HHsearch alignment for GI: 254780185 and conserved domain: PRK13518

>PRK13518 carboxylate-amine ligase; Provisional.
Probab=98.70  E-value=1.1e-06  Score=61.43  Aligned_cols=161  Identities=17%  Similarity=0.191  Sum_probs=104.4

Q ss_pred             CCCCCCCCCCCHHHCCCCCCC-CHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEE-ECCCC--------------------
Q ss_conf             112221335621210365556-68887769999999999998744975444121-01456--------------------
Q gi|254780185|r  200 QITKYHNQINDAQHSFGLQSE-SLLHASDNLQKYKYSVHQVANSYCKIATFMPK-PIASH--------------------  257 (458)
Q Consensus       200 ~ie~~h~E~gpGQ~Ei~~~~~-~~l~aAD~~~~~k~~ik~iA~~~G~~ATFmpK-P~~~~--------------------  257 (458)
T Consensus        47 ~~~~v~~El~~~qvEi~T~vc~~~~e~~~~L~~~R~~l~~aA~~~G~~l~a~GThP~~~w~~~~it~~~RY~~l~~~~~~  126 (357)
T PRK13518         47 LAGRLDHELFKFVIETQTPTLNDVAAAPDALREVRDALVAHAEEHGFRIAAAGLHPGAKWRELEHAEKPRYRSQLDRIQY  126 (357)
T ss_pred             CCCCCCHHHHCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             45655746655479945867699999999999999999999998698899626898888776888997789999999889


Q ss_pred             -----CCCHHHHHHHHCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCHHCCCCC---------HHHHHHC----CC
Q ss_conf             -----86012011111146763122155565789999999999988641000006670---------0144318----88
Q gi|254780185|r  258 -----NGSGMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGGIIKHAKSLNALTNAST---------NSYKRLL----TD  319 (458)
Q Consensus       258 -----~GsG~Hih~Sl~~~~~n~f~~~~~~~ls~~~~~fiaGil~h~~al~a~~~Ptv---------NSYkRl~----p~  319 (458)
T Consensus       127 ~ar~~li~G~HVHVGv~d~--------------e~av~v~n~lr~~LP~LlALSAnSPFw~G~DTG~aS~R~~~~~~~P~  192 (357)
T PRK13518        127 PQHRNTTAGLHIHVGVDDP--------------DKAVWVANELRWHMPVLLALSANSPYWNGFDTGLASARAKIFEALPN  192 (357)
T ss_pred             HHHHHHHEEEEEEECCCCH--------------HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHCCC
T ss_conf             9998746103799617978--------------99999999888778999999717942048888751089999972764


Q ss_pred             CC-CCEEEEECC--------------CCCCC---EEECCCCCCCCCCEEEECCCCCCCCHH--HHHHHHHHHHHHHHHH
Q ss_conf             52-120101136--------------88764---010257887654124404675321279--9999999999987885
Q gi|254780185|r  320 SQ-SPTKLTYST--------------HNHSA---SCRIPYENKSDNKSIEIRFPDLSANPY--LAPAAILMAGLDGIAK  378 (458)
Q Consensus       320 ~~-ap~~~~WG~--------------~NR~a---~iRip~~~~~~~~riE~R~~da~aNPY--L~lAailaAgl~Gi~~  378 (458)
T Consensus       193 aG~P~~f~s~~~y~~~v~~L~~tG~I~d~~~i~WDiR-P---s~~~pTvEvRV~D~~~~~~~~~~lAaL~raLv~~~~~  267 (357)
T PRK13518        193 TGMPTAFEDYEAFQAFERRMVETGSIEDRGELWYDVR-P---HSGHGTVEVRAPDAQADPDVVLAFVEYAHALVTDLAA  267 (357)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEC-C---CCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             7999544899999999999997398277884589944-2---6999972576578889989999999999999999999