RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780195|ref|YP_003064608.1| CTP synthetase [Candidatus Liberibacter asiaticus str. psy62] (544 letters) >gnl|CDD|30850 COG0504, PyrG, CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]. Length = 533 Score = 801 bits (2071), Expect = 0.0 Identities = 313/543 (57%), Positives = 393/543 (72%), Gaps = 14/543 (2%) Query: 3 KYIFITGGVVSSLGKGVAAASLGALLQAHKYKVRVRKLDPYLNSDPGTMSPVQHGEVFVT 62 KYIF+TGGVVSSLGKG+ AASLG LL+A KV ++KLDPYLN DPGTMSP QHGEVFVT Sbjct: 2 KYIFVTGGVVSSLGKGITAASLGRLLKARGLKVTIQKLDPYLNVDPGTMSPYQHGEVFVT 61 Query: 63 DDGGEADLDFGHYERFMGISTAKADNITAGRIYKNVIDRERRGDYLGTTVQVIPHVTNEI 122 DDG E DLD GHYERF+ ++ +K +NIT G+IY VI++ERRGDYLG TVQVIPH+T+EI Sbjct: 62 DDGAETDLDLGHYERFLDVNLSKDNNITTGKIYSEVIEKERRGDYLGKTVQVIPHITDEI 121 Query: 123 KEFITQGNE-DADFVICEIGGTIGDIEVMPFVEAIRQFGNEFSHRGSKALYIHLTLMPYI 181 K+ I + + AD VI EIGGT+GDIE +PF+EAIRQ E L+IH+TL+PYI Sbjct: 122 KDRIREAADSTADVVIVEIGGTVGDIESLPFLEAIRQLRLELGR--ENVLFIHVTLVPYI 179 Query: 182 RSSGELKTKPTQHSVKELQALGVHPDILLIRADRDIPEMERRKISLFCNVPMSAVIPALD 241 ++GELKTKPTQHSVKEL+++G+ PDIL+ R++R +PE ERRKI+LFCNVP AVI A D Sbjct: 180 AAAGELKTKPTQHSVKELRSIGIQPDILICRSERPLPEEERRKIALFCNVPEEAVISAPD 239 Query: 242 VDDIYKVPLSYHREGIDSVVLNAFGIENVSLPQIDNWQTFCDRTLSLKNEVKVAIVGKYI 301 V+ IY+VPL ++G+D +L + P + W+ D+ + K EV +A+VGKY+ Sbjct: 240 VESIYEVPLLLEKQGLDDYILERLNLNAPE-PDLSEWKDLVDKIKNPKKEVTIALVGKYV 298 Query: 302 HLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVPGGFGKRGS 361 L DAY+S+IEAL+H+G++ KV + WID+E LE+E+ + V GILVPGGFG RG Sbjct: 299 ELPDAYKSVIEALKHAGIALGVKVNIKWIDSEDLEEENAAELEKLVDGILVPGGFGYRGV 358 Query: 362 EGKIAAIKFARENKIPFLGICFGMQMAVIEAARNLAGIPNACSTEFSEAGV-PVIALMSE 420 EGKIAAI++AREN IPFLGIC GMQ+AVIE ARN+ G+ A STEF PV+ LM E Sbjct: 359 EGKIAAIRYARENNIPFLGICLGMQLAVIEFARNVLGLEGANSTEFDPDTKYPVVDLMPE 418 Query: 421 WMKGDQQEKRLPSDDLGATMRLGAYDVSLKEETLISRIYGLDLIPERHRHRYEVNVRYRE 480 DLG TMRLGAY LK TL +++YG D I ERHRHRYEVN YR+ Sbjct: 419 QKDV---------VDLGGTMRLGAYPCRLKPGTLAAKLYGKDEIYERHRHRYEVNNDYRD 469 Query: 481 KLEGCGLKFSGFSVDHALPEVVEYINHPWFIGVQYHPELKSRPLDPHPLFVSFIQATVLY 540 +LE GL FSG S D L E+VE +HP+F+ Q+HPE KSRPL PHPLFV F++A + Y Sbjct: 470 QLEKAGLVFSGTSPDGGLVEIVELPDHPFFVATQFHPEFKSRPLRPHPLFVGFVKAALEY 529 Query: 541 SQS 543 + Sbjct: 530 KKD 532 >gnl|CDD|37598 KOG2387, KOG2387, KOG2387, CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]. Length = 585 Score = 569 bits (1468), Expect = e-163 Identities = 256/560 (45%), Positives = 360/560 (64%), Gaps = 35/560 (6%) Query: 2 VKYIFITGGVVSSLGKGVAAASLGALLQAHKYKVRVRKLDPYLNSDPGTMSPVQHGEVFV 61 +KY+ +TGGV+S +GKG+ A+S+G LL++ +V K+DPYLN D GTMSP +HGEVFV Sbjct: 1 MKYVLVTGGVISGIGKGIIASSIGVLLKSCGLRVTSIKIDPYLNIDAGTMSPYEHGEVFV 60 Query: 62 TDDGGEADLDFGHYERFMGISTAKADNITAGRIYKNVIDRERRGDYLGTTVQVIPHVTNE 121 DDGGE DLD G+YERF+ I+ + +NIT G+IY++VI++ERRGDYLG TVQV+PH+T+ Sbjct: 61 LDDGGEVDLDLGNYERFLDITLTRDNNITTGKIYQHVIEKERRGDYLGKTVQVVPHITDA 120 Query: 122 IKEFI-------TQGNED-ADFVICEIGGTIGDIEVMPFVEAIRQFGNEFSHRGSKALYI 173 I+++I G D + E+GGT+GDIE MPFVEA+RQF +F I Sbjct: 121 IQDWIERVARIPVDGTGGEPDVCVIELGGTVGDIESMPFVEALRQF--QFKVGRENFCLI 178 Query: 174 HLTLMPYIRSSGELKTKPTQHSVKELQALGVHPDILLIRADRDIPEMERRKISLFCNVPM 233 H++L+P + +GE KTKPTQHSV++L+ LG+ PD++ R+ + + + KIS+FC+V Sbjct: 179 HVSLVPVLSVTGEQKTKPTQHSVRDLRGLGLSPDLIACRSTKPLEMSVKEKISMFCHVGP 238 Query: 234 SAVIPALDVDDIYKVPLSYHREGIDSVVLNAFGIENVSL--PQIDNWQTFCDRTLSLKNE 291 V+ DV IY VPL +GI + G+ +S P +D W +R L+ Sbjct: 239 EQVVGLHDVSSIYHVPLLLEEQGIVEYLNRRLGLSIISSERPMLDKWSNMAERYDDLQVP 298 Query: 292 VKVAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLE----KEDPVKH---- 343 V++A+VGKY L D+Y S+++AL H+ ++ K+++ WID+ LE +EDP K+ Sbjct: 299 VRIALVGKYTKLSDSYLSVVKALEHAALAINRKLEIVWIDSSDLEPETEQEDPRKYHAAW 358 Query: 344 --FYGVHGILVPGGFGKRGSEGKIAAIKFARENKIPFLGICFGMQMAVIEAARNLAGIPN 401 GILVPGGFG RG EGKI A K+ARENKIPFLGIC GMQ+AVIE ARN+ G+ + Sbjct: 359 QKLKSADGILVPGGFGDRGVEGKILAAKWARENKIPFLGICLGMQLAVIEFARNVLGLKD 418 Query: 402 ACSTEF-SEAGVPVIALMSEWMKGDQQEKRLPSDDLGATMRLGAYDVSLK-EETLISRIY 459 A STEF E PV+ M E K +G TMRLG+ + +++ + ++Y Sbjct: 419 ANSTEFDPETKNPVVIFMPEHNKT----------HMGGTMRLGSRRTVFQDKDSKLRKLY 468 Query: 460 G-LDLIPERHRHRYEVNVRYREKLEGCGLKFSGFSVDHALPEVVEYINHPWFIGVQYHPE 518 G ++ + ERHRHRYEVN ++LE GL F G V E++E +HP+F+GVQ+HPE Sbjct: 469 GNVEFVDERHRHRYEVNPEMVKQLEQAGLSFVGKDVTGKRMEIIELESHPFFVGVQFHPE 528 Query: 519 LKSRPLDPHPLFVSFIQATV 538 KSRP P PLF+ + A+ Sbjct: 529 FKSRPDKPSPLFLGLVAASC 548 >gnl|CDD|48377 cd03113, CTGs, CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain. The enzymes hydrolyze the amide bond of glutamine to ammonia and glutamate at the glutaminase domains and transfer nascent ammonia to the acceptor substrate at the synthetase domain to form an aminated product. Glutaminase domains have evolved from the same ancestor, whereas the synthetase domains are evolutionarily unrelated and have different functions. This protein family is classified based on the N-terminal synthetase domain.. Length = 255 Score = 413 bits (1064), Expect = e-116 Identities = 161/257 (62%), Positives = 203/257 (78%), Gaps = 4/257 (1%) Query: 3 KYIFITGGVVSSLGKGVAAASLGALLQAHKYKVRVRKLDPYLNSDPGTMSPVQHGEVFVT 62 KYIF+TGGVVSSLGKG+ AASLG LL+A KV +KLDPYLN DPGTMSP QHGEVFVT Sbjct: 1 KYIFVTGGVVSSLGKGITAASLGRLLKARGLKVTAQKLDPYLNVDPGTMSPYQHGEVFVT 60 Query: 63 DDGGEADLDFGHYERFMGISTAKADNITAGRIYKNVIDRERRGDYLGTTVQVIPHVTNEI 122 DDG E DLD GHYERF+ + ++ +NIT G+IY +VI++ERRGDYLG TVQVIPH+T+EI Sbjct: 61 DDGAETDLDLGHYERFLDTNLSRDNNITTGKIYSSVIEKERRGDYLGKTVQVIPHITDEI 120 Query: 123 KEFITQGNE--DADFVICEIGGTIGDIEVMPFVEAIRQFGNEFSHRGSKALYIHLTLMPY 180 KE I + E AD VI EIGGT+GDIE +PF+EAIRQ E L+IH+TL+PY Sbjct: 121 KERIRRVAEKSGADVVIVEIGGTVGDIESLPFLEAIRQMKLELG--RENVLFIHVTLVPY 178 Query: 181 IRSSGELKTKPTQHSVKELQALGVHPDILLIRADRDIPEMERRKISLFCNVPMSAVIPAL 240 ++++GELKTKPTQHSVKEL+++G+ PDIL+ R+++ +P R KI+LFC+VP AVI A Sbjct: 179 LKAAGELKTKPTQHSVKELRSIGIQPDILVCRSEKPLPPEIREKIALFCDVPPEAVISAP 238 Query: 241 DVDDIYKVPLSYHREGI 257 DVD+IY+VPL ++G+ Sbjct: 239 DVDNIYEVPLLLEQQGL 255 >gnl|CDD|153217 cd01746, GATase1_CTP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase. Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase (CTP). CTP is involved in pyrimidine ribonucleotide/ribonucleoside metabolism. CTPs produce CTP from UTP and glutamine and regulate intracellular CTP levels through interactions with four ribonucleotide triphosphates. The enzyme exists as a dimer of identical chains that aggregates as a tetramer. CTP is derived form UTP in three separate steps involving two active sites. In one active site, the UTP O4 oxygen is activated by Mg-ATP-dependent phosphorylation, followed by displacement of the resulting 4-phosphate moiety by ammonia. At a separate site, ammonia is generated via rate limiting glutamine hydrolysis (glutaminase) activity. A gated channel that spans between the glutamine hydrolysis and amidoligase active sites provides a path for ammonia diffusion. CTPs belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 235 Score = 360 bits (926), Expect = e-100 Identities = 138/244 (56%), Positives = 174/244 (71%), Gaps = 10/244 (4%) Query: 292 VKVAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGIL 351 V++A+VGKY+ L DAY S++EAL+H+G++ K+++ WID+E LE+E+ + G GIL Sbjct: 1 VRIALVGKYVELPDAYLSVLEALKHAGIALGVKLEIKWIDSEDLEEENAEEALKGADGIL 60 Query: 352 VPGGFGKRGSEGKIAAIKFARENKIPFLGICFGMQMAVIEAARNLAGIPNACSTEF-SEA 410 VPGGFG RG EGKI AIK+AREN IPFLGIC GMQ+AVIE ARN+ G+P+A STEF + Sbjct: 61 VPGGFGIRGVEGKILAIKYARENNIPFLGICLGMQLAVIEFARNVLGLPDANSTEFDPDT 120 Query: 411 GVPVIALMSEWMKGDQQEKRLPSDDLGATMRLGAYDVSLKEETLISRIYGLDLIPERHRH 470 PV+ LM E Q+ DLG TMRLGAY V LK TL + YG D + ERHRH Sbjct: 121 PHPVVDLMPE-----QKGV----KDLGGTMRLGAYPVILKPGTLAHKYYGKDEVEERHRH 171 Query: 471 RYEVNVRYREKLEGCGLKFSGFSVDHALPEVVEYINHPWFIGVQYHPELKSRPLDPHPLF 530 RYEVN Y ++LE GL+FSG D L E+VE +HP+F+G Q+HPE KSRPL PHPLF Sbjct: 172 RYEVNPEYVDELEEAGLRFSGTDPDGGLVEIVELPDHPFFVGTQFHPEFKSRPLKPHPLF 231 Query: 531 VSFI 534 V F+ Sbjct: 232 VGFV 235 >gnl|CDD|143892 pfam00117, GATase, Glutamine amidotransferase class-I. Length = 187 Score = 125 bits (317), Expect = 2e-29 Identities = 55/237 (23%), Positives = 77/237 (32%), Gaps = 52/237 (21%) Query: 302 HLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVPGGFGKRGS 361 L D S L + +V++ D E + GI++ G G G Sbjct: 1 LLIDNGDSFTYNLARALRELGVEVEVVPNDTPAEE----ILELLNPDGIIISPGPGSPGD 56 Query: 362 -EGKIAAIKFARENKIPFLGICFGMQMAVIEAARNLAGIPNACSTEFSEAGVPVIALMSE 420 G I AIK RENKIP LGIC G Q+ + VI Sbjct: 57 AGGAIEAIKELRENKIPILGICLGHQLLALAFGG------------------KVI----- 93 Query: 421 WMKGDQQEKRLPSDDLGATMRLGAYDVSLKEETLISRIYGL-DLIPERHRHRYEVNVRYR 479 + G +G YGL ++ R H Y V+ Sbjct: 94 ---------KAKEPHHGKNSPVGHDK---------GLFYGLPNVFIVRRYHSYAVD---- 131 Query: 480 EKLEGCGLKFSGFSVDHALPEVVEYINHPWFIGVQYHPELKSRPLDPHPLFVSFIQA 536 GL+ + S + + + +P GVQ+HPE P P LF I+ Sbjct: 132 PDTLPDGLEVTAASDNGGEIMAIRHKENP-IFGVQFHPESSLTPGGPELLFNFLIKL 187 >gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain. Type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to Class I glutamine amidotransferases, the intracellular PH1704 from Pyrococcus horikoshii, the C-terminal of the large catalase: Escherichia coli HP-II, Sinorhizobium meliloti Rm1021 ThuA. and, the A4 beta-galactosidase middle domain. The majority of proteins in this group have a reactive Cys found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For Class I glutamine amidotransferases proteins which transfer ammonia from the amide side chain of glutamine to an acceptor substrate, this Cys forms a Cys-His-Glu catalytic triad in the active site. Glutamine amidotransferases activity can be found in a range of biosynthetic enzymes included in this cd: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase, anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. For Pyrococcus horikoshii PH1704, the Cys of the nucleophile elbow together with a different His and, a Glu from an adjacent monomer form a catalytic triad different from the typical GATase1 triad. The E. coli HP-II C-terminal domain, S. meliloti Rm1021 ThuA and the A4 beta-galactosidase middle domain lack the catalytic triad typical GATaseI domains. GATase1-like domains can occur either as single polypeptides, as in Class I glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Length = 115 Score = 59.1 bits (143), Expect = 3e-09 Identities = 26/101 (25%), Positives = 46/101 (45%), Gaps = 11/101 (10%) Query: 294 VAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVP 353 VA++ + S ++ALR +G +V + D +E + + + G+++P Sbjct: 1 VAVLLFPGFEELELASPLDALREAGA----EVDVVSPDGGPVESDVDLDDY---DGLILP 53 Query: 354 GGFG----KRGSEGKIAAIKFARENKIPFLGICFGMQMAVI 390 GG G E +A ++ A P LGIC G Q+ V+ Sbjct: 54 GGPGTPDDLARDEALLALLREAAAAGKPILGICLGAQLLVL 94 >gnl|CDD|32254 COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only]. Length = 243 Score = 56.5 bits (136), Expect = 2e-08 Identities = 44/215 (20%), Positives = 74/215 (34%), Gaps = 51/215 (23%) Query: 347 VHGILVPGG-------FGKRGSEGK-----------IAAIKFARENKIPFLGICFGMQMA 388 + G+++ GG +G+ SE +A I+ A E IP LGIC G+Q+ Sbjct: 61 IDGLILTGGSNVDPSLYGEEPSEKDGPYDPERDAFELALIRAALERGIPILGICRGLQLL 120 Query: 389 VIEAARNLAGIPNACSTEFSEAGVPVIALMSEWMKGDQQEKRLPSDDLGATMRLGAYDVS 448 + L + SE + + V Sbjct: 121 NVALGGTLY-------QDISE----QPGHIDHRQPNPVHIESHE--------------VH 155 Query: 449 LKEETLISRIYGLDLIPERHRHRYEVNVRYREKLEGCGLKFSGFSVDHALPEVVEYINHP 508 ++ + +++I G H + +KL GL + D E VE N Sbjct: 156 IEPGSKLAKILGESEFMVNSFHHQAI-----KKL-APGLVVEARAPD-GTVEAVEVKNDA 208 Query: 509 WFIGVQYHPELKSRPLDP-HPLFVSFIQATVLYSQ 542 + +GVQ+HPE LF +F+ A ++ Sbjct: 209 FVLGVQWHPEYLVDTNPLSLALFEAFVNACKKHAA 243 >gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain. Type 1 glutamine amidotransferase (GATase1)-like domain. This group contains proteins similar to Class I glutamine amidotransferases, the intracellular PH1704 from Pyrococcus horikoshii, the C-terminal of the large catalase: Escherichia coli HP-II, Sinorhizobium meliloti Rm1021 ThuA, the A4 beta-galactosidase middle domain and peptidase E. The majority of proteins in this group have a reactive Cys found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For Class I glutamine amidotransferases proteins which transfer ammonia from the amide side chain of glutamine to an acceptor substrate, this Cys forms a Cys-His-Glu catalytic triad in the active site. Glutamine amidotransferases activity can be found in a range of biosynthetic enzymes included in this cd: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase, anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase (CPSase), cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. For Pyrococcus horikoshii PH1704, the Cys of the nucleophile elbow together with a different His and, a Glu from an adjacent monomer form a catalytic triad different from the typical GATase1 triad. Peptidase E is believed to be a serine peptidase having a Ser-His-Glu catalytic triad which differs from the Cys-His-Glu catalytic triad of typical GATase1 domains, by having a Ser in place of the reactive Cys at the nucleophile elbow. The E. coli HP-II C-terminal domain, S. meliloti Rm1021 ThuA and the A4 beta-galactosidase middle domain lack the catalytic triad typical GATaseI domains. GATase1-like domains can occur either as single polypeptides, as in Class I glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Peptidase E has a circular permutation in the common core of a typical GTAse1 domain. Length = 92 Score = 54.5 bits (131), Expect = 6e-08 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 11/98 (11%) Query: 294 VAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVP 353 VA++ + S ++ALR +G +V + D +E + + + G+++P Sbjct: 1 VAVLLFGGSEELELASPLDALREAGA----EVDVVSPDGGPVESDVDLDDY---DGLILP 53 Query: 354 GGFG----KRGSEGKIAAIKFARENKIPFLGICFGMQM 387 GG G E +A ++ A P LGIC G Q+ Sbjct: 54 GGPGTPDDLAWDEALLALLREAAAAGKPVLGICLGAQL 91 >gnl|CDD|153219 cd01748, GATase1_IGP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS). Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS). IGPS incorporates ammonia derived from glutamine into N1-[(5'-phosphoribulosyl)-formimino]-5-aminoimidazole-4- carboxamide ribonucleotide (PRFAR) to form 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR) and imidazole glycerol phosphate (IGP). The glutamine amidotransferase domain generates the ammonia nucleophile which is channeled from the glutaminase active site to the PRFAR active site. IGPS belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 198 Score = 37.5 bits (88), Expect = 0.010 Identities = 28/86 (32%), Positives = 39/86 (45%), Gaps = 20/86 (23%) Query: 308 RSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVPG-G-FG----KRGS 361 RS+ AL G +V ++ D E + D +++PG G FG Sbjct: 12 RSVANALERLGA----EVIIT-SDPEEILSAD---------KLILPGVGAFGDAMANLRE 57 Query: 362 EGKIAAIKFARENKIPFLGICFGMQM 387 G I A+K A + PFLGIC GMQ+ Sbjct: 58 RGLIEALKEAIASGKPFLGICLGMQL 83 >gnl|CDD|153212 cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Length = 188 Score = 36.5 bits (85), Expect = 0.020 Identities = 9/23 (39%), Positives = 11/23 (47%) Query: 365 IAAIKFARENKIPFLGICFGMQM 387 I+ A P LGIC G Q+ Sbjct: 71 KELIRQALAAGKPVLGICLGHQL 93 >gnl|CDD|30467 COG0118, HisH, Glutamine amidotransferase [Amino acid transport and metabolism]. Length = 204 Score = 36.3 bits (84), Expect = 0.023 Identities = 30/89 (33%), Positives = 41/89 (46%), Gaps = 26/89 (29%) Query: 308 RSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVPG---------GFGK 358 RS+ +AL G +V +S D E + K D +++PG + Sbjct: 15 RSVKKALERLGA----EVVVS-RDPEEILKAD---------KLILPGVGAFGAAMANLRE 60 Query: 359 RGSEGKIAAIKFARENKIPFLGICFGMQM 387 RG I AIK A E+ PFLGIC GMQ+ Sbjct: 61 RGL---IEAIKEAVESGKPFLGICLGMQL 86 >gnl|CDD|153216 cd01745, GATase1_2, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Length = 189 Score = 35.6 bits (83), Expect = 0.038 Identities = 11/23 (47%), Positives = 15/23 (65%) Query: 365 IAAIKFARENKIPFLGICFGMQM 387 +A ++ A E P LGIC GMQ+ Sbjct: 90 LALLRAALERGKPILGICRGMQL 112 Score = 32.9 bits (76), Expect = 0.23 Identities = 9/19 (47%), Positives = 14/19 (73%) Query: 500 EVVEYINHPWFIGVQYHPE 518 E +E + P+ +GVQ+HPE Sbjct: 154 EAIESPDRPFVLGVQWHPE 172 >gnl|CDD|30396 COG0047, PurL, Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism]. Length = 231 Score = 35.1 bits (81), Expect = 0.055 Identities = 26/90 (28%), Positives = 36/90 (40%), Gaps = 23/90 (25%) Query: 308 RSLIEALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVPGGF--GKRGSEGKI 365 + A +G + W + L D G+++PGGF G G I Sbjct: 17 YDMAAAFERAGFE----AEDVWHS-DLLLGRD-------FDGVVLPGGFSYGDYLRAGAI 64 Query: 366 AAI--------KFARENKIPFLGICFGMQM 387 AAI +FA + K P LGIC G Q+ Sbjct: 65 AAIAPVMDEVREFAEKGK-PVLGICNGFQI 93 >gnl|CDD|30851 COG0505, CarA, Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism]. Length = 368 Score = 32.9 bits (75), Expect = 0.22 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 499 PEVVEYINHPWFIGVQYHPELKSRPLDPHPLFVSFIQ 535 E + + + P F VQYHPE P D LF FI+ Sbjct: 325 VEGIRHKDLPAF-SVQYHPEASPGPHDTRYLFDEFIE 360 Score = 32.1 bits (73), Expect = 0.39 Identities = 18/59 (30%), Positives = 22/59 (37%), Gaps = 10/59 (16%) Query: 331 DAETLEKEDPVKHFYGVHGILVPGGFG--KRGSEGKIAAIKFARENKIPFLGICFGMQM 387 AE + +P GI + G G I IK KIP GIC G Q+ Sbjct: 212 SAEEILALNP-------DGIFLSNGPGDPAPLDYA-IETIKELLGTKIPIFGICLGHQL 262 >gnl|CDD|145019 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain. This family consists of various cobyrinic acid a,c-diamide synthases. These include CbiA and CbiP from S.typhimurium, and CobQ from R. capsulatus. These amidases catalyse amidations to various side chains of hydrogenobyrinic acid or cobyrinic acid a,c-diamide in the biosynthesis of cobalamin (vitamin B12) from uroporphyrinogen III. Vitamin B12 is an important cofactor and an essential nutrient for many plants and animals and is primarily produced by bacteria. The family also contains dethiobiotin synthetases as well as the plasmid partitioning proteins of the MinD/ParA family. Length = 212 Score = 32.0 bits (73), Expect = 0.37 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Query: 5 IFIT---GGVVSSLGKGVAAASLGALLQAHKYKVRVRKLDPYLNSDPGTMSPVQHGEVFV 61 I I GGV GK AA+L L Y+V + LDP N +V Sbjct: 1 IAIAGTKGGV----GKTTLAANLARALAKRGYRVLLIDLDPQANLTSSLGKGPDLIDVLK 56 Query: 62 TDD 64 Sbjct: 57 EGL 59 >gnl|CDD|153213 cd01742, GATase1_GMP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase. Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase. GMP synthetase is a glutamine amidotransferase from the de novo purine biosynthetic pathway. Glutamine amidotransferase (GATase) activity catalyse the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. GMP synthetase catalyses the amination of the nucleotide precursor xanthosine 5'-monophospahte to form GMP. GMP synthetase belongs to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 181 Score = 32.1 bits (74), Expect = 0.44 Identities = 9/15 (60%), Positives = 12/15 (80%) Query: 373 ENKIPFLGICFGMQM 387 E +P LGIC+GMQ+ Sbjct: 68 ELGVPVLGICYGMQL 82 >gnl|CDD|109901 pfam00863, Peptidase_C4, Peptidase family C4. This peptidase is present in the nuclear inclusion protein of potyviruses. Length = 233 Score = 31.8 bits (73), Expect = 0.51 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 8/49 (16%) Query: 182 RSSGELKTKPTQH---SVKELQALGVHP----DILLIRADRDIPEMERR 223 R++G L + +QH +VK L VHP DI++IR +D P ++ Sbjct: 50 RNNGTLTIR-SQHGEFTVKNTTQLKVHPIEGRDIVIIRLPKDFPPFPQK 97 >gnl|CDD|153215 cd01744, GATase1_CPSase, Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II. This group of sequences represents the small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II. CPSase II catalyzes the production of carbomyl phosphate (CP) from bicarbonate, glutamine and two molecules of MgATP. The reaction is believed to proceed by a series of four biochemical reactions involving a minimum of three discrete highly reactive intermediates. The synthesis of CP is critical for the initiation of two separate biosynthetic pathways. In one CP is coupled to aspartate, its carbon and nitrogen nuclei ultimately incorporated into the aromatic moieties of pyrimidine nucleotides. In the second pathway CP is condensed with ornithine at the start of the urea cycle and is utilized for the detoxification of ammonia and biosynthesis of arginine. CPSases may be encoded by one or by several genes, depending on the species. The E.coli enzyme is a heterodimer consisting of two polypeptide chains referred to as the small and large subunit. Ammonia an intermediate during the biosynthesis of carbomyl phosphate produced by the hydrolysis of glutamine in the small subunit of the enzyme is delivered via a molecular tunnel between the remotely located carboxyphosphate active site in the large subunit. CPSase IIs belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. This group also contains the sequence from the mammalian urea cycle form which has lost the active site Cys, resulting in an ammonia-dependent form, CPSase I. Length = 178 Score = 31.7 bits (73), Expect = 0.54 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 17/60 (28%) Query: 491 GFSVDHA-LPEVVE--YIN-------------HPWFIGVQYHPELKSRPLDPHPLFVSFI 534 G++VD LP +E ++N P F VQ+HPE P D LF F+ Sbjct: 120 GYAVDPDSLPGGLEVTHVNLNDGTVEGIRHKDLPVF-SVQFHPEASPGPHDTEYLFDEFL 178 >gnl|CDD|153211 cd01740, GATase1_FGAR_AT, Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase. Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase (FGAR-AT). FGAR-AT catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to formylglycinamidine ribonucleotide (FGAM), ADP, Pi, and glutamate in the fourth step of the purine biosynthetic pathway. FGAR-AT is a glutamine amidotransferase. Glutamine amidotransferase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. FGAR-AT belongs to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 238 Score = 31.4 bits (72), Expect = 0.65 Identities = 22/87 (25%), Positives = 35/87 (40%), Gaps = 22/87 (25%) Query: 313 ALRHSGVSNYTKVQLSWIDAETLEKEDPVKHFYGVHGILVPGGF--GKR-GSEGKIAA-- 367 A +G + + W + + L + + G+++PGGF G + G IAA Sbjct: 18 AFELAGF----EAEDVWHN-DLLAGRKDLDDY---DGVVLPGGFSYGDYLRA-GAIAAAS 68 Query: 368 -------IKFARENKIPFLGICFGMQM 387 +FA LGIC G Q+ Sbjct: 69 PLLMEEVKEFAERGG-LVLGICNGFQI 94 >gnl|CDD|58169 cd03522, MoeA_like, MoeA_like. This domain is similar to a domain found in a variety of proteins involved in biosynthesis of molybdopterin cofactor, like MoaB, MogA, and MoeA. There this domain is presumed to bind molybdopterin. The exact function of this subgroup is unknown.. Length = 312 Score = 31.3 bits (71), Expect = 0.70 Identities = 25/109 (22%), Positives = 37/109 (33%), Gaps = 11/109 (10%) Query: 76 ERFMGISTAKADNITAGRIYKNVIDRERRGDYLGTTVQVIPHVTNEIKEFITQGNEDADF 135 E + G K + R+ G L ++PH I I + E Sbjct: 170 EVYGGRIEDKFGPVLRARL-------AALGVEL-VEQVIVPHDEAAIAAAIAEALEAGAE 221 Query: 136 VICEIGGTIGDIE-VMPFVEAIRQFGNEFSHRGSKALYIHLTLMPYIRS 183 ++ GG D + V P AIR G E G +L L+ Y+ Sbjct: 222 LLILTGGASVDPDDVTP--AAIRAAGGEVIRYGMPVDPGNLLLLGYLGG 268 >gnl|CDD|153221 cd01750, GATase1_CobQ, Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ). Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ). CobQ plays a role in cobalamin biosythesis. CobQ catalyses amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide in the biosynthesis of cobalamin. CobQ belongs to the triad family of amidotransferases. Two of the three residues of the catalytic triad that are involved in glutamine binding, hydrolysis and transfer of the resulting ammonia to the acceptor substrate in other triad aminodotransferases are conserved in CobQ. Length = 194 Score = 31.1 bits (71), Expect = 0.78 Identities = 11/21 (52%), Positives = 11/21 (52%) Query: 367 AIKFARENKIPFLGICFGMQM 387 AIK P LGIC G QM Sbjct: 64 AIKNYARAGGPVLGICGGYQM 84 >gnl|CDD|153218 cd01747, GATase1_Glutamyl_Hydrolase, Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. gamma-Glutamyl Hydrolase catalyzes the cleavage of the gamma-glutamyl chain of folylpoly-gamma-glutamyl substrates and is a central enzyme in folyl and antifolyl poly-gamma-glutamate metabolism. GATase activity involves the removal of the ammonia group from a glutamate molecule and its subsequent transfer to a specific substrate, thus creating a new carbon-nitrogen group on the substrate. gamma-Glutamyl hydrolases belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 273 Score = 30.8 bits (70), Expect = 1.0 Identities = 44/193 (22%), Positives = 63/193 (32%), Gaps = 55/193 (28%) Query: 347 VHGILVPGG--FGKRGSEGKIAAIKF--ARENKI-----PFLGICFGMQMAVIEAARNLA 397 ++GIL PGG + A I + A E P G C G ++ + Sbjct: 55 INGILFPGGAVDIDTSGYARTAKIIYNLALERNDAGDYFPVWGTCLGFELLTYLTSGETL 114 Query: 398 GIPNACSTEFSEAGVPVIALMSEWMKGDQQE----KRLPSDDLGATMRLGAYDVSLKEET 453 + +T + + D + KR P D L SL E Sbjct: 115 LLEATEATNSA---------LPLNFTEDALQSRLFKRFPPDLL----------KSLATEP 155 Query: 454 LISRIYGLDLIPERHRHRYEVNVRYREKLEGCGLKFSGFSV-----DHALPE---VVEYI 505 L + HRY ++ E GL F+V D E VE Sbjct: 156 LTM-----------NNHRYGIS---PENFTENGLLSDFFNVLTTNDDWNGVEFISTVEAY 201 Query: 506 NHPWFIGVQYHPE 518 +P + GVQ+HPE Sbjct: 202 KYPIY-GVQWHPE 213 >gnl|CDD|133630 CHL00188, hisH, imidazole glycerol phosphate synthase subunit hisH; Provisional. Length = 210 Score = 30.6 bits (69), Expect = 1.2 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 6/47 (12%) Query: 347 VHGILVPG------GFGKRGSEGKIAAIKFARENKIPFLGICFGMQM 387 VH +++PG K +G I IK PF+GIC G+ + Sbjct: 40 VHALVLPGVGSFDLAMKKLEKKGLITPIKKWIAEGNPFIGICLGLHL 86 >gnl|CDD|164573 CHL00197, carA, carbamoyl-phosphate synthase arginine-specific small subunit; Provisional. Length = 382 Score = 30.1 bits (68), Expect = 1.8 Identities = 12/26 (46%), Positives = 14/26 (53%) Query: 510 FIGVQYHPELKSRPLDPHPLFVSFIQ 535 + VQYHPE P D LF FI+ Sbjct: 347 YFSVQYHPEASPGPHDADYLFEYFIE 372 >gnl|CDD|36772 KOG1559, KOG1559, KOG1559, Gamma-glutamyl hydrolase [Coenzyme transport and metabolism]. Length = 340 Score = 30.0 bits (67), Expect = 1.9 Identities = 15/68 (22%), Positives = 29/68 (42%), Gaps = 7/68 (10%) Query: 335 LEKEDPVKHFYGVHGILVPGGFGKRGSEGKIAAIKFARE-------NKIPFLGICFGMQM 387 +E + V+G++ GG+ KRG ++ F + P GIC G ++ Sbjct: 100 EPEEILFQKLELVNGVIFTGGWAKRGDYFEVVKKIFNKVLERNDAGEHFPVYGICLGFEL 159 Query: 388 AVIEAARN 395 + ++N Sbjct: 160 LSMIISQN 167 >gnl|CDD|34896 COG5308, NUP170, Nuclear pore complex subunit [Intracellular trafficking and secretion]. Length = 1263 Score = 29.6 bits (66), Expect = 2.3 Identities = 19/75 (25%), Positives = 32/75 (42%), Gaps = 7/75 (9%) Query: 183 SSGELKTKPTQ--HSVKE-LQALGVHPDIL-LIRADRDIPEMERRKISLFCNVPMSAVIP 238 K Q + VKE L+ + DIL L+R D I +R ++S + ++ Sbjct: 1021 VPNSQKHVNVQLFNEVKERLEVASIQDDILRLVRVDPRIDNNKREELSKQLD---GEILS 1077 Query: 239 ALDVDDIYKVPLSYH 253 ++ + Y PL Y Sbjct: 1078 LSELFNDYADPLKYP 1092 >gnl|CDD|153214 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase. Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase (ASase). This group contains proteins similar to para-aminobenzoate (PABA) synthase and ASase. These enzymes catalyze similar reactions and produce similar products, PABA and ortho-aminobenzoate (anthranilate). Each enzyme is composed of non-identical subunits: a glutamine amidotransferase subunit (component II) and a subunit that produces an aminobenzoate products (component I). ASase catalyses the synthesis of anthranilate from chorismate and glutamine and is a tetrameric protein comprising two copies each of components I and II. Component II of ASase belongs to the family of triad GTases which hydrolyze glutamine and transfer nascent ammonia between the active sites. In some bacteria, such as Escherichia coli, component II can be much larger than in other organisms, due to the presence of phosphoribosyl-anthranilate transferase (PRTase) activity. PRTase catalyses the second step in tryptophan biosynthesis and results in the addition of 5-phosphoribosyl-1-pyrophosphate to anthranilate to create N-5'-phosphoribosyl-anthranilate. In E.coli, the first step in the conversion of chorismate to PABA involves two proteins: PabA and PabB which co-operate to transfer the amide nitrogen of glutamine to chorismate forming 4-amino-4 deoxychorismate (ADC). PabA acts as a glutamine amidotransferase, supplying an amino group to PabB, which carries out the amination reaction. A third protein PabC then mediates elimination of pyruvate and aromatization to give PABA. Several organisms have bipartite proteins containing fused domains homologous to PabA and PabB commonly called PABA synthases. These hybrid PABA synthases may produce ADC and not PABA. Length = 184 Score = 29.4 bits (67), Expect = 2.8 Identities = 7/13 (53%), Positives = 9/13 (69%) Query: 374 NKIPFLGICFGMQ 386 K+P LG+C G Q Sbjct: 70 GKVPILGVCLGHQ 82 >gnl|CDD|146753 pfam04281, Tom22, Mitochondrial import receptor subunit Tom22. The mitochondrial protein translocase family, which is responsible for movement of nuclear encoded pre-proteins into mitochondria, is very complex with at least 19 components. These proteins include several chaperone proteins, four proteins of the outer membrane translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family represents the Tom22 proteins. The N terminal region of Tom22 has been shown to have chaperone-like activity, and the C terminal region faces the intermembrane face. Length = 136 Score = 29.1 bits (66), Expect = 3.5 Identities = 10/27 (37%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Query: 446 DVSLKEETLISRIYGL-DLIPERHRHR 471 D + ETL RI L D++P R + Sbjct: 44 DSDFENETLYDRIVALKDIVPPTTRRK 70 >gnl|CDD|30864 COG0518, GuaA, GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism]. Length = 198 Score = 28.3 bits (63), Expect = 5.1 Identities = 10/23 (43%), Positives = 11/23 (47%) Query: 365 IAAIKFARENKIPFLGICFGMQM 387 IK A P LGIC G Q+ Sbjct: 69 KDLIKDAGVPGKPVLGICLGHQL 91 >gnl|CDD|34707 COG5104, PRP40, Splicing factor [RNA processing and modification]. Length = 590 Score = 28.2 bits (62), Expect = 5.2 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Query: 286 LSLKNEVKVAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLSWIDAETLEKEDP 340 LS E K A H +D +R+L+ L G Y ++ W +A L K+DP Sbjct: 345 LSAIEERKAAAAQNARHHRDEFRTLLRKLYSEGKIYY---RMKWKNAYPLIKDDP 396 >gnl|CDD|35591 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only]. Length = 1435 Score = 28.4 bits (63), Expect = 5.4 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Query: 500 EVVEYINHPWFIGVQYHPELKSRPLDPHPLFVSFIQATVLYSQSL 544 E + + + P+F VQ+HPE P D LF FI+ + Sbjct: 316 EGIMHSSKPFF-SVQFHPEATPGPHDTEYLFDVFIELVKKSKSTP 359 >gnl|CDD|36835 KOG1622, KOG1622, KOG1622, GMP synthase [Nucleotide transport and metabolism]. Length = 552 Score = 28.4 bits (63), Expect = 5.8 Identities = 8/13 (61%), Positives = 11/13 (84%) Query: 375 KIPFLGICFGMQM 387 +P LGIC+GMQ+ Sbjct: 88 GVPVLGICYGMQL 100 >gnl|CDD|37025 KOG1814, KOG1814, KOG1814, Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]. Length = 445 Score = 28.1 bits (62), Expect = 6.8 Identities = 10/16 (62%), Positives = 11/16 (68%) Query: 329 WIDAETLEKEDPVKHF 344 WI AE L E+P KHF Sbjct: 398 WICAELLYPENPYKHF 413 >gnl|CDD|30858 COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism]. Length = 191 Score = 27.8 bits (62), Expect = 7.6 Identities = 15/58 (25%), Positives = 21/58 (36%), Gaps = 7/58 (12%) Query: 330 IDAETLEKEDPVKHFYGVHGILVPGGFGKRGSEGKIAAIKFARENKIPFLGICFGMQM 387 I E +E P I++ G G G + +IP LG+C G Q Sbjct: 36 ISLELIEALKP-------DAIVISPGPGTPKDAGISLELIRRFAGRIPILGVCLGHQA 86 >gnl|CDD|38569 KOG3359, KOG3359, KOG3359, Dolichyl-phosphate-mannose:protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones]. Length = 723 Score = 27.5 bits (61), Expect = 8.3 Identities = 20/83 (24%), Positives = 25/83 (30%), Gaps = 16/83 (19%) Query: 465 PERHRHRYEVNVRYREKLEGCGLKFSGFSVDHALP-------EVV--EYINHP---WFIG 512 + R L GC LK SG LP EVV + W + Sbjct: 442 DQERIKTLTTEFRLIHVLTGCYLKSSGKK----LPEWGFEQQEVVCAKNPRDKSTTWNVE 497 Query: 513 VQYHPELKSRPLDPHPLFVSFIQ 535 +P L R D +SF Sbjct: 498 EHENPRLPERERDIVYPKLSFWA 520 >gnl|CDD|37236 KOG2025, KOG2025, KOG2025, Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics, Cell cycle control, cell division, chromosome partitioning]. Length = 892 Score = 27.7 bits (61), Expect = 9.0 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Query: 283 DRTLSLKNEVKVAIVGKYIHLKDAYRSLIEALRHSGVSNYTKVQLSWIDA 332 DR S+K + AI+ ++ D +++E L VSN ++V + ++A Sbjct: 241 DREFSVKGALVDAILSGWLRFSDG--NILELLERLDVSNSSEVAVKALEA 288 >gnl|CDD|34530 COG4921, COG4921, Uncharacterized protein conserved in archaea [Function unknown]. Length = 131 Score = 27.6 bits (61), Expect = 9.0 Identities = 20/99 (20%), Positives = 35/99 (35%), Gaps = 12/99 (12%) Query: 73 GHYERFMGIS-TAKADNITAGRIYKNVIDRERRGDYLGTTVQVIPHVTNEIKEFITQGNE 131 GHY +S ADNI R + R L V+ E+ + ++ Sbjct: 17 GHYRVTACVSAEVDADNIFTVRDVNVFVVCTREPPNLRDLVE-------EVSRALNGLDK 69 Query: 132 DADFVICEIGGTIGDIEVMPFVEAIRQFGNEFSHRGSKA 170 + + ++ E G + E A+ G F + + A Sbjct: 70 EDEMIVAEPGEFFNEPEWRV--SAL--LGAPFKYAETVA 104 >gnl|CDD|31681 COG1492, CobQ, Cobyric acid synthase [Coenzyme metabolism]. Length = 486 Score = 27.5 bits (61), Expect = 9.7 Identities = 13/41 (31%), Positives = 17/41 (41%), Gaps = 12/41 (29%) Query: 359 RGSEGKIAAIKFARENKI------------PFLGICFGMQM 387 GS+ IA +K RE + +GIC G QM Sbjct: 297 PGSKNTIADLKILREGGMDEKILEYARKGGDVIGICGGYQM 337 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.139 0.412 Gapped Lambda K H 0.267 0.0762 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 6,858,860 Number of extensions: 384204 Number of successful extensions: 1024 Number of sequences better than 10.0: 1 Number of HSP's gapped: 999 Number of HSP's successfully gapped: 49 Length of query: 544 Length of database: 6,263,737 Length adjustment: 99 Effective length of query: 445 Effective length of database: 4,124,446 Effective search space: 1835378470 Effective search space used: 1835378470 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 60 (26.8 bits)