Query         gi|254780196|ref|YP_003064609.1| hypothetical protein CLIBASIA_00405 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 125
No_of_seqs    126 out of 939
Neff          5.3 
Searched_HMMs 13730
Date          Mon May 23 13:00:34 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780196.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d2axti1 f.23.37.1 (I:1-35) Pho  28.8      13 0.00097   13.9   4.2   28   47-74      4-31  (35)
  2 d1m56d_ f.23.8.1 (D:) Bacteria  12.9      32  0.0023   12.0   4.2   25   44-68     17-41  (42)
  3 d1qled_ f.23.8.1 (D:) Bacteria  11.5      35  0.0026   11.8   4.0   25   44-68     18-42  (43)
  4 d1fftb2 f.17.2.1 (B:27-117) Cy   3.3 1.2E+02  0.0086    9.2   0.5   30   40-69     12-41  (91)
  5 d1v54j_ f.23.4.1 (J:) Mitochon   2.9 1.4E+02    0.01    8.9   4.8   32   39-70     23-55  (58)
  6 d1vf5c3 f.23.23.1 (C:250-286)    2.5 1.7E+02   0.012    8.5   2.4   13   47-59      4-16  (37)
  7 d1mg7a2 d.58.26.6 (A:188-380)    2.4 1.7E+02   0.012    8.4   0.1   24   23-46    108-132 (193)
  8 d1h72c1 d.14.1.5 (C:5-167) Hom   2.3 1.4E+02    0.01    8.8  -0.5   10   27-36     88-97  (163)
  9 d1ppjd2 f.23.11.1 (D:196-241)    2.3 1.8E+02   0.013    8.3   2.9   23   48-70      7-29  (46)
 10 d2e74e1 f.23.24.1 (E:1-32) Pet   2.3 1.8E+02   0.013    8.3   3.1   19    2-20      8-26  (32)

No 1  
>d2axti1 f.23.37.1 (I:1-35) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 146786]}
Probab=28.80  E-value=13  Score=13.88  Aligned_cols=28  Identities=18%  Similarity=0.317  Sum_probs=22.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             9999999999999999999972667776
Q gi|254780196|r   47 GRFTAILAFFFFATSIALGMISRYTSTR   74 (125)
Q Consensus        47 ~k~T~~la~~F~~~sl~l~~~s~~~~~~   74 (125)
                      -|+.....++||+.-+..+++++..+..
T Consensus         4 LKi~Vy~vV~fFv~lFiFGFLSnDP~Rn   31 (35)
T d2axti1           4 LKITVYIVVTFFVLLFVFGFLSGDPARN   31 (35)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTTCTTCS
T ss_pred             EEEEHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             8874166899999999986305899889


No 2  
>d1m56d_ f.23.8.1 (D:) Bacterial aa3 type cytochrome c oxidase subunit IV {Rhodobacter sphaeroides [TaxId: 1063]}
Probab=12.95  E-value=32  Score=12.04  Aligned_cols=25  Identities=20%  Similarity=0.214  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6899999999999999999999972
Q gi|254780196|r   44 HSLGRFTAILAFFFFATSIALGMIS   68 (125)
Q Consensus        44 ~~L~k~T~~la~~F~~~sl~l~~~s   68 (125)
                      +..-|+|.|.+++-.+..+.|++++
T Consensus        17 ~gFik~~t~~~i~~i~~liflAi~n   41 (42)
T d1m56d_          17 AGFVRMVTWAAVVIVAALIFLALAN   41 (42)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             9999999999999999999999963


No 3  
>d1qled_ f.23.8.1 (D:) Bacterial aa3 type cytochrome c oxidase subunit IV {Paracoccus denitrificans [TaxId: 266]}
Probab=11.54  E-value=35  Score=11.81  Aligned_cols=25  Identities=8%  Similarity=0.090  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6899999999999999999999972
Q gi|254780196|r   44 HSLGRFTAILAFFFFATSIALGMIS   68 (125)
Q Consensus        44 ~~L~k~T~~la~~F~~~sl~l~~~s   68 (125)
                      +..-|++.|.+++-.+..+.|++++
T Consensus        18 ~gFi~~~t~~~i~~i~~liflAi~n   42 (43)
T d1qled_          18 AGFIKGATWVSILSIAVLVFLALAN   42 (43)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             9999999999999999999999962


No 4  
>d1fftb2 f.17.2.1 (B:27-117) Cytochrome O ubiquinol oxidase, subunit II {Escherichia coli [TaxId: 562]}
Probab=3.28  E-value=1.2e+02  Score=9.22  Aligned_cols=30  Identities=0%  Similarity=-0.113  Sum_probs=18.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             656668999999999999999999999726
Q gi|254780196|r   40 RSTAHSLGRFTAILAFFFFATSIALGMISR   69 (125)
Q Consensus        40 ~g~~~~L~k~T~~la~~F~~~sl~l~~~s~   69 (125)
                      +...|.+.-..++++++|++....+.|+.-
T Consensus        12 ~~i~~L~~~~~~i~~iv~v~V~~~~~~~~~   41 (91)
T d1fftb2          12 LEQRSLILTAFGLMLIVVIPAILMAVGFAW   41 (91)
T ss_dssp             HHHHHHHHHHHHHTTTTTTHHHHHHHTTTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHE
T ss_conf             999999999999999999999999976403


No 5  
>d1v54j_ f.23.4.1 (J:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
Probab=2.89  E-value=1.4e+02  Score=8.89  Aligned_cols=32  Identities=19%  Similarity=-0.063  Sum_probs=22.5

Q ss_pred             CCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             665-66689999999999999999999997266
Q gi|254780196|r   39 VRS-TAHSLGRFTAILAFFFFATSIALGMISRY   70 (125)
Q Consensus        39 ~~g-~~~~L~k~T~~la~~F~~~sl~l~~~s~~   70 (125)
                      -+| ....|.|+|+.|.+.=.+-|+..-|.+..
T Consensus        23 KGG~~D~~LYr~Tm~L~~~G~~~s~~~l~~a~~   55 (58)
T d1v54j_          23 KGGATDNILYRVTMTLCLGGTLYSLYCLGWASF   55 (58)
T ss_dssp             TTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTS
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             177401799999999999989999999999857


No 6  
>d1vf5c3 f.23.23.1 (C:250-286) Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]}
Probab=2.48  E-value=1.7e+02  Score=8.50  Aligned_cols=13  Identities=23%  Similarity=0.480  Sum_probs=7.5

Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999999999999
Q gi|254780196|r   47 GRFTAILAFFFFA   59 (125)
Q Consensus        47 ~k~T~~la~~F~~   59 (125)
                      +|+.|.+++++.+
T Consensus         4 ~Rv~gl~~F~~~v   16 (37)
T d1vf5c3           4 NRVKWMIAFICLV   16 (37)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH
T ss_conf             8999999999999


No 7  
>d1mg7a2 d.58.26.6 (A:188-380) Early switch protein XOL-1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
Probab=2.43  E-value=1.7e+02  Score=8.45  Aligned_cols=24  Identities=4%  Similarity=0.055  Sum_probs=8.0

Q ss_pred             CCCCCCCCCCCCC-CCCCCCHHHHH
Q ss_conf             4776442222233-33466566689
Q gi|254780196|r   23 QSSDSSAFGSSSN-FTSVRSTAHSL   46 (125)
Q Consensus        23 Q~~kg~g~G~~~~-~~~~~g~~~~L   46 (125)
                      |...--||--.++ ++-+-....|+
T Consensus       108 ~~e~l~GFEIQQGGiLvvLKK~~F~  132 (193)
T d1mg7a2         108 EHEQVEGFEVQQGGILVALKKDSFF  132 (193)
T ss_dssp             HCTTEEEEEECSSCEEEEEETTGGG
T ss_pred             HHHHCCCEEEECCCEEEEEECCCHH
T ss_conf             2653133587327489999547313


No 8  
>d1h72c1 d.14.1.5 (C:5-167) Homoserine kinase {Archaeon Methanococcus jannaschii [TaxId: 2190]}
Probab=2.35  E-value=1.4e+02  Score=8.82  Aligned_cols=10  Identities=40%  Similarity=0.471  Sum_probs=6.8

Q ss_pred             CCCCCCCCCC
Q ss_conf             4422222333
Q gi|254780196|r   27 SSAFGSSSNF   36 (125)
Q Consensus        27 g~g~G~~~~~   36 (125)
                      |+|+|||++.
T Consensus        88 gaGLGsSSA~   97 (163)
T d1h72c1          88 GSGLGSSAAS   97 (163)
T ss_dssp             TSSSCHHHHH
T ss_pred             CCCCCCCHHH
T ss_conf             5665750788


No 9  
>d1ppjd2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
Probab=2.34  E-value=1.8e+02  Score=8.35  Aligned_cols=23  Identities=4%  Similarity=0.089  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             99999999999999999997266
Q gi|254780196|r   48 RFTAILAFFFFATSIALGMISRY   70 (125)
Q Consensus        48 k~T~~la~~F~~~sl~l~~~s~~   70 (125)
                      |-..+-+++|+..-..+.|+.++
T Consensus         7 K~mG~Kv~~~l~~l~~l~yy~KR   29 (46)
T d1ppjd2           7 KRMGLKMLLMMGLLLPLVYAMKR   29 (46)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99799999999999999999999


No 10 
>d2e74e1 f.23.24.1 (E:1-32) PetL subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
Probab=2.34  E-value=1.8e+02  Score=8.35  Aligned_cols=19  Identities=21%  Similarity=0.502  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q ss_conf             3599899999999999999
Q gi|254780196|r    2 QIFLMVVHLIVVVGLVCVI   20 (125)
Q Consensus         2 ~~~llvi~vi~~~~Li~~V   20 (125)
                      |.+++.++.-+++.+|..+
T Consensus         8 yivfialffgiavgiifai   26 (32)
T d2e74e1           8 YIVFIALFFGIAVGIIFAI   26 (32)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHEEEE
T ss_conf             9999999997886321457


Done!