RPSBLAST alignment of GI: 254780182 and protein with PDBid: 3l4j

>3l4j_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, covalently linked comple supercoiling; HET: DNA PTR TSP; 2.48A {Saccharomyces cerevisiae} PDB: 3l4k_A* 1bjt_A 1bgw_A 2rgr_A* Length = 757
 Score =  315 bits (807), Expect = 3e-86
 Identities = 85/538 (15%), Positives = 185/538 (34%), Gaps = 59/538 (10%)

Query: 13  EKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQMGVEWNKKYV 72
           +  +  + I+D +    + +++   + R+IP++ DG KP  R++L+G  +  ++   K  
Sbjct: 244 DPTLKEIPISDFINKELILFSLADNI-RSIPNVLDGFKPGQRKVLYGCFKKNLKSELKVA 302

Query: 73  KCARISGEVMGKYHPHGNAAIYDALARMAQDW--SLRLLLIEGQGNFGS--VDGDPPAAE 128
           + A    E     + HG  ++   +  +AQ++  S  + L+   G FG+    G   AA 
Sbjct: 303 QLAPYVSECTA--YHHGEQSLAQTIIGLAQNFVGSNNIYLLLPNGAFGTRATGGKDAAAA 360

Query: 129 RYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGIAVGMAT 188
           RY    L K    +          +    + +  EP       P +LVNG  GI  G +T
Sbjct: 361 RYIYTELNKLTRKIFHPADDPLYKYIQEDEKT-VEPEWYLPILPMILVNGAEGIGTGWST 419

Query: 189 NIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVILGRTGIKNAYATGRGSI 248
            IP  N  E++     ++++ ++  + +    RG            TG        R  +
Sbjct: 420 YIPPFNPLEIIKNIRHLMNDEEL--EQMHPWFRGW-----------TGTIEEIEPLRYRM 466

Query: 249 VIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELV-REKRIVDIADLRDESDRQG 307
                 +          + +TE+P +   + + E +   +    +I       +E     
Sbjct: 467 ------YGRIEQIGDNVLEITELPARTWTSTIKEYLLLGLSGNDKIKPWIKDMEEQHDDN 520

Query: 308 YRVVIELKRGASADVIL-NQLYRYTSLQSLFSVNMVALN--GYKPERFTLIGILKAFVAF 364
            + +I L     A         R+  +  +  +NMVA +  G   +  ++  IL  F   
Sbjct: 521 IKFIITLSPEEMAKTRKIGFYERFKLISPISLMNMVAFDPHGKIKKYNSVNEILSEFYYV 580

Query: 365 REEVVVRRTKYL-------LNKARDRAHVLVG-----LAIAVANLDEVVRIIRFSPNPET 412
           R E   +R  ++       + K   +   +       L +     + +++ +     P  
Sbjct: 581 RLEYYQKRKDHMSERLQWEVEKYSFQVKFIKMIIEKELTVTNKPRNAIIQELENLGFPRF 640

Query: 413 ARRELMQRSWNASDIKDLIDLIDDSSYTI-----------GSDGTMYLSEVQTRAILELR 461
            +           +I + I+ +  ++                             +L +R
Sbjct: 641 NKEGKPYYGSPNDEIAEQINDVKGATSDEEDEESSHEDTENVINGPEELYGTYEYLLGMR 700

Query: 462 LARLTGLGRDDIRNELNSLGIEIKECLDILSSRSRLLGIIKQELLSVKDELDTPRRTR 519
           +  LT      +  +      E++  L + +       I   +L + +       +  
Sbjct: 701 IWSLTKERYQKLLKQKQEKETELENLLKLSAKD-----IWNTDLKAFEVGYQEFLQRD 753