RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780194|ref|YP_003064607.1| 50S ribosomal protein L31 [Candidatus Liberibacter asiaticus str. psy62] (74 letters) >gnl|CDD|144697 pfam01197, Ribosomal_L31, Ribosomal protein L31. Length = 69 Score = 79.1 bits (196), Expect = 3e-16 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 4/71 (5%) Query: 1 MKKNIHPETHLITVVMT-DGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGG 59 MKK IHPE + + G + TRST + V+K+D+ H + G +QK+ D G Sbjct: 1 MKKGIHPEYREVVFTCSSCGNVFVTRSTKEYP--VIKIDVCSACHPFYTG-KQKLVDTAG 57 Query: 60 QVSRFKKRFAG 70 +V +F KRF Sbjct: 58 RVEKFNKRFGK 68 >gnl|CDD|30603 COG0254, RpmE, Ribosomal protein L31 [Translation, ribosomal structure and biogenesis]. Length = 75 Score = 73.0 bits (179), Expect = 2e-14 Identities = 28/74 (37%), Positives = 40/74 (54%), Gaps = 5/74 (6%) Query: 1 MKKNIHPETHLITVVMTD--GTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRG 58 MKK+IHPE + V + G ++ TRST + + LD+ H + G +QKI D Sbjct: 1 MKKDIHPEYYRPVVFVCSSCGNEFTTRSTKGTD--EINLDVCSKCHPFYTG-KQKIVDTE 57 Query: 59 GQVSRFKKRFAGLS 72 G+V +F KRF G Sbjct: 58 GRVEKFNKRFGGFK 71 >gnl|CDD|177058 CHL00136, rpl31, ribosomal protein L31; Validated. Length = 68 Score = 37.3 bits (87), Expect = 9e-04 Identities = 26/70 (37%), Positives = 35/70 (50%), Gaps = 4/70 (5%) Query: 1 MKKNIHPETHLITVVMTDGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQ 60 KKNIHP+ T V DG T + K E + +DI +H + G QKI D G+ Sbjct: 2 PKKNIHPQWFPETKVYCDGQLVMTVGSTKPE---LNVDIWSGNHPFYT-GSQKIIDTEGR 57 Query: 61 VSRFKKRFAG 70 V RF K++ Sbjct: 58 VERFMKKYGL 67 >gnl|CDD|99966 cd03792, GT1_Trehalose_phosphorylase, Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose. The catalyzing activity includes the phosphorolysis of trehalose, which produce alpha-Glc-1-P and glucose, and the subsequent synthesis of trehalose. This family is most closely related to the GT1 family of glycosyltransferases.. Length = 372 Score = 24.9 bits (55), Expect = 5.0 Identities = 13/52 (25%), Positives = 18/52 (34%), Gaps = 12/52 (23%) Query: 25 RSTWKEEGAVMKLDIDPLSHF---------AWIGGRQKI-TDRG--GQVSRF 64 ++ IDPLS +I + I +R QVSRF Sbjct: 148 PPQVPPRKVIIPPSIDPLSGKNRELSPADIEYILEKYGIDPERPYITQVSRF 199 >gnl|CDD|38908 KOG3704, KOG3704, KOG3704, Heparan sulfate D-glucosaminyl 3-O-sulfotransferase [Posttranslational modification, protein turnover, chaperones]. Length = 360 Score = 24.6 bits (53), Expect = 5.5 Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 41 PLSHFAWIGGRQKITDRGGQVSRFKKRFAGLS 72 PL ++ G + I+D G++ R + F GL Sbjct: 258 PLRQILFVSGERLISDPAGELGRV-QDFLGLK 288 >gnl|CDD|34245 COG4625, COG4625, Uncharacterized protein with a C-terminal OMP (outer membrane protein) domain [Function unknown]. Length = 577 Score = 24.6 bits (53), Expect = 6.5 Identities = 12/46 (26%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Query: 18 DGTQYQTRSTWKEEGAVMKLDIDPLSHFAWIGGRQKITDRGGQVSR 63 G Q + W+ D+ P S FA G G +SR Sbjct: 491 VGLQLRGYLGWRHN---FDQDLTPESSFAAASGWTAFVVVGVPISR 533 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.134 0.407 Gapped Lambda K H 0.267 0.0823 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 905,457 Number of extensions: 35968 Number of successful extensions: 66 Number of sequences better than 10.0: 1 Number of HSP's gapped: 60 Number of HSP's successfully gapped: 7 Length of query: 74 Length of database: 6,263,737 Length adjustment: 45 Effective length of query: 29 Effective length of database: 5,291,332 Effective search space: 153448628 Effective search space used: 153448628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (23.2 bits)