>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.

Probab=90.61 E-value=1.1 Score=25.44 Aligned_cols=82 Identities=13% Similarity=0.161 Sum_probs=49.5 Q ss_pred HHHHHHHHHHHHHHHHCCCCCEEEECCCC--CC--------CCCHHHHHCCCCEEEECCCCCCCCC---HHHHHHHHHHH Q ss_conf 46888888888878736724167722565--67--------2344566216983997377786550---16888998874 Q gi|254780195|r 306 AYRSLIEALRHSGVSNYTKVQLSWIDAET--LE--------KEDPVKHFYGVHGILVPGGFGKRGS---EGKIAAIKFAR 372 (544) Q Consensus 306 aY~Si~EAL~hA~~~~~~kv~i~wIdse~--le--------~~~~~~~L~~~dGIlVPGGFG~RGi---eGkI~Ai~yAR 372 (544) T Consensus 13 ~~~~~~evl~~a~~-~~~~~~v~~vs~~~~~v~ss~G~~v~~d~~~~~~~~~D~lvvpGg~~~~~~~~~~~l~~~Lr~~~ 91 (183) T cd03139 13 DVIGPYEVFGRAPR-LAAPFEVFLVSETGGPVSSRSGLTVLPDTSFADPPDLDVLLVPGGGGTRALVNDPALLDFIRRQA 91 (183) T ss_pred HHHHHHHHHHHHHH-CCCCEEEEEEECCCCCEEECCCCEEECCCCHHHCCCCCEEEECCCCCHHHHCCCHHHHHHHHHHH T ss_conf 99999999983344-38986999997699907867980896058844667589999879987453048989999999987 Q ss_pred CCCCCHHHHHHHHHHH Q ss_conf 0476322355769999 Q gi|254780195|r 373 ENKIPFLGICFGMQMA 388 (544) Q Consensus 373 en~iP~LGIClGmQ~a 388 (544) T Consensus 92 ~~g~~i~siCtGa~~L 107 (183) T cd03139 92 ARAKYVTSVCTGALLL 107 (183) T ss_pred HCCCEEEEECHHHHHH T ss_conf 6198389873767999

HHsearch alignment for GI: 254780195 and conserved domain: cd03139