RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780185|ref|YP_003064598.1| glutamine synthetase protein
[Candidatus Liberibacter asiaticus str. psy62]
         (458 letters)



>gnl|CDD|30523 COG0174, GlnA, Glutamine synthetase [Amino acid transport and
           metabolism].
          Length = 443

 Score =  364 bits (937), Expect = e-101
 Identities = 162/460 (35%), Positives = 240/460 (52%), Gaps = 37/460 (8%)

Query: 8   IIQKIAQEKVKFIDLRFTDLQGKFRHISMNVSLFN---ENTLLNGITFDSSSIDGWHSKH 64
           +++ + +  VKF+DLRFTDL G  R  ++               G+ FD SSI G+    
Sbjct: 6   VLKLLKENGVKFVDLRFTDLNGVLRGKTIPAEKPVSVLAQLFEGGVVFDGSSIAGFEGIG 65

Query: 65  -PNLLLIPDIETMHMDPFYAQSTVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTTDIG 123
             +++L PD+ T+ +DP+    T   +C+VYDP    PY RDPR   ++A+  L+   + 
Sbjct: 66  ESDMVLKPDLSTLVVDPWREGPTARVLCDVYDP-DGTPYPRDPRSVLKRALARLKDEGLA 124

Query: 124 DTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQNGNNKGYDSHAKSSYTLPPQDKL 183
              ++G   EFF+FD                         + G  +     + + P D+ 
Sbjct: 125 P-AVVGPELEFFLFDRD-------------------GRDPDGGRPADKGGYFDVAPLDEA 164

Query: 184 HDMRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESLLHASDNLQKYKYSVHQVANSY 243
            D R +IV AL   G++I   H+++   Q    L+ +  L A+D +  +KY V +VA  +
Sbjct: 165 EDFRRDIVEALEAAGIEIEAIHHEVAPGQFEINLRFDDALKAADQIVIFKYVVKEVAEKH 224

Query: 244 CKIATFMPKPIASHNGSGMYLNMSI-HKGEKAIFTG-NQHDRVSLKGLYYLGGIIKHAKS 301
              ATFMPKP    NGSGM+++ S+  K    +F   + +  +S   L+++GGI+KHA +
Sbjct: 225 GLTATFMPKPFFGDNGSGMHVHQSLWDKDGGNLFADEDGYAGLSETALHFIGGILKHAPA 284

Query: 302 LNALTNASTNSYKRLLTD-SQSPTKLTYSTHNHSASCRIPYENKS-DNKSIEIRFPDLSA 359
           L A+T  + NSYKRL      +PT + +   N SAS RIP    +   + +E R PD  A
Sbjct: 285 LTAITAPTVNSYKRLGVPYEWAPTYIAWGVRNRSASVRIPASGANGKARRVEFRVPDPDA 344

Query: 360 NPYLAPAAILMAGLDGIAKKIHPG----KNIDELSLEEQNTIPRICISLRESLENLDKDR 415
           NPYLA AAIL AGLDGI  K+ PG     N+ ELS EE+   P +  SLRE+L+ L +D 
Sbjct: 345 NPYLAFAAILAAGLDGIENKLEPGEPVDGNLYELSPEERKE-PTLPASLREALDAL-EDS 402

Query: 416 EFLKVGNVFDDDQIDAFINLKMKEVLKLESSPSPVEFEMY 455
           EFL+      +D IDA+I LK  E  +  S  +P EFE Y
Sbjct: 403 EFLR--EALGEDFIDAYIALKRAEWEEFRSRVTPWEFERY 440


>gnl|CDD|143894 pfam00120, Gln-synt_C, Glutamine synthetase, catalytic domain. 
          Length = 257

 Score =  244 bits (626), Expect = 3e-65
 Identities = 97/272 (35%), Positives = 141/272 (51%), Gaps = 17/272 (6%)

Query: 103 NRDPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFDNVHCTISPIKSGFALESTEFLQNG 162
            RDPR   ++A+  L       T   G   EFF+FD+V     P   G+        +  
Sbjct: 1   PRDPRSILKRALARLAELGY--TPYFGPEQEFFLFDDVRPGGGP-PGGYP-----DPRGP 52

Query: 163 NNKGYDSHAKSSYTLPPQDKLHDMRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESL 222
              GY       + + P D+  D+R +IV AL   G+ +   H+++   QH    +    
Sbjct: 53  YYGGY-------FPVAPLDEARDIRRDIVKALEAAGIPVEGIHHEVAPGQHEIDFRFADA 105

Query: 223 LHASDNLQKYKYSVHQVANSYCKIATFMPKPIASHNGSGMYLNMSI-HKGEKAIFT-GNQ 280
           L A+DNLQ +KY V +VA  +   ATFMPKPI   NGSGM+ + S+  K  K +F  G+ 
Sbjct: 106 LEAADNLQLFKYVVKRVAEKHGLTATFMPKPIFGDNGSGMHTHQSLWDKDGKNLFADGDG 165

Query: 281 HDRVSLKGLYYLGGIIKHAKSLNALTNASTNSYKRLLTDSQSPTKLTYSTHNHSASCRIP 340
           +  +S    +++GGI+KHA ++ A T  + NSYKRL+  +++P  + +   N SAS RIP
Sbjct: 166 YAGLSETARHFIGGILKHAPAITAYTAPTVNSYKRLVPGTEAPVYIAWGVRNRSASIRIP 225

Query: 341 YENKSDNKSIEIRFPDLSANPYLAPAAILMAG 372
                    +E R PD  ANPYLA AA+L AG
Sbjct: 226 RGGGPKAGRVEDRLPDPDANPYLALAALLAAG 257


>gnl|CDD|146534 pfam03951, Gln-synt_N, Glutamine synthetase, beta-Grasp domain. 
          Length = 84

 Score = 94.1 bits (235), Expect = 7e-20
 Identities = 34/84 (40%), Positives = 50/84 (59%), Gaps = 3/84 (3%)

Query: 16 KVKFIDLRFTDLQGKFRHISMNVSLFNENTLLNGITFDSSSIDGWHS-KHPNLLLIPDIE 74
           VKF+DLRFTD+ G+ +H+ +  +  +E+    GI FD SSI+G+      ++ L PD  
Sbjct: 1  GVKFVDLRFTDILGRLKHVRIPATELDEDAFEEGIGFDGSSIEGFAPINESDMYLKPDPS 60

Query: 75 TMHMDPFYAQS--TVAFICNVYDP 96
          T ++DPF      T   IC+VYDP
Sbjct: 61 TAYIDPFRPDPGKTARVICDVYDP 84


>gnl|CDD|35902 KOG0683, KOG0683, KOG0683, Glutamine synthetase [Amino acid
           transport and metabolism].
          Length = 380

 Score = 51.1 bits (122), Expect = 7e-07
 Identities = 78/358 (21%), Positives = 136/358 (37%), Gaps = 51/358 (14%)

Query: 26  DLQGKFRHISMNVSLFNENTLLNGITFDSSSIDGWHSKHPNLLLIPDIETMHMDPFYAQS 85
           +L+ K R +    S  +E  + N   +D SS      ++ ++ L P    ++ DPF   +
Sbjct: 43  NLRSKTRTLDAEPSSISELPIWN---YDGSSTGQAPGENSDVYLRP--VAIYPDPFRNGN 97

Query: 86  TVAFICNVYDPITLQPYNRDPRYTAQKAIDYLQTTDIGDTLLLGITTEFFVFD--NVHCT 143
            +  +C+ YD    +P   + R    + +  L T D       G+  E+ + D  + H  
Sbjct: 98  NILVMCDTYDF-DGKPTETNKRVACARIMPKLSTKD--TEPWFGMEQEYTLLDALDGHPF 154

Query: 144 ISPIKSGFALESTEFLQNGNNKGYDSHAKSSYTLPPQDKLHD--MRSEIVSALNNIGVQI 201
             P K GF      +        Y            +D + +   R+ + + LN  G+ +
Sbjct: 155 GWP-KGGFPGPQGPY--------YCGVGADRVF--GRD-IVEAHYRACLYAGLNISGINV 202

Query: 202 TKYHNQINDAQHSFGLQSESLLHASDNLQKYKYSVHQVANSYCKIATFMPKPIASH-NGS 260
                ++   Q  F +     +   D L   +Y +H+VA  +  IA+F PKPI    NG+
Sbjct: 203 -----EVMPGQWEFQVGPCEGISMGDQLWMARYILHRVAEKFGVIASFDPKPILGDWNGA 257

Query: 261 GMYLNMSIHKGEKAIFTGNQHDRVSLKGLYYLGGIIK-----HAKSLNALTNASTNSYKR 315
           G + N S     K +            GL  +   I      H + + A         +R
Sbjct: 258 GCHTNFST----KEMREAG--------GLKIIEEAIPKLSKRHREHIAAYDPKGGKDNER 305

Query: 316 LLTD---SQSPTKLTYSTHNHSASCRIPYENKSDNKSI-EIRFPDLSANPYLAPAAIL 369
            LT    + S    ++   N + S RIP    ++ K   E R P  + +PY     I+
Sbjct: 306 RLTGRHETGSIDNFSWGVANRNPSIRIPRTVAAEGKGYFEDRRPSSNCDPYAVTLMII 363


>gnl|CDD|33749 COG3968, COG3968, Uncharacterized protein related to glutamine
           synthetase [General function prediction only].
          Length = 724

 Score = 37.7 bits (87), Expect = 0.007
 Identities = 30/135 (22%), Positives = 52/135 (38%), Gaps = 5/135 (3%)

Query: 181 DKLHDMRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESLLHASDNLQKYKYSVHQVA 240
           +++     ++   L  +G+     HN++   Q       ES   A+D+ Q     + + A
Sbjct: 266 ERVSAFMKDVEKELYALGIPAKTRHNEVAPGQFEIAPIFESGNLATDHQQLVMEVLKKTA 325

Query: 241 NSYCKIATFMPKPIASHNGSGMYLNMSI--HKGEKAIFTGNQ-HDRVSLKGLYYLGGIIK 297
             +  +     KP A  NGSG + N S+    G   +  G+  HD      L +   +IK
Sbjct: 326 LKHGLVCLLHEKPFAGINGSGKHNNWSMGTDDGLNLLDPGDMPHDNKQF--LLFCTAVIK 383

Query: 298 HAKSLNALTNASTNS 312
                  L  AS  +
Sbjct: 384 AVDKYADLLRASAAN 398


>gnl|CDD|37825 KOG2614, KOG2614, KOG2614, Kynurenine 3-monooxygenase and related
           flavoprotein monooxygenases [Energy production and
           conversion, General function prediction only].
          Length = 420

 Score = 29.9 bits (67), Expect = 1.6
 Identities = 8/73 (10%), Positives = 21/73 (28%), Gaps = 12/73 (16%)

Query: 31  FRHISMNVSLFNENTLLNGITFDSSS------------IDGWHSKHPNLLLIPDIETMHM 78
            R     ++ +  +  L    F                +D +    P+++ +   E++  
Sbjct: 210 PRPGFHLIAYWFLDKSLTSTDFAPFDEPEKLKKTSLEVVDFFPENFPDIIELTGEESIVR 269

Query: 79  DPFYAQSTVAFIC 91
            P   +     I 
Sbjct: 270 TPLADRPPWPLIS 282


>gnl|CDD|38745 KOG3537, KOG3537, KOG3537, Adaptor protein NUMB [Signal
           transduction mechanisms].
          Length = 543

 Score = 29.7 bits (66), Expect = 1.6
 Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 8/53 (15%)

Query: 51  TFDSSSIDGWHSKHPNLLLIPDIETMHMDPFYAQ-------STVAFICNVYDP 96
             ++ +   W++  PN + IP      +DPF AQ       ST  F  N + P
Sbjct: 484 PRNAPAGINWNAS-PNPMKIPQPPAKPVDPFDAQWSRLAVNSTNPFPSNPFSP 535


>gnl|CDD|37128 KOG1917, KOG1917, KOG1917, Membrane-associated hematopoietic
           protein [General function prediction only].
          Length = 1125

 Score = 28.4 bits (63), Expect = 4.1
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 11/62 (17%)

Query: 166 GYDSHAKSSYTLPPQDKLHDMRSEIVSALNNIGVQITKYHNQINDAQHSFGLQ---SESL 222
           G++S+ K+  +L   DKLH   +E+  ALN        Y   I   +H+F  +    + L
Sbjct: 658 GHESYRKNRKSLTMLDKLHTALTELCFALN--------YVPPICVWEHTFAPREYLRQHL 709

Query: 223 LH 224
             
Sbjct: 710 EG 711


>gnl|CDD|36190 KOG0972, KOG0972, KOG0972, Huntingtin interacting protein 1 (Hip1)
           interactor Hippi [Signal transduction mechanisms].
          Length = 384

 Score = 27.3 bits (60), Expect = 9.7
 Identities = 13/61 (21%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 181 DKLHDMRSEIVSALNNIGVQITKYHNQINDAQHSFGLQSESLLHASDNL-QKYKYSVHQV 239
           ++++ M   I   + N+G  + K H +I  A      + +SL +   +L QK++ +   +
Sbjct: 230 EQMNSMHKNIEQKVGNVGPYLDKLHKEITKALEKIASREKSLNNQLASLMQKFRRATDTL 289

Query: 240 A 240
           +
Sbjct: 290 S 290


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.317    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0833    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 5,290,694
Number of extensions: 271072
Number of successful extensions: 558
Number of sequences better than 10.0: 1
Number of HSP's gapped: 544
Number of HSP's successfully gapped: 10
Length of query: 458
Length of database: 6,263,737
Length adjustment: 97
Effective length of query: 361
Effective length of database: 4,167,664
Effective search space: 1504526704
Effective search space used: 1504526704
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (26.3 bits)