RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780187|ref|YP_003064600.1| 30S ribosomal protein S4 [Candidatus Liberibacter asiaticus str. psy62] (206 letters) >gnl|CDD|30868 COG0522, RpsD, Ribosomal protein S4 and related proteins [Translation, ribosomal structure and biogenesis]. Length = 205 Score = 189 bits (480), Expect = 6e-49 Identities = 88/209 (42%), Positives = 122/209 (58%), Gaps = 7/209 (3%) Query: 1 MSKRESSKHKIDRRIGENLWGRPKSPVNTR-SYGPGLHGQRRKSKPSYFGLQLRAKQKMK 59 M++ K K+ RR+G N W + + + Y PG HGQ R K S +GLQLR KQK++ Sbjct: 1 MARYPGPKKKLSRRLGFNPWLKERLCKERKLPYKPGQHGQERWKKLSDYGLQLREKQKLR 60 Query: 60 KYYGDISEKKFRSIFKEADRSRGDTSHNLISFLESRLDTIVYRAKFVPTIFAARQFVNHR 119 +YG + EK+FR KEA R +G T NL++ LE RLD +VYR F T ARQ V+H Sbjct: 61 AFYG-VLEKQFRRYLKEAGRLKGVTGLNLLALLERRLDNVVYRLGFAKTRRQARQLVSHG 119 Query: 120 HVLVNGRSVNIGSYRCKEGDVIEVKQKSKQLASVLEASQLAE--RDVPEYISVNHDNMVA 177 H+LVNG+ VNI SY GD I V++KSK + EA +LA P ++ V+ + + Sbjct: 120 HILVNGKRVNIPSYLVSPGDEISVREKSKSPIKIKEALELAAQRGIPPAWLEVDEEKLEG 179 Query: 178 TFVRIPSSLKDVPYPVIMQPNLVVEFYSR 206 TF R+P + P + L+VEFYS+ Sbjct: 180 TFKRLP---ERSDLPAPINEQLIVEFYSK 205 >gnl|CDD|177038 CHL00113, rps4, ribosomal protein S4; Reviewed. Length = 201 Score = 148 bits (376), Expect = 1e-36 Identities = 81/213 (38%), Positives = 116/213 (54%), Gaps = 21/213 (9%) Query: 1 MSKRESSKHKIDRRIGENLWG----RPKSPVNTRSYGPGLHGQRRKSKPSYFGLQLRAKQ 56 MS+ + KI RR+G L G P+ G L Q R K S + ++L KQ Sbjct: 1 MSRYRGPRLKIIRRLGA-LPGLTSKTPR-------PGSDLRNQSRSGKKSQYRIRLEEKQ 52 Query: 57 KMKKYYGDISEKKFRSIFKEADRSRGDTSHNLISFLESRLDTIVYRAKFVPTIFAARQFV 116 K++ YG ++E++ + A +++G T L+ LE RLD I++R PTI AARQ V Sbjct: 53 KLRFNYG-LTERQLLKYVRIARKAKGSTGQVLLQLLEMRLDNILFRLGMAPTIPAARQLV 111 Query: 117 NHRHVLVNGRSVNIGSYRCKEGDVIEVK--QKSKQLA-SVLEASQLAERDVPEYISVNHD 173 NH H+LVNGR V+I SYRCK D+I VK QKSK L + LE+S E +P +++++ Sbjct: 112 NHGHILVNGRIVDIPSYRCKPKDIITVKDKQKSKNLIQNNLESSPREE--LPNHLTLDKL 169 Query: 174 NMVATFVRIPSSLKDVPYPVIMQPNLVVEFYSR 206 +I K V + + LVVE+YSR Sbjct: 170 QYKGLVNQIIDR-KWV--GLKINELLVVEYYSR 199 >gnl|CDD|144902 pfam01479, S4, S4 domain. The S4 domain is a small domain consisting of 60-65 amino acid residues that was detected in the bacterial ribosomal protein S4, eukaryotic ribosomal S9, two families of pseudouridine synthases, a novel family of predicted RNA methylases, a yeast protein containing a pseudouridine synthetase and a deaminase domain, bacterial tyrosyl-tRNA synthetases, and a number of uncharacterized, small proteins that may be involved in translation regulation. The S4 domain probably mediates binding to RNA. Length = 48 Score = 67.5 bits (166), Expect = 2e-12 Identities = 22/47 (46%), Positives = 27/47 (57%) Query: 95 RLDTIVYRAKFVPTIFAARQFVNHRHVLVNGRSVNIGSYRCKEGDVI 141 RLD ++ R + ARQ + H HV VNG+ V SYR K GDVI Sbjct: 2 RLDKVLARLGLASSRSEARQLIRHGHVRVNGKVVKDPSYRVKPGDVI 48 >gnl|CDD|29105 cd00165, S4, S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site; Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized functional similarity between these three protein classes.. Length = 70 Score = 66.8 bits (163), Expect = 4e-12 Identities = 31/66 (46%), Positives = 38/66 (57%) Query: 95 RLDTIVYRAKFVPTIFAARQFVNHRHVLVNGRSVNIGSYRCKEGDVIEVKQKSKQLASVL 154 RLD I+ R P+ ARQ + H HVLVNG+ V SY+ K GDVIEV KS + V Sbjct: 2 RLDKILARLGLAPSRSEARQLIKHGHVLVNGKVVTKPSYKVKPGDVIEVDGKSIEEDIVY 61 Query: 155 EASQLA 160 E +L Sbjct: 62 EDKKLL 67 >gnl|CDD|143931 pfam00163, Ribosomal_S4, Ribosomal protein S4/S9 N-terminal domain. This family includes small ribosomal subunit S9 from prokaryotes and S16 from metazoans. This domain is predicted to bind to ribosomal RNA. This domain is composed of four helices in the known structure. However the domain is discontinuous in sequence and the alignment for this family contains only the first three helices. Length = 94 Score = 52.3 bits (126), Expect = 9e-08 Identities = 31/96 (32%), Positives = 47/96 (48%), Gaps = 6/96 (6%) Query: 2 SKRESSKHKIDRRIGENLWGRPKSPVNTRSYG--PGLHGQRRKS--KPSYFGLQLRAKQK 57 S+ K+ RR+GE K+ + YG PG HG R K + S + L+L KQK Sbjct: 1 SRYRGPTLKLPRRLGELPRLTAKTKLA-GEYGLRPGQHGWRVKKGRRLSRYLLRLDEKQK 59 Query: 58 MKKYYGDISEKKFRSIFKEADRSRGDTSHNLISFLE 93 ++ +YG + E++ R A + G NL+ LE Sbjct: 60 LRFFYG-LLERQLRRYGVLAKKLDGSLGLNLLDLLE 94 >gnl|CDD|38511 KOG3301, KOG3301, KOG3301, Ribosomal protein S4 [Translation, ribosomal structure and biogenesis]. Length = 183 Score = 50.4 bits (120), Expect = 3e-07 Identities = 18/46 (39%), Positives = 26/46 (56%) Query: 91 FLESRLDTIVYRAKFVPTIFAARQFVNHRHVLVNGRSVNIGSYRCK 136 FLE RL TIV++ +I AR + RH+ V + VNI S+ + Sbjct: 94 FLERRLQTIVFKLGLAKSIHHARVLIRQRHIRVGKQIVNIPSFMVR 139 >gnl|CDD|31381 COG1188, COG1188, Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) [Translation, ribosomal structure and biogenesis]. Length = 100 Score = 31.0 bits (70), Expect = 0.24 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 3/72 (4%) Query: 95 RLDTIVYRAKFVPTIFAARQFVNHRHVLVNGRSVNIGSYRCKEGDVIEVKQKSKQLASVL 154 RLD ++ A+F+ A++ + V VNG+ S K GD++ ++ +K+ + Sbjct: 10 RLDKWLWAARFIKRRSLAKEMIEGGRVKVNGQRAK-PSKEVKVGDILTIRFGNKEF--TV 66 Query: 155 EASQLAERDVPE 166 + L E+ P Sbjct: 67 KVLALGEQRRPA 78 >gnl|CDD|31382 COG1189, COG1189, Predicted rRNA methylase [Translation, ribosomal structure and biogenesis]. Length = 245 Score = 31.0 bits (70), Expect = 0.26 Identities = 17/58 (29%), Positives = 26/58 (44%) Query: 95 RLDTIVYRAKFVPTIFAARQFVNHRHVLVNGRSVNIGSYRCKEGDVIEVKQKSKQLAS 152 RLD ++ + A++ + +VLVNG V S D IEVK + + S Sbjct: 4 RLDALLVERGLFESREKAKELILAGNVLVNGEKVTKPSQLVDIDDEIEVKGEEQPYVS 61 >gnl|CDD|32457 COG2302, COG2302, Uncharacterized conserved protein, contains S4-like domain [Function unknown]. Length = 257 Score = 30.6 bits (69), Expect = 0.34 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 13/60 (21%) Query: 95 RLDTIV------YRAKFVPTIFAARQFVNHRHVLVNGRSVNIGSYRCKEGDVIEVKQKSK 148 RLD ++ RAK Q + V VN + V+ SY +EGD+I ++ + Sbjct: 182 RLDVVISEGFGLSRAKAQ-------QLIEKGKVKVNWKVVDKASYEVQEGDLISIRGFGR 234 >gnl|CDD|36152 KOG0934, KOG0934, KOG0934, Clathrin adaptor complex, small subunit [Intracellular trafficking, secretion, and vesicular transport]. Length = 145 Score = 27.2 bits (60), Expect = 3.7 Identities = 14/49 (28%), Positives = 28/49 (57%) Query: 55 KQKMKKYYGDISEKKFRSIFKEADRSRGDTSHNLISFLESRLDTIVYRA 103 K +++K+Y +S K+ + I +E +S + SF+E + + +VYR Sbjct: 13 KTRLQKWYEALSIKERKKIERELIKSVLARKPKMCSFIEYKDEKVVYRR 61 >gnl|CDD|107256 cd01543, PBP1_XylR, Ligand-binding domain of DNA transcription repressor specific for xylose (XylR). Ligand-binding domain of DNA transcription repressor specific for xylose (XylR), a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of XylR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor. Length = 265 Score = 26.4 bits (59), Expect = 6.5 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Query: 153 VLEASQLAERDVPEYISV---NHDNMVATFVRIP-SS 185 +LEA + A VPE ++V ++D ++ R P SS Sbjct: 186 LLEACRRAGIAVPEEVAVLGVDNDELICELSRPPLSS 222 >gnl|CDD|145636 pfam02597, ThiS, ThiS family. ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer. ThiS is coded in the thiCEFSGH operon in E. coli. This family of proteins have two conserved Glycines at the COOH terminus. Thiocarboxylate is formed at the last G in the activation process. Sulphur is transferred from ThiI to ThiS in a reaction catalysed by IscS. MoaD, a protein involved sulphur transfer in molybdopterin synthesis, is about the same length and shows limited sequence similarity to ThiS. Both have the conserved GG at the COOH end. Length = 70 Score = 26.0 bits (58), Expect = 7.3 Identities = 8/25 (32%), Positives = 11/25 (44%), Gaps = 2/25 (8%) Query: 121 VLVNGRSVN--IGSYRCKEGDVIEV 143 V VNG V K+GD + + Sbjct: 39 VAVNGEIVPRSQADTPLKDGDEVAI 63 >gnl|CDD|34758 COG5157, CDC73, RNA polymerase II assessory factor [Transcription]. Length = 362 Score = 25.9 bits (56), Expect = 9.3 Identities = 18/114 (15%), Positives = 36/114 (31%), Gaps = 9/114 (7%) Query: 41 RKSKPSYFGLQLRAKQKMKKYYGD-------ISEKKFRSIFKEADRSRGDTSHNLISFLE 93 R + + R Y+ D + S + +A + +TS Sbjct: 76 RDKSYAVYMTLCRESGIGNIYFLDRTDLIEWLEGNTESSQYLKAPGQKKETSSTTSISA- 134 Query: 94 SRLDTIVYRAKFVPTIFAARQFVNHRHVLVNGRSVNIGSYRCKEGDVIEVKQKS 147 R+D+ V V T+ R V H L+ + ++ + D + + Sbjct: 135 -RIDSEVSDPVVVETMKHERILVGHNSRLIGLKPISFLGLLKDKEDKLVQSEGG 187 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0591 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,402,077 Number of extensions: 117295 Number of successful extensions: 281 Number of sequences better than 10.0: 1 Number of HSP's gapped: 275 Number of HSP's successfully gapped: 16 Length of query: 206 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 117 Effective length of database: 4,340,536 Effective search space: 507842712 Effective search space used: 507842712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.3 bits)