BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780183|ref|YP_003064596.1| single-strand binding protein (ssb) [Candidatus Liberibacter asiaticus str. psy62] (159 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780183|ref|YP_003064596.1| single-strand binding protein (ssb) [Candidatus Liberibacter asiaticus str. psy62] Length = 159 Score = 326 bits (835), Expect = 2e-91, Method: Compositional matrix adjust. Identities = 159/159 (100%), Positives = 159/159 (100%) Query: 1 MVASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVF 60 MVASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVF Sbjct: 1 MVASLNKVILIGNLGADPDVRHTQDGRKIVNIRIATSDSWKDRVTNERREKTEWHSVIVF 60 Query: 61 SEELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMRSMVMLDGRRDSLQGE 120 SEELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMRSMVMLDGRRDSLQGE Sbjct: 61 SEELCRIVEQYLRKGSKVYIEGSLQTRKWQDQSGNNRYTTEIIMRSMVMLDGRRDSLQGE 120 Query: 121 EQRSEQHSNNLKENVVGNRYSSPREESVFSDELDDEIPF 159 EQRSEQHSNNLKENVVGNRYSSPREESVFSDELDDEIPF Sbjct: 121 EQRSEQHSNNLKENVVGNRYSSPREESVFSDELDDEIPF 159 >gi|254780564|ref|YP_003064977.1| hypothetical protein CLIBASIA_02255 [Candidatus Liberibacter asiaticus str. psy62] Length = 107 Score = 29.3 bits (64), Expect = 0.038, Method: Compositional matrix adjust. Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Query: 64 LCRIVEQYLRKGSKVY--IEGSLQTRKWQDQSGNNRYTTEII 103 L IV+QY+ Y I+G + RK+ DQ+ NR + E+I Sbjct: 58 LLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELI 99 >gi|254780644|ref|YP_003065057.1| hypothetical protein CLIBASIA_02655 [Candidatus Liberibacter asiaticus str. psy62] Length = 289 Score = 21.2 bits (43), Expect = 9.0, Method: Compositional matrix adjust. Identities = 7/18 (38%), Positives = 14/18 (77%) Query: 122 QRSEQHSNNLKENVVGNR 139 Q +E+H NNL++ ++ +R Sbjct: 174 QETEKHINNLQDKILQDR 191 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.314 0.131 0.371 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,950 Number of Sequences: 1233 Number of extensions: 3770 Number of successful extensions: 11 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 8 length of query: 159 length of database: 328,796 effective HSP length: 67 effective length of query: 92 effective length of database: 246,185 effective search space: 22649020 effective search space used: 22649020 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 35 (18.1 bits)