RPSBLAST alignment for GI: 254780185 and conserved domain: TIGR03105

>gnl|CDD|163137 TIGR03105, gln_synth_III, glutamine synthetase, type III. This family consists of the type III isozyme of glutamine synthetase, originally described in Rhizobium meliloti, where types I and II also occur. Length = 435
 Score =  176 bits (449), Expect = 9e-45
 Identities = 122/470 (25%), Positives = 210/470 (44%), Gaps = 62/470 (13%)

Query: 10  QKIAQEK-VKFIDLRFTDLQGKFRHISMNVSLFNENTLLNGITFDSSSID--GWHSKHPN 66
           Q +A++K +K+    F DL G  +   +      ++    G  F   +    G     P+
Sbjct: 2   QALARDKGIKYFLASFVDLHGVQKAKLVPAEAI-DHMATGGAGFAGFAAWGLGQSPADPD 60

Query: 67  LLLIPDIETMHMDPFYAQSTVAFI-CNVYDPITLQPYNRDPRYTAQKAIDYLQTTDIGDT 125
           L+ IPD++++   P+  Q  VA++  +++  +  +PY + PR   ++ +   +  ++G T
Sbjct: 61  LMAIPDLDSLTQLPW--QPGVAWVAADLH--VNGKPYPQAPRVVLKRQLA--EAAELGLT 114

Query: 126 LLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQNGNNK-----GYDSHAKSSYTLPPQ 180
           L  G+  EFF+                       ++ +         D+ AK  Y     
Sbjct: 115 LNTGVECEFFLLR---------------------RDEDGSLSIADRADTLAKPCYDQRGL 153

Query: 181 DKLHDMRSEIVSALNNIGVQITKYHNQINDA--QHSFGLQSESLLHASDNLQKYKYSVHQ 238
            + +D+ +EI  A+N +G     Y N   DA  Q          L  +D    ++Y V +
Sbjct: 154 MRRYDVLTEISDAMNALGWDP--YQNDHEDANGQFEMNFTYADALTTADRHAFFRYMVKE 211

Query: 239 VANSYCKIATFMPKPIASHNGSGMYLNMSIHKGE-KAIFTGNQHDR---VSLKGLYYLGG 294
           +A  +   ATFMPKP A   G+G + ++S+   + + +F  +       +S    +++GG
Sbjct: 212 IAEKHGMRATFMPKPFADLTGNGCHFHLSLWDEDGRNLFADDSDPNGLGLSKLAYHFIGG 271

Query: 295 IIKHAKSLNALTNASTNSYKRLL------TDSQSPTKLTYSTHNHSASCRIPYENKSDNK 348
           I+ HA +L A+   + NSYKRL         + +P  ++Y  +N +   RIP     D  
Sbjct: 272 ILHHAPALCAVLAPTVNSYKRLNAPRTTSGATWAPNFISYGGNNRTHMVRIP-----DPG 326

Query: 349 SIEIRFPDLSANPYLAPAAILMAGLDGIAKKIHPGKNIDELSLEEQ---NTIPRICISLR 405
             E+R  D +ANPYLA AAIL AGLDGI +K+ PG   D     E+     +  +  +L 
Sbjct: 327 RFELRLADGAANPYLAQAAILAAGLDGIERKLDPGPPRDINLYAEELAARGVETLPQNLL 386

Query: 406 ESLENLDKDREFLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEMY 455
           E+L  L+ D   L        + +D F+ LK +E  +     S  E + Y
Sbjct: 387 EALRALEAD-PLLA--EALGAEFVDEFLKLKRQEWEEYHRHVSDWEIDRY 433