>cd04323 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, anticodon recognition domain of the type found in human and Saccharomyces cerevisiae cytoplasmic asparaginyl-tRNA synthetase (AsnRS), in Brugia malayai AsnRs and, in various putative bacterial AsnRSs. This domain is a beta-barrel domain (OB fold) involved in binding the tRNA anticodon stem-loop. The enzymes in this group are homodimeric class2b aminoacyl-tRNA synthetases (aaRSs). aaRSs catalyze the specific attachment of amino acids (AAs) to their cognate tRNAs during protein biosynthesis. This 2-step reaction involves i) the activation of the AA by ATP in the presence of magnesium ions, followed by ii) the transfer of the activated AA to the terminal ribose of tRNA. In the case of the class2b aaRSs, the activated AA is attached to the 3'OH of the terminal ribose. Eukaryotes contain 2 sets of aaRSs, both of which are encoded by the nuclear genome. One set concerns with cytoplasmic synthesis, whereas the other exclusively with

Probab=92.47 E-value=0.83 Score=25.15 Aligned_cols=82 Identities=12% Similarity=0.193 Sum_probs=51.0 Q ss_pred EEEEEEEECCCCEEEECCCCCEEEEEEEEECCCCCCCCCCCEEECEEEECCCCCHHHHHH-HHHHHCCCCCEEEEEECCC Q ss_conf 799996425886679869998699999983456420268845301124302110158987-7221104771599984133 Q gi|254780183|r 7 KVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVFSEELCR-IVEQYLRKGSKVYIEGSLQ 85 (159) Q Consensus 7 ~v~l~G~l~~dPelr~~~~g~~v~~f~va~~~~~~~~~~~~~~d~t~~~~v~~~g~~~Ae-~~~~~l~KG~~V~V~Grl~ 85 (159) T Consensus 1 kV~l~GWV~~---~R~~-g~l~Fi~LR----------------D~~G~iQ~V~~~~~~~~~~~~~~l~~Es~v~V~G~v~ 60 (84) T cd04323 1 RVKVFGWVHR---LRSQ-KKLMFLVLR----------------DGTGFLQCVLSKKLVTEFYDAKSLTQESSVEVTGEVK 60 (84) T ss_pred CEEEEEEEEE---EECC-CCCEEEEEE----------------ECCEEEEEEECCCCCCHHHHHHHCCCCEEEEEEEEEE T ss_conf 9999998998---6238-992899995----------------0887999998886573689997388835999999999 Q ss_pred CCCCCCCCCCEEEEEEEEEEEEEECC Q ss_conf 33320468837688999997769846 Q gi|254780183|r 86 TRKWQDQSGNNRYTTEIIMRSMVMLD 111 (159) Q Consensus 86 ~~~~~~kdG~~r~~~~V~a~~i~~l~ 111 (159) T Consensus 61 ~~~---~~~~~~~~~Ei~~~~i~vl~ 83 (84) T cd04323 61 EDP---RAKQAPGGYELQVDYLEIIG 83 (84) T ss_pred ECC---CCCCCCCCEEEEEEEEEEEC T ss_conf 789---77779975999943999963

HHsearch alignment for GI: 254780183 and conserved domain: cd04323