGKRTSSYDFRISNRSGKGIRATDVSKINEIGALVAVFPVND 849
             E+   E+FILTV+E GFGKR+S+Y +RI++R G GI   D++  ++ G +V V PV  
Sbjct: 778 ILEMAKSEEFILTVTENGFGKRSSAYGYRITDRGGSGIINMDIN--DKTGLVVGVMPVKM 835

Query: 850 NDQIILVSDKGTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVERIR 898
           +D+++L+++ G LIR  +  +RI  R T GV++F     E+VVSV  I 
Sbjct: 836 DDELMLITNSGKLIRCKLESVRITGRNTSGVILFKLDDGEKVVSVSLIA 884


>gi|224824087|ref|ZP_03697195.1| DNA gyrase, A subunit [Lutiella nitroferrum 2002]
 gi|224603506|gb|EEG09681.1| DNA gyrase, A subunit [Lutiella nitroferrum 2002]
          Length = 861

 Score =  934 bits (2413), Expect = 0.0,   Method: Composition-based stats.
 Identities = 391/902 (43%), Positives = 563/902 (62%), Gaps = 68/902 (7%)

Query: 8   SDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEW 67
           +D+   K    +S+ +EM+ SYL YA++VI+GRA+PD+RDGLKPVHRR+LF M ++  +W
Sbjct: 2   TDQFFAKETIPISLEEEMRRSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHELSNDW 61

Query: 68  NKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDGDPPAA 127
           N+ Y K ARI G+V+GKYHPHG++A+YD + RMAQD+SLR  LI+GQGNFGSVDGD  AA
Sbjct: 62  NRAYKKSARIVGDVIGKYHPHGDSAVYDTIVRMAQDFSLRYPLIDGQGNFGSVDGDNAAA 121

Query: 128 ERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMA 187
            RYTE R+ + AH LL D+ K+TVDF PNYDGS QEP++L A+ PN+L+NG  GIAVGMA
Sbjct: 122 MRYTEIRMARIAHELLADIEKETVDFGPNYDGSEQEPLILPAKIPNLLINGSSGIAVGMA 181

Query: 188 TNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGS 247
           TNIP HNL EV+DGC+AV+ + DI +D L++II  PDFPT  +I G  G+K  Y TGRG 
Sbjct: 182 TNIPPHNLNEVIDGCLAVLASSDITIDELIDIIPAPDFPTAGIIYGTAGVKEGYRTGRGR 241

Query: 248 IVIRGVSHIEKT-SGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRDESDRQ 306
           +++R  +H E    GDR+ I+V E+PYQVNKA +LE+I ELVR+K+I  I+DLRDESD+ 
Sbjct: 242 VIMRARTHFEDIGKGDRQAIIVDELPYQVNKARLLERIGELVRDKQIEGISDLRDESDKS 301

Query: 307 GYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALNGYKPERFTLIGILKAFVAFRE 366
           G RVVIELKRG   +V+LN LY+ T LQ  F +NMVAL   +P    L  IL+ F+  R 
Sbjct: 302 GMRVVIELKRGEMPEVVLNHLYKLTQLQDSFGINMVALVDGQPRLLNLKQILEEFLRHRR 361

Query: 367 EVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQRSWNASD 426
           EVV RRT + L KAR+R H+L GLA+A++N+D