BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780196|ref|YP_003064609.1| hypothetical protein
CLIBASIA_00405 [Candidatus Liberibacter asiaticus str. psy62]
         (125 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780196|ref|YP_003064609.1| hypothetical protein CLIBASIA_00405 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039873|gb|ACT56669.1| hypothetical protein CLIBASIA_00405 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 125

 Score =  245 bits (626), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 125/125 (100%), Positives = 125/125 (100%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT
Sbjct: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120
           SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS
Sbjct: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120

Query: 121 SSRTK 125
           SSRTK
Sbjct: 121 SSRTK 125


>gi|315122623|ref|YP_004063112.1| hypothetical protein CKC_04375 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496025|gb|ADR52624.1| hypothetical protein CKC_04375 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 126

 Score =  132 bits (332), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/105 (62%), Positives = 85/105 (80%), Gaps = 1/105 (0%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           MQIFLM  HLI+V+GLVC ILIQSSDSSAFG+SS+FTSVRS A+SL RFT+ILAF FF+T
Sbjct: 1   MQIFLMTAHLIIVIGLVCTILIQSSDSSAFGTSSSFTSVRSIAYSLARFTSILAFLFFST 60

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
           SIALG+ SRY S + K+++ +SL  +  ++ N N G+ S+P +DS
Sbjct: 61  SIALGITSRYHSIKTKEDLRQSLASATNNKINYNSGN-SNPNIDS 104


>gi|325293009|ref|YP_004278873.1| Protein-export membrane protein secG [Agrobacterium sp. H13-3]
 gi|325060862|gb|ADY64553.1| Protein-export membrane protein secG [Agrobacterium sp. H13-3]
          Length = 157

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 63/106 (59%), Gaps = 8/106 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R T ILA  FF
Sbjct: 6   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTGILAALFF 65

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN---DNFGDGSSP 101
            TS+ LG+++RY S R  D ++R  + + + QGN   D  G   +P
Sbjct: 66  VTSLGLGLLTRYES-RPTDILNR--IPATQGQGNGILDTLGPAQTP 108


>gi|86357801|ref|YP_469693.1| preprotein translocase subunit SecG [Rhizobium etli CFN 42]
 gi|86281903|gb|ABC90966.1| protein-export translocase protein [Rhizobium etli CFN 42]
          Length = 162

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 63/104 (60%), Gaps = 8/104 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN---DNFGDGS 99
            TS+ LG+++RY   R  D ++R  + +   QGN   D+ G G+
Sbjct: 61  LTSLGLGILTRYEG-RPSDILNR--IPATSGQGNGILDSLGGGA 101


>gi|116252258|ref|YP_768096.1| preprotein translocase subunit SecG [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115256906|emb|CAK08000.1| putative secG protein [Rhizobium leguminosarum bv. viciae 3841]
          Length = 173

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 64/118 (54%), Gaps = 8/118 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN---DNFGDGSSPKLDSVSAKSSSS 113
            TS+ LG+++RY   R  D + R  + +   QGN   D+ G   +P          SS
Sbjct: 61  LTSLGLGILTRYEG-RPSDILDR--IPATGGQGNGILDSLGGAQAPATPPAGNGVPSS 115


>gi|190891863|ref|YP_001978405.1| probable protein-export translocase protein [Rhizobium etli CIAT
           652]
 gi|190697142|gb|ACE91227.1| probable protein-export translocase protein [Rhizobium etli CIAT
           652]
          Length = 174

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 63/105 (60%), Gaps = 8/105 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN---DNFGDGSS 100
            TS+ LG+++RY   R  D ++R  + +   QGN   D+ G G+ 
Sbjct: 61  LTSLGLGILTRYEG-RPSDILNR--IPATSGQGNGILDSLGGGAQ 102


>gi|218662639|ref|ZP_03518569.1| preprotein translocase subunit SecG [Rhizobium etli IE4771]
          Length = 176

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 62/106 (58%), Gaps = 8/106 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN---DNFGDGSSP 101
            TS+ LG+++RY   R  D + R  + +   QGN   D+ G   +P
Sbjct: 61  LTSLGLGILTRYEG-RPGDILDR--IPATSGQGNGILDSLGGAQAP 103


>gi|218462580|ref|ZP_03502671.1| preprotein translocase subunit SecG [Rhizobium etli Kim 5]
          Length = 171

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 62/106 (58%), Gaps = 8/106 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN---DNFGDGSSP 101
            TS+ LG+++RY   R  D + R  + +   QGN   D+ G   +P
Sbjct: 61  LTSLGLGILTRYEG-RPGDILDR--IPATSGQGNGILDSLGGAQAP 103


>gi|241204752|ref|YP_002975848.1| preprotein translocase subunit SecG [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858642|gb|ACS56309.1| preprotein translocase, SecG subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 177

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 62/104 (59%), Gaps = 8/104 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN---DNFGDGS 99
            TS+ LG+++RY   R  D + R  + +   QGN   D+ G G+
Sbjct: 61  LTSLGLGILTRYEG-RPSDILDR--IPATGGQGNGILDSLGGGA 101


>gi|209549427|ref|YP_002281344.1| preprotein translocase subunit SecG [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535183|gb|ACI55118.1| preprotein translocase, SecG subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 179

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 62/104 (59%), Gaps = 8/104 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN---DNFGDGS 99
            TS+ LG+++RY   R  D + R  + +   QGN   D+ G G+
Sbjct: 61  ITSLGLGILTRYEG-RPSDILDR--IPATGGQGNGILDSLGGGA 101


>gi|159184841|ref|NP_354613.2| preprotein translocase subunit SecG [Agrobacterium tumefaciens
          str. C58]
 gi|159140125|gb|AAK87398.2| protein-export membrane protein SECG [Agrobacterium tumefaciens
          str. C58]
          Length = 157

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 59/94 (62%), Gaps = 5/94 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R T ILA  FF
Sbjct: 1  MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTGILAALFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
           TS+ LG+++RY S R  D ++R  + + + QGN
Sbjct: 61 LTSLGLGLMTRYES-RPTDILNR--IPATQGQGN 91


>gi|240850255|ref|YP_002971648.1| preprotein translocase SecG subunit [Bartonella grahamii as4aup]
 gi|240267378|gb|ACS50966.1| preprotein translocase SecG subunit [Bartonella grahamii as4aup]
          Length = 150

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG--SSSNFTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV VILIQ S+    G  +SS     R + + L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVITLVGVILIQPSEGGGLGVSNSSGLMKTRGSRNPLTRLTAILACCFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
             SI L ++    S    D + R  V+S  +Q + N G  S P  D  S+ S    + G 
Sbjct: 61  VVSIGLTVVGNI-SNSSSDILKRIPVNS--EQNSTNKGSESVPSSDGESSPSILEQLGGN 117

Query: 119 RSSSRTK 125
            +S + +
Sbjct: 118 SNSPQEQ 124


>gi|254701879|ref|ZP_05163707.1| preprotein translocase subunit SecG [Brucella suis bv. 5 str.
          513]
 gi|261752442|ref|ZP_05996151.1| preprotein translocase subunit SecG [Brucella suis bv. 5 str.
          513]
 gi|261742195|gb|EEY30121.1| preprotein translocase subunit SecG [Brucella suis bv. 5 str.
          513]
          Length = 148

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 3/83 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1  MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHR 81
          ATS+ LG+++RY   R  D ++R
Sbjct: 61 ATSLLLGIMARY-GERPTDILNR 82


>gi|218513883|ref|ZP_03510723.1| preprotein translocase subunit SecG [Rhizobium etli 8C-3]
          Length = 99

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 61/101 (60%), Gaps = 8/101 (7%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFFATSI 62
           ++V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF TS+
Sbjct: 1   MIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFFLTSL 60

Query: 63  ALGMISRYTSTRYKDNMHRSLVDSIKDQGN---DNFGDGSS 100
            LG+++RY   R  D ++R  + +   QGN   D+ G G+ 
Sbjct: 61  GLGILTRYEG-RPSDILNR--IPATSGQGNGILDSLGGGAQ 98


>gi|306841862|ref|ZP_07474543.1| preprotein translocase, SecG subunit [Brucella sp. BO2]
 gi|306288055|gb|EFM59455.1| preprotein translocase, SecG subunit [Brucella sp. BO2]
          Length = 148

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 3/83 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1  MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHR 81
          ATS+ LG+++RY   R  D ++R
Sbjct: 61 ATSLLLGIMARY-GERPTDILNR 82


>gi|306844001|ref|ZP_07476596.1| preprotein translocase, SecG subunit [Brucella sp. BO1]
 gi|306275756|gb|EFM57480.1| preprotein translocase, SecG subunit [Brucella sp. BO1]
          Length = 150

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 3/83 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1  MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHR 81
          ATS+ LG+++RY   R  D ++R
Sbjct: 61 ATSLLLGIMARY-GERPTDILNR 82


>gi|163868050|ref|YP_001609254.1| preprotein translocase subunit SecG [Bartonella tribocorum CIP
          105476]
 gi|161017701|emb|CAK01259.1| preprotein translocase SecG subunit [Bartonella tribocorum CIP
          105476]
          Length = 150

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 57/96 (59%), Gaps = 3/96 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG--SSSNFTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL++V+ LV VILIQ S+    G  +SS     R + + L R TAILA  FF
Sbjct: 1  MQTVLIVIHLLIVITLVGVILIQPSEGGGLGVSNSSGLMKTRGSRNPLTRLTAILACCFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN 94
            SIAL ++   +++ + D + R  V+S ++  N N
Sbjct: 61 VVSIALTVVGSISNSGF-DILKRIPVNSEQNSTNKN 95


>gi|239832025|ref|ZP_04680354.1| preprotein translocase, SecG subunit [Ochrobactrum intermedium
          LMG 3301]
 gi|239824292|gb|EEQ95860.1| preprotein translocase, SecG subunit [Ochrobactrum intermedium
          LMG 3301]
          Length = 153

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (63%), Gaps = 3/83 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1  MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHR 81
          ATS+ LG+++RY   +  D ++R
Sbjct: 61 ATSLILGIMARY-GEKPTDILNR 82


>gi|294852477|ref|ZP_06793150.1| preprotein translocase [Brucella sp. NVSL 07-0026]
 gi|294821066|gb|EFG38065.1| preprotein translocase [Brucella sp. NVSL 07-0026]
          Length = 148

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 3/83 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1  MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHR 81
          ATS+ LG+++RY   R  D ++R
Sbjct: 61 ATSLLLGIMARY-GERPTDILNR 82


>gi|62290050|ref|YP_221843.1| preprotein translocase subunit SecG [Brucella abortus bv. 1 str.
          9-941]
 gi|82699977|ref|YP_414551.1| preprotein translocase subunit SecG [Brucella melitensis biovar
          Abortus 2308]
 gi|148559914|ref|YP_001259058.1| preprotein translocase subunit SecG [Brucella ovis ATCC 25840]
 gi|161511144|ref|NP_539764.2| preprotein translocase subunit SecG [Brucella melitensis bv. 1
          str. 16M]
 gi|163843402|ref|YP_001627806.1| preprotein translocase subunit SecG [Brucella suis ATCC 23445]
 gi|189024290|ref|YP_001935058.1| Preprotein translocase SecG subunit [Brucella abortus S19]
 gi|225627606|ref|ZP_03785643.1| preprotein translocase, SecG subunit [Brucella ceti str. Cudo]
 gi|225852636|ref|YP_002732869.1| preprotein translocase subunit SecG [Brucella melitensis ATCC
          23457]
 gi|237815559|ref|ZP_04594556.1| preprotein translocase, SecG subunit [Brucella abortus str. 2308
          A]
 gi|254689362|ref|ZP_05152616.1| preprotein translocase subunit SecG [Brucella abortus bv. 6 str.
          870]
 gi|254693846|ref|ZP_05155674.1| preprotein translocase subunit SecG [Brucella abortus bv. 3 str.
          Tulya]
 gi|254697495|ref|ZP_05159323.1| preprotein translocase subunit SecG [Brucella abortus bv. 2 str.
          86/8/59]
 gi|254704425|ref|ZP_05166253.1| preprotein translocase subunit SecG [Brucella suis bv. 3 str.
          686]
 gi|254710213|ref|ZP_05172024.1| preprotein translocase subunit SecG [Brucella pinnipedialis
          B2/94]
 gi|254714210|ref|ZP_05176021.1| preprotein translocase subunit SecG [Brucella ceti M644/93/1]
 gi|254717646|ref|ZP_05179457.1| preprotein translocase subunit SecG [Brucella ceti M13/05/1]
 gi|254730392|ref|ZP_05188970.1| preprotein translocase subunit SecG [Brucella abortus bv. 4 str.
          292]
 gi|256031707|ref|ZP_05445321.1| preprotein translocase subunit SecG [Brucella pinnipedialis
          M292/94/1]
 gi|256044793|ref|ZP_05447697.1| preprotein translocase subunit SecG [Brucella melitensis bv. 1
          str. Rev.1]
 gi|256061220|ref|ZP_05451371.1| preprotein translocase subunit SecG [Brucella neotomae 5K33]
 gi|256113699|ref|ZP_05454503.1| preprotein translocase subunit SecG [Brucella melitensis bv. 3
          str. Ether]
 gi|256159866|ref|ZP_05457595.1| preprotein translocase subunit SecG [Brucella ceti M490/95/1]
 gi|256255108|ref|ZP_05460644.1| preprotein translocase subunit SecG [Brucella ceti B1/94]
 gi|256257608|ref|ZP_05463144.1| preprotein translocase subunit SecG [Brucella abortus bv. 9 str.
          C68]
 gi|256263871|ref|ZP_05466403.1| preprotein translocase SecG subunit [Brucella melitensis bv. 2
          str. 63/9]
 gi|256369563|ref|YP_003107073.1| protein-export membrane protein [Brucella microti CCM 4915]
 gi|260168839|ref|ZP_05755650.1| preprotein translocase subunit SecG [Brucella sp. F5/99]
 gi|260546602|ref|ZP_05822341.1| preprotein translocase SecG subunit [Brucella abortus NCTC 8038]
 gi|260565604|ref|ZP_05836088.1| preprotein translocase SecG subunit [Brucella melitensis bv. 1
          str. 16M]
 gi|260566328|ref|ZP_05836798.1| preprotein translocase SecG subunit [Brucella suis bv. 4 str. 40]
 gi|260754879|ref|ZP_05867227.1| preprotein translocase subunit SecG [Brucella abortus bv. 6 str.
          870]
 gi|260758096|ref|ZP_05870444.1| preprotein translocase subunit SecG [Brucella abortus bv. 4 str.
          292]
 gi|260761920|ref|ZP_05874263.1| preprotein translocase subunit SecG [Brucella abortus bv. 2 str.
          86/8/59]
 gi|260883891|ref|ZP_05895505.1| preprotein translocase subunit SecG [Brucella abortus bv. 9 str.
          C68]
 gi|261214131|ref|ZP_05928412.1| preprotein translocase subunit SecG [Brucella abortus bv. 3 str.
          Tulya]
 gi|261219485|ref|ZP_05933766.1| preprotein translocase subunit SecG [Brucella ceti M13/05/1]
 gi|261222303|ref|ZP_05936584.1| preprotein translocase subunit SecG [Brucella ceti B1/94]
 gi|261317771|ref|ZP_05956968.1| preprotein translocase subunit SecG [Brucella pinnipedialis
          B2/94]
 gi|261321980|ref|ZP_05961177.1| preprotein translocase subunit SecG [Brucella ceti M644/93/1]
 gi|261325227|ref|ZP_05964424.1| preprotein translocase subunit SecG [Brucella neotomae 5K33]
 gi|261755102|ref|ZP_05998811.1| preprotein translocase subunit SecG [Brucella suis bv. 3 str.
          686]
 gi|261758327|ref|ZP_06002036.1| preprotein translocase SecG subunit [Brucella sp. F5/99]
 gi|265988802|ref|ZP_06101359.1| preprotein translocase subunit SecG [Brucella pinnipedialis
          M292/94/1]
 gi|265991217|ref|ZP_06103774.1| preprotein translocase subunit SecG [Brucella melitensis bv. 1
          str. Rev.1]
 gi|265995053|ref|ZP_06107610.1| preprotein translocase subunit SecG [Brucella melitensis bv. 3
          str. Ether]
 gi|265998267|ref|ZP_06110824.1| preprotein translocase subunit SecG [Brucella ceti M490/95/1]
 gi|297248450|ref|ZP_06932168.1| protein-export membrane protein [Brucella abortus bv. 5 str.
          B3196]
 gi|62196182|gb|AAX74482.1| preprotein translocase, SecG subunit, hypothetical [Brucella
          abortus bv. 1 str. 9-941]
 gi|82616078|emb|CAJ11116.1| Preprotein translocase SecG subunit [Brucella melitensis biovar
          Abortus 2308]
 gi|148371171|gb|ABQ61150.1| protein-export membrane protein [Brucella ovis ATCC 25840]
 gi|163674125|gb|ABY38236.1| preprotein translocase, SecG subunit [Brucella suis ATCC 23445]
 gi|189019862|gb|ACD72584.1| Preprotein translocase SecG subunit [Brucella abortus S19]
 gi|225617611|gb|EEH14656.1| preprotein translocase, SecG subunit [Brucella ceti str. Cudo]
 gi|225641001|gb|ACO00915.1| preprotein translocase, SecG subunit [Brucella melitensis ATCC
          23457]
 gi|237788857|gb|EEP63068.1| preprotein translocase, SecG subunit [Brucella abortus str. 2308
          A]
 gi|255999725|gb|ACU48124.1| protein-export membrane protein [Brucella microti CCM 4915]
 gi|260095652|gb|EEW79529.1| preprotein translocase SecG subunit [Brucella abortus NCTC 8038]
 gi|260151672|gb|EEW86766.1| preprotein translocase SecG subunit [Brucella melitensis bv. 1
          str. 16M]
 gi|260155846|gb|EEW90926.1| preprotein translocase SecG subunit [Brucella suis bv. 4 str. 40]
 gi|260668414|gb|EEX55354.1| preprotein translocase subunit SecG [Brucella abortus bv. 4 str.
          292]
 gi|260672352|gb|EEX59173.1| preprotein translocase subunit SecG [Brucella abortus bv. 2 str.
          86/8/59]
 gi|260674987|gb|EEX61808.1| preprotein translocase subunit SecG [Brucella abortus bv. 6 str.
          870]
 gi|260873419|gb|EEX80488.1| preprotein translocase subunit SecG [Brucella abortus bv. 9 str.
          C68]
 gi|260915738|gb|EEX82599.1| preprotein translocase subunit SecG [Brucella abortus bv. 3 str.
          Tulya]
 gi|260920887|gb|EEX87540.1| preprotein translocase subunit SecG [Brucella ceti B1/94]
 gi|260924574|gb|EEX91142.1| preprotein translocase subunit SecG [Brucella ceti M13/05/1]
 gi|261294670|gb|EEX98166.1| preprotein translocase subunit SecG [Brucella ceti M644/93/1]
 gi|261296994|gb|EEY00491.1| preprotein translocase subunit SecG [Brucella pinnipedialis
          B2/94]
 gi|261301207|gb|EEY04704.1| preprotein translocase subunit SecG [Brucella neotomae 5K33]
 gi|261738311|gb|EEY26307.1| preprotein translocase SecG subunit [Brucella sp. F5/99]
 gi|261744855|gb|EEY32781.1| preprotein translocase subunit SecG [Brucella suis bv. 3 str.
          686]
 gi|262552735|gb|EEZ08725.1| preprotein translocase subunit SecG [Brucella ceti M490/95/1]
 gi|262766166|gb|EEZ11955.1| preprotein translocase subunit SecG [Brucella melitensis bv. 3
          str. Ether]
 gi|263002001|gb|EEZ14576.1| preprotein translocase subunit SecG [Brucella melitensis bv. 1
          str. Rev.1]
 gi|263094002|gb|EEZ17936.1| preprotein translocase SecG subunit [Brucella melitensis bv. 2
          str. 63/9]
 gi|264660999|gb|EEZ31260.1| preprotein translocase subunit SecG [Brucella pinnipedialis
          M292/94/1]
 gi|297175619|gb|EFH34966.1| protein-export membrane protein [Brucella abortus bv. 5 str.
          B3196]
 gi|326409155|gb|ADZ66220.1| Preprotein translocase SecG subunit [Brucella melitensis M28]
 gi|326538865|gb|ADZ87080.1| preprotein translocase, SecG subunit [Brucella melitensis M5-90]
          Length = 148

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 3/83 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1  MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHR 81
          ATS+ LG+++RY   R  D ++R
Sbjct: 61 ATSLLLGIMARY-GERPTDILNR 82


>gi|254706679|ref|ZP_05168507.1| preprotein translocase subunit SecG [Brucella pinnipedialis
          M163/99/10]
 gi|261314140|ref|ZP_05953337.1| preprotein translocase subunit SecG [Brucella pinnipedialis
          M163/99/10]
 gi|261303166|gb|EEY06663.1| preprotein translocase subunit SecG [Brucella pinnipedialis
          M163/99/10]
          Length = 148

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 3/83 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1  MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHR 81
          ATS+ LG+++RY   R  D ++R
Sbjct: 61 ATSLLLGIMARY-GERPTDILNR 82


>gi|161619089|ref|YP_001592976.1| preprotein translocase subunit SecG [Brucella canis ATCC 23365]
 gi|161335900|gb|ABX62205.1| preprotein translocase, SecG subunit [Brucella canis ATCC 23365]
          Length = 148

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 3/83 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1  MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHR 81
          ATS+ LG+++RY   R  D ++R
Sbjct: 61 ATSLLLGIMARY-GERPTDILNR 82


>gi|254719200|ref|ZP_05181011.1| preprotein translocase subunit SecG [Brucella sp. 83/13]
 gi|265984196|ref|ZP_06096931.1| preprotein translocase subunit SecG [Brucella sp. 83/13]
 gi|264662788|gb|EEZ33049.1| preprotein translocase subunit SecG [Brucella sp. 83/13]
          Length = 136

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 3/83 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1  MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHR 81
          ATS+ LG+++RY   R  D ++R
Sbjct: 61 ATSLLLGIMARY-GERPTDILNR 82


>gi|153009382|ref|YP_001370597.1| preprotein translocase subunit SecG [Ochrobactrum anthropi ATCC
          49188]
 gi|151561270|gb|ABS14768.1| preprotein translocase, SecG subunit [Ochrobactrum anthropi ATCC
          49188]
          Length = 153

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 53/83 (63%), Gaps = 3/83 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  ++V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1  MQTVIIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHR 81
          ATS+ LG+++RY   +  D ++R
Sbjct: 61 ATSLILGIMARY-GEKPTDILNR 82


>gi|23502015|ref|NP_698142.1| preprotein translocase subunit SecG [Brucella suis 1330]
 gi|23347967|gb|AAN30057.1| preprotein translocase, SecG subunit, putative [Brucella suis
          1330]
          Length = 148

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 52/83 (62%), Gaps = 3/83 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R   ++L R TAILA  FF
Sbjct: 1  MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGATNALTRTTAILAIGFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHR 81
          ATS+ LG+++RY   R  D ++R
Sbjct: 61 ATSLLLGIMARY-GERPTDILNR 82


>gi|110633987|ref|YP_674195.1| preprotein translocase subunit SecG [Mesorhizobium sp. BNC1]
 gi|110284971|gb|ABG63030.1| protein translocase subunit secG [Chelativorans sp. BNC1]
          Length = 162

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 63/130 (48%), Gaps = 9/130 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           M   ++V+HL++V+ LV V+L+Q S+    G      F + R  A+ L R TAILA  FF
Sbjct: 1   MHQVILVIHLLIVIALVGVVLMQRSEGGGLGIGGGSGFMTARGAANVLTRTTAILAAAFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN-----DNFGDG-SSPKLDSVSAKSSS 112
            TS+AL + +RY   R  D   R   D  + QG      D  G G ++P      A +S 
Sbjct: 61  ITSLALSLHARY-GERPTDIFDRLPQDQTQPQGAGGGILDQLGGGTTAPAPAEEQAPASE 119

Query: 113 SVVAGKRSSS 122
           +  A     S
Sbjct: 120 TAPAPSEPQS 129


>gi|163760081|ref|ZP_02167164.1| protein-export membrane protein [Hoeflea phototrophica DFL-43]
 gi|162282480|gb|EDQ32768.1| protein-export membrane protein [Hoeflea phototrophica DFL-43]
          Length = 129

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 2/72 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL++V+ LV ++L+Q S+    G      F S R  A++L R T ILA  FF
Sbjct: 1  MQTVLIVIHLMIVLALVGIVLVQRSEGGGLGIGGGSGFMSARGAANALTRTTGILAAAFF 60

Query: 59 ATSIALGMISRY 70
           TS+ALG+++RY
Sbjct: 61 VTSLALGILARY 72


>gi|240141512|ref|YP_002965992.1| putative secG: preprotein translocase [Methylobacterium
          extorquens AM1]
 gi|240011489|gb|ACS42715.1| putative secG: preprotein translocase [Methylobacterium
          extorquens AM1]
          Length = 155

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 52/92 (56%), Gaps = 12/92 (13%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
          MQ  L+VVHLI+V+ L+ V+L+Q S+             S F + R  A++L R TAILA
Sbjct: 1  MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGGGGGGGVSGFMTGRGQANALTRATAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDS 86
            FF TSIAL +++  T+        RS++D 
Sbjct: 61 ALFFTTSIALAILAHRTAA------PRSILDE 86


>gi|163854058|ref|YP_001642101.1| preprotein translocase, SecG subunit [Methylobacterium extorquens
          PA1]
 gi|218533001|ref|YP_002423817.1| preprotein translocase, SecG subunit [Methylobacterium
          chloromethanicum CM4]
 gi|254564026|ref|YP_003071121.1| secG: preprotein translocase [Methylobacterium extorquens DM4]
 gi|163665663|gb|ABY33030.1| preprotein translocase, SecG subunit [Methylobacterium extorquens
          PA1]
 gi|218525304|gb|ACK85889.1| preprotein translocase, SecG subunit [Methylobacterium
          chloromethanicum CM4]
 gi|254271304|emb|CAX27316.1| putative secG: preprotein translocase [Methylobacterium
          extorquens DM4]
          Length = 155

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 52/92 (56%), Gaps = 12/92 (13%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
          MQ  L+VVHLI+V+ L+ V+L+Q S+             S F + R  A++L R TAILA
Sbjct: 1  MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGGGGGGGVSGFMTGRGQANALTRATAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDS 86
            FF TSIAL +++      ++    RS++D 
Sbjct: 61 ALFFTTSIALAILA------HRSAAPRSILDE 86


>gi|220925412|ref|YP_002500714.1| preprotein translocase subunit SecG [Methylobacterium nodulans
          ORS 2060]
 gi|219950019|gb|ACL60411.1| preprotein translocase, SecG subunit [Methylobacterium nodulans
          ORS 2060]
          Length = 135

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 47/77 (61%), Gaps = 5/77 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS-----SSNFTSVRSTAHSLGRFTAILAF 55
          MQ  L+VVHLI+V+ L+ V+L+Q S+           +  F + R  A++L R TAILA 
Sbjct: 1  MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGGGSSGTQGFLTGRGQANALTRATAILAA 60

Query: 56 FFFATSIALGMISRYTS 72
           FFATS+ L ++S  TS
Sbjct: 61 LFFATSMVLAILSHRTS 77


>gi|319404081|emb|CBI77669.1| Preprotein translocase, SecG subunit [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 146

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 64/116 (55%), Gaps = 6/116 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS-SNFTSVRSTAHSLGRFTAILAFFFFA 59
           MQ  L+V+H +VV+ L+ V+L+Q S+    G   S+F S R    +L R T ILA  FF 
Sbjct: 1   MQTVLIVIHFLVVIALIGVVLLQPSEGGGLGGGGSSFMSTRGAKSALTRLTTILAACFFM 60

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
           TSI L +I    S    D ++R  V+S ++   +N   GS+P   SV  ++  S++
Sbjct: 61  TSIGLIVIGNL-SNSSSDILNRIPVNSGQNSTKENE-SGSAP---SVEGEAQPSII 111


>gi|46204719|ref|ZP_00209534.1| COG1314: Preprotein translocase subunit SecG [Magnetospirillum
          magnetotacticum MS-1]
          Length = 98

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 12/100 (12%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          MQ  L+VVHLI+V+ L+ V+L+Q S+               F + R  A++L R TAILA
Sbjct: 1  MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGVGVGGGVSGFMTGRGQANALTRSTAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN 94
            FF TSI L ++S      ++    RS++D    QG   
Sbjct: 61 ALFFTTSITLAIMS------HRSAAPRSILDGTGQQGQTQ 94


>gi|188584387|ref|YP_001927832.1| preprotein translocase, SecG subunit [Methylobacterium populi
          BJ001]
 gi|179347885|gb|ACB83297.1| preprotein translocase, SecG subunit [Methylobacterium populi
          BJ001]
          Length = 156

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 51/92 (55%), Gaps = 12/92 (13%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          MQ  L+VVHLI+V+ L+ V+L+Q S+               F + R  A++L R TAILA
Sbjct: 1  MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGGGGSGGVSGFMTGRGQANALTRATAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDS 86
            FF TSIAL +++      ++    RS++D 
Sbjct: 61 ALFFTTSIALAILA------HRSAAPRSILDE 86


>gi|319898757|ref|YP_004158850.1| Preprotein translocase, SecG subunit [Bartonella clarridgeiae 73]
 gi|319402721|emb|CBI76268.1| Preprotein translocase, SecG subunit [Bartonella clarridgeiae 73]
          Length = 149

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 1/94 (1%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
          MQ  L+V+H +VV+ LV V+L+Q S+   FG  S+F S R T  +L R T ILA  FFA 
Sbjct: 1  MQTVLIVIHFLVVIALVGVVLLQPSEGGGFGGGSSFMSTRGTKSALTRLTTILAICFFAI 60

Query: 61 SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN 94
          SI L ++    S    D ++R  V S K+   +N
Sbjct: 61 SIGLIVVGNL-SNSGSDILNRIPVSSGKNSTKEN 93


>gi|154248119|ref|YP_001419077.1| preprotein translocase, SecG subunit [Xanthobacter autotrophicus
           Py2]
 gi|154162204|gb|ABS69420.1| preprotein translocase, SecG subunit [Xanthobacter autotrophicus
           Py2]
          Length = 133

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 66/125 (52%), Gaps = 20/125 (16%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-------FTSVRSTAHSLGRFTAIL 53
           MQ  L+V+HL+VV+ L+ V+LIQ S+    G           F + R +A+ L R TA+L
Sbjct: 1   MQTVLIVIHLMVVLALIGVVLIQRSEGGGLGIGGGGGGGAGGFFTARGSANLLTRATAVL 60

Query: 54  AFFFFATSIALGMISRY---------TSTRYKDNMHRS---LVDSIKDQGN-DNFGDGSS 100
           A  FF TS+AL +++ +          +T+    + +S   ++D I+ QG   + G  ++
Sbjct: 61  ALIFFITSLALTIVAGWGRAPRSILQPATQSGPQVPQSGGTILDQIRPQGGAADQGAPAT 120

Query: 101 PKLDS 105
           P + S
Sbjct: 121 PAVPS 125


>gi|319405523|emb|CBI79142.1| Preprotein translocase, SecG subunit [Bartonella sp. AR 15-3]
          Length = 145

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 60/110 (54%), Gaps = 8/110 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           MQ  L+V+H +VV+ LV V+L+Q S+   FG SS F + R T  +L R T +LA  FFA 
Sbjct: 1   MQTVLIVIHFLVVIALVGVVLLQPSEGGGFGGSSGFINTRGTKSALTRLTTLLAICFFAI 60

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN-------FGDGSSPKL 103
           SI L +I    S    D ++R  ++S ++   +N        GD + P +
Sbjct: 61  SIGLIVIGNL-SNSGSDILNRIPINSEQNSIKENTSESTPSVGDEAQPSI 109


>gi|170743496|ref|YP_001772151.1| preprotein translocase, SecG subunit [Methylobacterium sp. 4-46]
 gi|168197770|gb|ACA19717.1| preprotein translocase, SecG subunit [Methylobacterium sp. 4-46]
          Length = 142

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (59%), Gaps = 5/77 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRSTAHSLGRFTAILAF 55
          MQ  L+VVHLI+V+ L+ V+L+Q S+           +  F + R  A++L R TAILA 
Sbjct: 1  MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGGGGSGTQGFLTGRGQANALTRATAILAA 60

Query: 56 FFFATSIALGMISRYTS 72
           FF TS+ L ++S  T+
Sbjct: 61 LFFTTSMVLAILSHRTA 77


>gi|319407093|emb|CBI80730.1| Preprotein translocase, SecG subunit [Bartonella sp. 1-1C]
          Length = 146

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 67/126 (53%), Gaps = 3/126 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT-SVRSTAHSLGRFTAILAFFFFA 59
           MQ  L+V+H +VV+ L+ V+L+Q S+   FG   +   S R T ++L R T ILA  FF 
Sbjct: 1   MQTVLIVIHFLVVIALIGVVLLQPSEGGGFGGGGSSFMSARGTKNALTRLTTILAACFFM 60

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
            SI L ++    S    D ++R  V++ ++   +N   GS+P ++  +  S    + G  
Sbjct: 61  ISIGLIVVGNL-SNSGSDILNRIPVNAGQNSTKEN-ASGSTPSVEGEAQPSIIDQLGGGP 118

Query: 120 SSSRTK 125
            SS+ +
Sbjct: 119 ESSQQQ 124


>gi|192291604|ref|YP_001992209.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
          TIE-1]
 gi|192285353|gb|ACF01734.1| preprotein translocase, SecG subunit [Rhodopseudomonas palustris
          TIE-1]
          Length = 134

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (62%), Gaps = 2/72 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  ++V+HL+ V+GL+ V+L+Q S+    G      F S R TA+ L R TAILA  FF
Sbjct: 1  MQTVIIVIHLMFVLGLIGVVLLQKSEGGGLGVGGGGGFMSSRGTANLLTRTTAILAAGFF 60

Query: 59 ATSIALGMISRY 70
          ATS+ L  ++ Y
Sbjct: 61 ATSLLLTWLASY 72


>gi|170749511|ref|YP_001755771.1| preprotein translocase, SecG subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656033|gb|ACB25088.1| preprotein translocase, SecG subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 140

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 56/113 (49%), Gaps = 22/113 (19%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           MQ  L+VVHLI+V+ L+ V+L+Q S+               F + R  A++L R TAILA
Sbjct: 1   MQTVLIVVHLIIVLALIGVVLLQRSEGGLGLGGGGGGGVGGFMTGRGQANALTRATAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ----------GNDNFGD 97
             FF TS+ L ++S      ++    +S++D+   Q          G DN  D
Sbjct: 61  ALFFTTSMVLAILS------HRSAAPKSILDTGAPQTSGQPAKQPTGADNLLD 107


>gi|71083625|ref|YP_266344.1| preprotein translocase subunit SecG [Candidatus Pelagibacter
          ubique HTCC1062]
 gi|91761954|ref|ZP_01263919.1| Preprotein translocase SecG subunit [Candidatus Pelagibacter
          ubique HTCC1002]
 gi|71062738|gb|AAZ21741.1| Preprotein translocase SecG subunit [Candidatus Pelagibacter
          ubique HTCC1062]
 gi|91717756|gb|EAS84406.1| Preprotein translocase SecG subunit [Candidatus Pelagibacter
          ubique HTCC1002]
          Length = 99

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 56/96 (58%), Gaps = 8/96 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG---SSSNFTSVRSTAHSLGRFTAILAFFF 57
          M+  L+VV+L++   LV +IL+Q S+  A G   S  NF   RS  + +G+ TA++A  F
Sbjct: 1  MENILLVVNLVLATILVLLILVQKSEGGALGIGVSQDNFMLSRSAGNFMGKATAVVATLF 60

Query: 58 FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
             S+AL +ISR   T  +     S++D I+++ +D
Sbjct: 61 IICSLALTIISRGELTPTE-----SVLDIIEEKSSD 91


>gi|39935952|ref|NP_948228.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
          CGA009]
 gi|39649806|emb|CAE28328.1| possible secG: preprotein translocase [Rhodopseudomonas palustris
          CGA009]
          Length = 134

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (62%), Gaps = 2/72 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  ++V+HL+ V+GL+ V+L+Q S+    G      F S R TA+ L R TAILA  FF
Sbjct: 1  MQTVIIVIHLMFVLGLIGVVLLQKSEGGGLGVGGGGGFMSSRGTANLLTRTTAILAAGFF 60

Query: 59 ATSIALGMISRY 70
          ATS+ L  ++ Y
Sbjct: 61 ATSLLLTWLASY 72


>gi|182678433|ref|YP_001832579.1| preprotein translocase, SecG subunit [Beijerinckia indica subsp.
          indica ATCC 9039]
 gi|182634316|gb|ACB95090.1| preprotein translocase, SecG subunit [Beijerinckia indica subsp.
          indica ATCC 9039]
          Length = 139

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (55%), Gaps = 11/84 (13%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST--AHSLGRFTAILAFFFF 58
          MQ  L+V+HLIVV+ LV  +L+Q S+  A G       +     A+ L R TAILA  FF
Sbjct: 1  MQTVLIVIHLIVVIALVITVLLQRSEGGALGVGGGGGFMTGRGQANVLTRATAILAALFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRS 82
           TS+AL +++         N+HR+
Sbjct: 61 TTSLALTILA---------NLHRA 75


>gi|222086038|ref|YP_002544570.1| protein-export translocase protein [Agrobacterium radiobacter K84]
 gi|221723486|gb|ACM26642.1| protein-export translocase protein [Agrobacterium radiobacter K84]
          Length = 168

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 10/121 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V++L++VV L+ V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLLVIYLMIVVALIGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILAALFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN---DNFG--DGSSPKLDSVSAKSSSS 113
           A ++ + ++SR+   R  D ++R  + S   QGN   D+ G   G++P        ++S 
Sbjct: 61  ALALGMNVLSRFEG-RPTDILNR--IPSTSGQGNGILDSLGGQKGAAPAGSQTQPANNSG 117

Query: 114 V 114
           V
Sbjct: 118 V 118


>gi|319408343|emb|CBI81996.1| Protein-export membrane protein [Bartonella schoenbuchensis R1]
          Length = 151

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 63/127 (49%), Gaps = 3/127 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQS--SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+H ++V+ L+ V+LIQ          S S F S R T + L R T ILA  FF
Sbjct: 1   MQTVLIVIHFLIVITLIGVVLIQPSEGGGLGTSSGSGFMSARGTKNMLTRLTTILAICFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
             SI L ++   +++   D ++R  ++S ++  N N  +   P  +  S  S    + G 
Sbjct: 61  TMSIVLVVVGNISNSD-SDILNRIPINSEQNPVNKNTTEEGKPSSNQSSKPSILEQLGGA 119

Query: 119 RSSSRTK 125
            + S+ +
Sbjct: 120 STPSQKQ 126


>gi|316933954|ref|YP_004108936.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
          DX-1]
 gi|315601668|gb|ADU44203.1| preprotein translocase, SecG subunit [Rhodopseudomonas palustris
          DX-1]
          Length = 135

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 45/74 (60%), Gaps = 4/74 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
          MQ  ++V+HL++V+GL+ V+L+Q S+    G        F S R TA+ L R TAILA  
Sbjct: 1  MQTVIIVIHLMLVLGLIGVVLLQKSEGGGLGVGGGGGGGFMSSRGTANLLTRTTAILAVG 60

Query: 57 FFATSIALGMISRY 70
          FF TS+ L  ++ Y
Sbjct: 61 FFITSLLLTWLASY 74


>gi|296532894|ref|ZP_06895559.1| preprotein translocase subunit SecG [Roseomonas cervicalis ATCC
          49957]
 gi|296266776|gb|EFH12736.1| preprotein translocase subunit SecG [Roseomonas cervicalis ATCC
          49957]
          Length = 89

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 44/79 (55%), Gaps = 5/79 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-----NFTSVRSTAHSLGRFTAILAF 55
          M   L+V+HL V + L+ V+L+Q S+    G  S     +F + R TA+ L R TAILA 
Sbjct: 1  MMTVLLVLHLFVTLALIGVVLLQRSEGGGLGIGSSQGMGSFMTGRGTANLLTRTTAILAT 60

Query: 56 FFFATSIALGMISRYTSTR 74
           F   ++A+ M+ R  + R
Sbjct: 61 LFMGLALAMAMLGRGQAQR 79


>gi|158424692|ref|YP_001525984.1| preprotein translocase SecG subunit [Azorhizobium caulinodans ORS
          571]
 gi|158331581|dbj|BAF89066.1| preprotein translocase SecG subunit [Azorhizobium caulinodans ORS
          571]
          Length = 138

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 5/75 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRSTAHSLGRFTAILAF 55
          MQ  L+V+HL+VV+ L+ V+LIQ S+         G    F + R TA+ L R TA+LA 
Sbjct: 1  MQTVLIVIHLLVVLALIGVVLIQRSEGGGLGIGGGGGGGGFFTARGTANVLTRATAVLAA 60

Query: 56 FFFATSIALGMISRY 70
           FF TS+ L +++ +
Sbjct: 61 LFFITSLGLTILAGW 75


>gi|91977295|ref|YP_569954.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
          BisB5]
 gi|91683751|gb|ABE40053.1| protein translocase subunit secG [Rhodopseudomonas palustris
          BisB5]
          Length = 128

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 44/74 (59%), Gaps = 4/74 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
          MQ  ++V+HL++V+GL+  +L+Q S+    G        F S R TA+ L R TAILA  
Sbjct: 1  MQTVIIVIHLMLVLGLIGSVLLQKSEGGGLGVGGGGGGGFMSSRGTANLLTRTTAILAAG 60

Query: 57 FFATSIALGMISRY 70
          FF TS+ L  ++ Y
Sbjct: 61 FFVTSLLLSWLATY 74


>gi|323138444|ref|ZP_08073513.1| preprotein translocase, SecG subunit [Methylocystis sp. ATCC
          49242]
 gi|322396240|gb|EFX98772.1| preprotein translocase, SecG subunit [Methylocystis sp. ATCC
          49242]
          Length = 255

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 43/72 (59%), Gaps = 3/72 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  ++ +HL+VV  LV ++L Q S+  A G   +  FT  R  A++L R T ILA  FF
Sbjct: 1  MQQVIIAIHLMVVTALVILVLYQKSEGGALGMGGSGVFTG-RGQANALTRATGILATIFF 59

Query: 59 ATSIALGMISRY 70
           TSIAL ++  +
Sbjct: 60 ITSIALTVLPAW 71


>gi|163746028|ref|ZP_02153387.1| preprotein translocase, SecG subunit, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161380773|gb|EDQ05183.1| preprotein translocase, SecG subunit, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 118

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 21/117 (17%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV--RSTAHSLGRFTAILAFFFF 58
           M+  ++++HLI+ +GL+ V+L+Q S+    G      +V  RS A +LG+ T ILA  F 
Sbjct: 1   MENVVLIIHLILALGLIAVVLLQRSEGGGLGMGGGGGAVSGRSAATALGKITWILAAGFI 60

Query: 59  ATSIALGMIS-----------RYTSTRYKDNMHRSLVDSIKDQGNDNF---GDGSSP 101
            TSI L +I+           R ++T    N   +L       G+D      DG++P
Sbjct: 61  VTSITLTIIAAEKSAGSSVIDRLSATPPAQNGSPAL-----PAGDDLLPPSADGNTP 112


>gi|86749908|ref|YP_486404.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
          HaA2]
 gi|86572936|gb|ABD07493.1| protein translocase subunit secG [Rhodopseudomonas palustris
          HaA2]
          Length = 130

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 4/74 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
          MQ  ++V+HL++V+GL+  +L+Q S+    G        F S R TA+ L R TA LA  
Sbjct: 1  MQTVIIVIHLMLVLGLIATVLLQKSEGGGLGVGGGGGGGFMSSRGTANLLTRTTAFLAVG 60

Query: 57 FFATSIALGMISRY 70
          FF TS+ L  ++ Y
Sbjct: 61 FFITSLLLSWLATY 74


>gi|298291795|ref|YP_003693734.1| preprotein translocase, SecG subunit [Starkeya novella DSM 506]
 gi|296928306|gb|ADH89115.1| preprotein translocase, SecG subunit [Starkeya novella DSM 506]
          Length = 129

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 5/75 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
          MQ  ++V+HL+VV+ L+ V+LIQ S+    G         F S R TA+ L R TAILA 
Sbjct: 1  MQTVIIVIHLMVVLALIGVVLIQRSEGGGLGIGGGGGGGGFFSARGTANVLTRATAILAA 60

Query: 56 FFFATSIALGMISRY 70
           FF TS++L +++ +
Sbjct: 61 LFFITSLSLTILAGW 75


>gi|90423972|ref|YP_532342.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
          BisB18]
 gi|90105986|gb|ABD88023.1| protein translocase subunit secG [Rhodopseudomonas palustris
          BisB18]
          Length = 128

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 43/76 (56%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          MQ  ++V+HL++V  L+  +L+Q S+  A G          F S R TA+ L R TA+LA
Sbjct: 1  MQTVIIVLHLMIVATLIATVLLQKSEGGALGMGGGGGGGGGFMSSRGTANLLTRTTAVLA 60

Query: 55 FFFFATSIALGMISRY 70
            FF TS+ L  I+ Y
Sbjct: 61 VGFFITSLLLSWIASY 76


>gi|150396289|ref|YP_001326756.1| preprotein translocase subunit SecG [Sinorhizobium medicae
          WSM419]
 gi|150027804|gb|ABR59921.1| preprotein translocase, SecG subunit [Sinorhizobium medicae
          WSM419]
          Length = 156

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 50/72 (69%), Gaps = 2/72 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V++L+VVV L+ V+LIQ S+    G      F S R TA++L R TA+LAF FF
Sbjct: 1  MQTILLVIYLMVVVALIGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAVLAFLFF 60

Query: 59 ATSIALGMISRY 70
          A ++A+G++SRY
Sbjct: 61 ALALAMGILSRY 72


>gi|49475362|ref|YP_033403.1| preprotein translocase subunit SecG [Bartonella henselae str.
          Houston-1]
 gi|49238168|emb|CAF27377.1| Protein-export membrane protein [Bartonella henselae str.
          Houston-1]
          Length = 152

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (56%), Gaps = 2/69 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ--SSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+H +VV+ LV VILIQ          S S     R + ++L R TAILA  FF
Sbjct: 1  MQTVLIVIHFLVVITLVGVILIQHSEGGGLGVSSGSGLMKTRGSKNALSRLTAILACCFF 60

Query: 59 ATSIALGMI 67
          A SI L ++
Sbjct: 61 AVSIGLTVV 69


>gi|146283633|ref|YP_001173786.1| preprotein translocase subunit SecG [Pseudomonas stutzeri A1501]
 gi|145571838|gb|ABP80944.1| preprotein translocase, SecG subunit [Pseudomonas stutzeri A1501]
          Length = 141

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 50/81 (61%), Gaps = 6/81 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          +Q  ++VVHL+V +G+V ++L+Q    +D+ A FGS ++ T    + +A  L RFTAILA
Sbjct: 16 LQTVVIVVHLLVALGVVALVLLQQGKGADAGASFGSGASATVFGSQGSATFLSRFTAILA 75

Query: 55 FFFFATSIALGMISRYTSTRY 75
            FF TS+ L   ++  + + 
Sbjct: 76 GVFFLTSLGLAFFAKQQADQL 96


>gi|146341033|ref|YP_001206081.1| preprotein translocase subunit SecG [Bradyrhizobium sp. ORS278]
 gi|146193839|emb|CAL77856.1| putative Protein-export membrane protein, secG-like [Bradyrhizobium
           sp. ORS278]
          Length = 127

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 54/108 (50%), Gaps = 4/108 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V  L+  +L+Q S+    G      F S R TA+ L R TA+LA  FF
Sbjct: 1   MQTVLIVIHLMIVAVLIGAVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTAVLAVGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSV 106
            TS+ L  ++ Y   R   ++  ++    +  G      GS   LD +
Sbjct: 61  VTSLLLTWLAGY--DRKPSSILGNMPGQTQSGGATPVAPGSGGVLDQL 106


>gi|114707417|ref|ZP_01440313.1| protein-export membrane protein [Fulvimarina pelagi HTCC2506]
 gi|114536976|gb|EAU40104.1| protein-export membrane protein [Fulvimarina pelagi HTCC2506]
          Length = 258

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 3/75 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFF 57
          M+  L+V+HL++V+ LV V+L+Q S+  A G         S R  A++L + T ILA  F
Sbjct: 1  METILIVIHLMIVIALVVVVLLQRSEGGALGIGGGGGGMMSARGAANALTKTTGILAAGF 60

Query: 58 FATSIALGMISRYTS 72
          F TS++LG+++RY S
Sbjct: 61 FITSLSLGILARYGS 75


>gi|327482028|gb|AEA85338.1| preprotein translocase subunit SecG [Pseudomonas stutzeri DSM
          4166]
          Length = 127

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 50/80 (62%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          +Q  ++VVHL+V +G+V ++L+Q    +D+ A FGS ++ T    + +A  L RFTAILA
Sbjct: 2  LQTVVIVVHLLVALGVVALVLLQQGKGADAGASFGSGASATVFGSQGSATFLSRFTAILA 61

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF TS+ L   ++  + +
Sbjct: 62 GVFFLTSLGLAFFAKQQADQ 81


>gi|15965192|ref|NP_385545.1| preprotein translocase subunit SecG [Sinorhizobium meliloti 1021]
 gi|307309206|ref|ZP_07588877.1| preprotein translocase, SecG subunit [Sinorhizobium meliloti
          BL225C]
 gi|307321536|ref|ZP_07600931.1| preprotein translocase, SecG subunit [Sinorhizobium meliloti
          AK83]
 gi|15074372|emb|CAC46018.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306892843|gb|EFN23634.1| preprotein translocase, SecG subunit [Sinorhizobium meliloti
          AK83]
 gi|306900352|gb|EFN30968.1| preprotein translocase, SecG subunit [Sinorhizobium meliloti
          BL225C]
          Length = 161

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 50/72 (69%), Gaps = 2/72 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V++L+VVV L+ V+LIQ S+    G      F S R TA++L R TA+LAF FF
Sbjct: 1  MQTVLLVIYLMVVVALIGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAVLAFLFF 60

Query: 59 ATSIALGMISRY 70
          A ++A+G++SRY
Sbjct: 61 ALALAMGILSRY 72


>gi|288958210|ref|YP_003448551.1| SecG protein [Azospirillum sp. B510]
 gi|288910518|dbj|BAI72007.1| SecG protein [Azospirillum sp. B510]
          Length = 107

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%), Gaps = 4/72 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M+  ++V+HL++ VGLV VILIQ S+        G+     S R TA+ L R T ILA  
Sbjct: 1  MESVILVIHLLIAVGLVGVILIQRSEGGGLGIGGGTMGGMMSTRGTANLLTRTTGILAGC 60

Query: 57 FFATSIALGMIS 68
          FFATSI L +++
Sbjct: 61 FFATSIVLAILA 72


>gi|49474121|ref|YP_032163.1| preprotein translocase subunit SecG [Bartonella quintana str.
          Toulouse]
 gi|49239625|emb|CAF25984.1| Protein-export membrane protein [Bartonella quintana str.
          Toulouse]
          Length = 151

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 50/100 (50%), Gaps = 3/100 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS--SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+H +VV+ LV +ILIQ          S S     R + ++L R TAILA  FF
Sbjct: 1  MQTVLIVIHFLVVIALVGIILIQPSEGGGLGVSSGSGLMRTRGSKNALSRLTAILACCFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
            SI L ++    S    D + R  ++S ++  N +  + 
Sbjct: 61 TVSIGLTVVGSI-SNSSSDILKRIPINSEQNSTNKDASEA 99


>gi|27379917|ref|NP_771446.1| preprotein translocase subunit SecG [Bradyrhizobium japonicum USDA
           110]
 gi|27353070|dbj|BAC50071.1| protein-export membrane protein [Bradyrhizobium japonicum USDA 110]
          Length = 129

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 50/104 (48%), Gaps = 8/104 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  ++V+HL++V  ++  +L+Q S+    G      F S R TA+ L R TAILA  FF
Sbjct: 1   MQTVVIVIHLMIVAVMIGAVLLQKSEGGGLGMGGGAGFMSSRGTANLLSRTTAILAAGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
            TS+ L   + Y      +    S++     QG    G   +P 
Sbjct: 61  VTSLFLSWYAGY------NRAPSSIIGQPASQGQPAGGSPIAPP 98


>gi|254448886|ref|ZP_05062342.1| preprotein translocase, SecG subunit [gamma proteobacterium
           HTCC5015]
 gi|198261576|gb|EDY85865.1| preprotein translocase, SecG subunit [gamma proteobacterium
           HTCC5015]
          Length = 124

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 63/120 (52%), Gaps = 9/120 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
           M+  L+VVH+++ +GL+ +ILIQ    +   +AFGS ++ T   ++     + + T  +A
Sbjct: 1   METALLVVHVLLSIGLIALILIQHGKGADAGAAFGSGASGTVFGASGAGSFMTKLTTWIA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FFATS+AL   +  TS+     + R++    ++Q  +   + S+  +    A S S V
Sbjct: 61  VSFFATSLALAYTAANTSSEPTSVIERTMQ---QEQSGEEAAEQSTGDVPVAPASSDSDV 117


>gi|222148650|ref|YP_002549607.1| protein-export membrane protein SECG [Agrobacterium vitis S4]
 gi|221735636|gb|ACM36599.1| protein-export membrane protein SECG [Agrobacterium vitis S4]
          Length = 128

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 3/79 (3%)

Query: 16 LVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTST 73
          LV V+LIQ S+    G      F S R  A++L R TAILA  FF TS+ LG++SR+ + 
Sbjct: 16 LVGVVLIQRSEGGGLGIGGGSGFMSARGAANALTRTTAILATLFFITSLGLGILSRFEA- 74

Query: 74 RYKDNMHRSLVDSIKDQGN 92
          +  D ++R         GN
Sbjct: 75 KPTDILNRIPAGQQAPSGN 93


>gi|59711090|ref|YP_203866.1| preprotein translocase subunit SecG [Vibrio fischeri ES114]
 gi|197334714|ref|YP_002155238.1| translocase [Vibrio fischeri MJ11]
 gi|59479191|gb|AAW84978.1| preprotein translocase membrane subunit [Vibrio fischeri ES114]
 gi|197316204|gb|ACH65651.1| translocase [Vibrio fischeri MJ11]
          Length = 110

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 52/99 (52%), Gaps = 6/99 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M   L+V++LI  VG++ ++L+Q    +    +FG+ ++ T   S+     L R TAI A
Sbjct: 1  MHTILLVIYLIAAVGVIGLVLVQHGKGADMGASFGAGASNTVFGSSGSGNFLTRMTAICA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
            FF  S+ALG +S + S  +   + +   + + D  +D
Sbjct: 61 TVFFVISLALGNMSTHKSEGFDLKLDQQATEQVTDNASD 99


>gi|148255834|ref|YP_001240419.1| preprotein translocase subunit SecG [Bradyrhizobium sp. BTAi1]
 gi|146408007|gb|ABQ36513.1| protein translocase subunit secG [Bradyrhizobium sp. BTAi1]
          Length = 127

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 11/103 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ   +V+HL++V  L+  +L+Q S+    G      F S R TA+ L R TA+LA  FF
Sbjct: 1   MQTVFIVIHLMIVAVLIGAVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTAVLAVGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
            TS+ L  ++ Y      D    S++ ++  Q       G++P
Sbjct: 61  VTSLLLTWLAGY------DRKPTSILGNVPGQTQSG---GATP 94


>gi|127513758|ref|YP_001094955.1| preprotein translocase subunit SecG [Shewanella loihica PV-4]
 gi|126639053|gb|ABO24696.1| protein translocase subunit secG [Shewanella loihica PV-4]
          Length = 114

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 51/99 (51%), Gaps = 15/99 (15%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M   LMV++L+V +GL+ +ILIQ        ++FG+ ++ T   S+     L R TAILA
Sbjct: 1  MYEVLMVIYLLVALGLIGLILIQQGKGADMGASFGAGASATLFGSSGSGNFLTRSTAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
            FFA S+ +G +S           H    +S KD G D
Sbjct: 61 IAFFALSLTIGNLSAN---------HAKTEESWKDLGAD 90


>gi|317123040|ref|YP_004103043.1| protein translocase subunit secG [Thermaerobacter marianensis DSM
          12885]
 gi|315593020|gb|ADU52316.1| protein translocase subunit secG [Thermaerobacter marianensis DSM
          12885]
          Length = 71

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 6/67 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAF------GSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          +++VH++ V+GL+ V+++QS  S+        G+ + F   R     LGR T ILA  FF
Sbjct: 1  MLIVHILAVIGLIAVVVLQSGRSAGLSGAIAGGAEAFFGKRRGLDEFLGRMTVILAVVFF 60

Query: 59 ATSIALG 65
           TS  LG
Sbjct: 61 ITSFVLG 67


>gi|212634071|ref|YP_002310596.1| preprotein translocase subunit SecG [Shewanella piezotolerans
          WP3]
 gi|212555555|gb|ACJ28009.1| Preprotein translocase, SecG subunit [Shewanella piezotolerans
          WP3]
          Length = 111

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 50/95 (52%), Gaps = 15/95 (15%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          LMVV+L+V +GLV +ILIQ        ++FG+ ++ T   S+     L R TAILA  FF
Sbjct: 5  LMVVYLLVAIGLVGMILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAILAIAFF 64

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
          A S+ +G +S           H    D+  D G+D
Sbjct: 65 ALSLTIGNLSAN---------HTQSEDAWNDLGSD 90


>gi|260771817|ref|ZP_05880735.1| preprotein translocase subunit SecG [Vibrio metschnikovii CIP
           69.14]
 gi|260613109|gb|EEX38310.1| preprotein translocase subunit SecG [Vibrio metschnikovii CIP
           69.14]
          Length = 114

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 60/110 (54%), Gaps = 11/110 (10%)

Query: 5   LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
           L+V++L+  VG++ ++LIQ        ++FG+ ++ T      + + L R TA+ A  FF
Sbjct: 8   LLVIYLLAAVGIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAVFATAFF 67

Query: 59  ATSIALGMISRY-TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             S+ LG +S + T +++ D +   +V    +Q +++  D  +PK D + 
Sbjct: 68  VISLVLGNMSTHKTESQWVDPLQGHVV----EQADNSVSDIPAPKGDEIP 113


>gi|260427354|ref|ZP_05781333.1| preprotein translocase subunit SecG [Citreicella sp. SE45]
 gi|260421846|gb|EEX15097.1| preprotein translocase subunit SecG [Citreicella sp. SE45]
          Length = 126

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 43/70 (61%), Gaps = 2/70 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV--RSTAHSLGRFTAILAFFFF 58
          MQ  +++VHL++ + L+ V+L+Q S+    G      ++  R+ A +LG+ T ILA  F 
Sbjct: 1  MQNVILIVHLLLALSLIGVVLLQRSEGGGLGMGGGGGAMSQRAAATALGKITWILAICFI 60

Query: 59 ATSIALGMIS 68
          ATS+ L +++
Sbjct: 61 ATSLTLTILA 70


>gi|148555264|ref|YP_001262846.1| protein translocase subunit secG [Sphingomonas wittichii RW1]
 gi|148500454|gb|ABQ68708.1| protein translocase subunit secG [Sphingomonas wittichii RW1]
          Length = 124

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAF---GSSSNFTSVRSTAHSLGRFTAILAFFF 57
          FL+VVH+IV   LV +IL+Q S+       GS     S R  A  L R TAILA  F
Sbjct: 5  FLLVVHIIVATALVAIILVQRSEGGGLTSGGSPGGLMSARGAADFLTRTTAILAGIF 61


>gi|159045283|ref|YP_001534077.1| preprotein translocase subunit SecG [Dinoroseobacter shibae DFL
          12]
 gi|157913043|gb|ABV94476.1| putative preprotein translocase [Dinoroseobacter shibae DFL 12]
          Length = 122

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 49/94 (52%), Gaps = 10/94 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV----RSTAHSLGRFTAILAFF 56
          M+  +++VHL++ + L+ V+L+Q S+    G            RS A +LG+ T ILA  
Sbjct: 1  MENVILIVHLLLALALIGVVLLQRSEGGGLGMGGGGGGGAMTGRSAATALGKMTWILAVA 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
          F  TSI L +++   S       + S++D + DQ
Sbjct: 61 FIGTSITLTILAAANSN------NASVLDRLTDQ 88


>gi|121602235|ref|YP_988844.1| preprotein translocase subunit SecG [Bartonella bacilliformis
           KC583]
 gi|120614412|gb|ABM45013.1| preprotein translocase, SecG subunit [Bartonella bacilliformis
           KC583]
          Length = 149

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 69/123 (56%), Gaps = 11/123 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+H ++V+ LV V+LIQ S+    G      F S R T ++L R TAILA  FF
Sbjct: 1   MQTVLIVIHFLIVIVLVGVVLIQPSEGGGLGVGGGSGFMSTRGTRNTLTRLTAILAICFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN-------FGDGSSPK-LDSVSAKS 110
            TSIAL ++   +++   D ++R  V+S ++  N N        G+G+ P  L+ +   S
Sbjct: 61  VTSIALIVVGSISNSNL-DILNRIPVNSEQNSINKNASEGVPSPGNGTQPSILEQLGGAS 119

Query: 111 SSS 113
           +SS
Sbjct: 120 TSS 122


>gi|83942932|ref|ZP_00955392.1| preprotein translocase, SecG subunit [Sulfitobacter sp. EE-36]
 gi|83954106|ref|ZP_00962826.1| preprotein translocase, SecG subunit [Sulfitobacter sp. NAS-14.1]
 gi|83841143|gb|EAP80313.1| preprotein translocase, SecG subunit [Sulfitobacter sp. NAS-14.1]
 gi|83845940|gb|EAP83817.1| preprotein translocase, SecG subunit [Sulfitobacter sp. EE-36]
          Length = 122

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF----TSVRSTAHSLGRFTAILAFF 56
          M+  +++VHLI+ +GL+ V+L+Q S+    G          S R+ A ++G+ T +LA  
Sbjct: 1  MENVVLIVHLILALGLIAVVLLQRSEGGGLGMGGGGGGGAVSGRAAATAMGKLTWVLAAA 60

Query: 57 FFATSIALGMISRYTS 72
          F  TSI L +I+   S
Sbjct: 61 FIVTSITLTIIAAEKS 76


>gi|157376524|ref|YP_001475124.1| preprotein translocase subunit SecG [Shewanella sediminis
          HAW-EB3]
 gi|157318898|gb|ABV37996.1| preprotein translocase, SecG subunit [Shewanella sediminis
          HAW-EB3]
          Length = 115

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 9/86 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M   LMVV+L+V +GLV +ILIQ        ++FG+ ++ T   S+     L R TA+LA
Sbjct: 1  MYEVLMVVYLVVAIGLVGLILIQQGKGADMGASFGAGASATLFGSSGAGNFLTRSTAVLA 60

Query: 55 FFFFATSIALGMIS-RYTSTR--YKD 77
            FFA S+ +G +S  +T +   +KD
Sbjct: 61 IGFFALSLTIGNLSANHTKSEDAWKD 86


>gi|307546730|ref|YP_003899209.1| hypothetical protein HELO_4140 [Halomonas elongata DSM 2581]
 gi|307218754|emb|CBV44024.1| hypothetical protein predicted by Glimmer/Critica [Halomonas
           elongata DSM 2581]
          Length = 120

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 60/119 (50%), Gaps = 16/119 (13%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQ---SSDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
           MQ+ ++++H+ + + LV +IL+Q    +D+ A FG  ++ T    R +   L R TA+LA
Sbjct: 1   MQVAILMIHVAIAIALVALILLQQGKGADAGASFGGGASQTVFGSRGSGSFLSRATAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKD--------NMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FFATS+ L   +       ++           +S   ++ D+GN    D ++P L+ 
Sbjct: 61  AAFFATSLTLAYFASQAGEAPEEVGIPDAEVVEQQSAEPTLDDKGNG--ADNAAPVLEE 117


>gi|94265674|ref|ZP_01289414.1| Preprotein translocase SecG subunit [delta proteobacterium
          MLMS-1]
 gi|93453801|gb|EAT04170.1| Preprotein translocase SecG subunit [delta proteobacterium
          MLMS-1]
          Length = 125

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 46/84 (54%), Gaps = 10/84 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSNFT--SVRSTAHSLGRFTAILA 54
          MQ  L+V+H++V + LV +IL+Q    +S  ++FGS+SN T          + + T   A
Sbjct: 1  MQTILIVIHILVCLFLVVIILLQHGKGASIGASFGSASNQTVFGTEGPMPLMNKITTTAA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDN 78
           FF ATS++L     Y S+R  D 
Sbjct: 61 IFFMATSVSLA----YFSSRVGDG 80


>gi|292493669|ref|YP_003529108.1| preprotein translocase subunit SecG [Nitrosococcus halophilus Nc4]
 gi|291582264|gb|ADE16721.1| preprotein translocase, SecG subunit [Nitrosococcus halophilus Nc4]
          Length = 151

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 65/137 (47%), Gaps = 26/137 (18%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSNFT--SVRSTAHSLGRFTAILA 54
           M   L+V H++V + LV ++LIQ    +   +AFGS ++ T    R +A+ L R +AILA
Sbjct: 1   MHSVLLVFHILVAIALVSLVLIQHGKGADAGAAFGSGASATVFGARGSANFLTRASAILA 60

Query: 55  FFFFATSIALGMIS---RYTSTRYKDNMHRSLVD------------SIKD---QGNDNFG 96
             FF TS++L   S     TS+  +    + + D            + KD   +G    G
Sbjct: 61  AVFFITSLSLAYFSVREPQTSSVTQAAEPKIVADEDMVIPPLPKDETTKDKLSEGAQQLG 120

Query: 97  DG--SSPKLDSVSAKSS 111
            G   SPK   V A SS
Sbjct: 121 AGQEESPKSSEVPAASS 137


>gi|115524601|ref|YP_781512.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
          BisA53]
 gi|115518548|gb|ABJ06532.1| protein translocase subunit secG [Rhodopseudomonas palustris
          BisA53]
          Length = 130

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHSLGRFTAILA 54
          MQ  ++V+HL++V  L+ ++L+Q S+          G    F S R TA+ L R T  LA
Sbjct: 1  MQTVIIVIHLMIVATLIALVLLQKSEGGALGVGGGGGGGGGFMSSRGTANLLTRSTGFLA 60

Query: 55 FFFFATSIALGMISRY 70
            FF TS+ L  ++ Y
Sbjct: 61 AGFFVTSLTLSWLASY 76


>gi|163793239|ref|ZP_02187215.1| preprotein translocase, SecG subunit [alpha proteobacterium
          BAL199]
 gi|159181885|gb|EDP66397.1| preprotein translocase, SecG subunit [alpha proteobacterium
          BAL199]
          Length = 105

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 7/81 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-------NFTSVRSTAHSLGRFTAIL 53
          M   ++ +HL++ + LV V+L+Q S+    G          +F S R TA+ L R TAIL
Sbjct: 1  MTAIVLTIHLMIALALVIVVLLQRSEGGGLGIGGGGGGGMGSFMSARGTANLLTRTTAIL 60

Query: 54 AFFFFATSIALGMISRYTSTR 74
          A  F +TSI L +++  T T+
Sbjct: 61 AACFMSTSILLAILAGNTGTQ 81


>gi|94268755|ref|ZP_01291276.1| Preprotein translocase SecG subunit [delta proteobacterium
          MLMS-1]
 gi|93451477|gb|EAT02311.1| Preprotein translocase SecG subunit [delta proteobacterium
          MLMS-1]
          Length = 125

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 46/84 (54%), Gaps = 10/84 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSNFT--SVRSTAHSLGRFTAILA 54
          MQ  L+V+H++V + LV +IL+Q    +S  ++FGS+SN T          + + T   A
Sbjct: 1  MQTILIVIHILVCLFLVVIILLQHGKGASIGASFGSASNQTVFGTEGPMPLMNKITTTAA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDN 78
           FF ATS++L     Y S+R  D 
Sbjct: 61 IFFMATSVSLA----YFSSRVGDG 80


>gi|313903094|ref|ZP_07836488.1| protein translocase subunit secG [Thermaerobacter subterraneus
          DSM 13965]
 gi|313466596|gb|EFR62116.1| protein translocase subunit secG [Thermaerobacter subterraneus
          DSM 13965]
          Length = 71

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 6/67 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAF------GSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          ++++H++ V+GL+ V+++QS  S+        G+ + F   R     LGR T ILA  FF
Sbjct: 1  MLILHILAVIGLIAVVILQSGRSAGLSGAIAGGAEAFFGKRRGLDDFLGRMTVILAVVFF 60

Query: 59 ATSIALG 65
           TS  LG
Sbjct: 61 VTSFVLG 67


>gi|260433187|ref|ZP_05787158.1| preprotein translocase subunit SecG [Silicibacter
          lacuscaerulensis ITI-1157]
 gi|260417015|gb|EEX10274.1| preprotein translocase subunit SecG [Silicibacter
          lacuscaerulensis ITI-1157]
          Length = 121

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 3/75 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
          M+  ++++HL++ +GL+ V+L+Q S+       G      + RS A +LG+ T ILA  F
Sbjct: 1  MENVVLIIHLLLALGLIAVVLMQRSEGGGLGMGGGGGGAMAGRSAATALGKLTWILAACF 60

Query: 58 FATSIALGMISRYTS 72
            TSI L +++   S
Sbjct: 61 IVTSITLTILAAQKS 75


>gi|289207892|ref|YP_003459958.1| preprotein translocase, SecG subunit [Thioalkalivibrio sp. K90mix]
 gi|288943523|gb|ADC71222.1| preprotein translocase, SecG subunit [Thioalkalivibrio sp. K90mix]
          Length = 126

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 63/116 (54%), Gaps = 10/116 (8%)

Query: 4   FLMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSNFT--SVRSTAHSLGRFTAILAFFF 57
            L+VV + V + L+ ++L+Q    +   +AFGS ++ T    R +A+ L R TA LA  F
Sbjct: 5   LLLVVQVAVSIALIALVLMQHGKGADAGAAFGSGASATVFGARGSANFLSRSTAFLAVVF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSL-VDSIKDQGNDNFG-DGSSPKLDSVSAKSS 111
           F  S+ L  ++  +ST   +++   L  + ++++G+   G  G+ P+ D   A +S
Sbjct: 65  FVNSLTLAYLA--SSTPQAESLMDQLEAEEMREEGDIPEGIPGTVPRDDESDAPAS 118


>gi|170727897|ref|YP_001761923.1| preprotein translocase subunit SecG [Shewanella woodyi ATCC
          51908]
 gi|169813244|gb|ACA87828.1| preprotein translocase, SecG subunit [Shewanella woodyi ATCC
          51908]
          Length = 113

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 44/74 (59%), Gaps = 6/74 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M   LMVV+L+V +GLV +ILIQ        ++FG+ ++ T   S+     L R TAILA
Sbjct: 1  MYEVLMVVYLLVAIGLVGLILIQQGKGADMGASFGAGASATLFGSSGAGNFLTRSTAILA 60

Query: 55 FFFFATSIALGMIS 68
            FFA S+ +G +S
Sbjct: 61 IGFFALSLIIGNLS 74


>gi|74420895|gb|ABA05094.1| protein translocase subunit secG [Nitrobacter winogradskyi
          Nb-255]
          Length = 138

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 2/70 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  ++V+HLI+V  L  V+L+Q S+    G      F S R TA+ L R T+ LA  FF
Sbjct: 15 MQTAVIVIHLIIVATLTVVVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTSFLAAGFF 74

Query: 59 ATSIALGMIS 68
           TS+ L  ++
Sbjct: 75 VTSLLLSWLA 84


>gi|288942135|ref|YP_003444375.1| preprotein translocase subunit SecG [Allochromatium vinosum DSM
          180]
 gi|288897507|gb|ADC63343.1| preprotein translocase, SecG subunit [Allochromatium vinosum DSM
          180]
          Length = 152

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 49/92 (53%), Gaps = 8/92 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSNFT--SVRSTAHSLGRFTAILA 54
          MQ  L V+ + + +GL+ ++LIQ    +   +AFGS ++ T    + +   L R TAILA
Sbjct: 1  MQTILTVLQVFLSLGLIGLVLIQHGKGADAGAAFGSGASATVFGAQGSGSFLTRLTAILA 60

Query: 55 FFFFATSIALGMISRYTSTR--YKDNMHRSLV 84
            FF TS+AL   +  TS      D M  ++V
Sbjct: 61 TLFFLTSMALAYYATQTSGPAGLMDKMGDAVV 92


>gi|153844466|ref|ZP_01993661.1| translocase [Vibrio parahaemolyticus AQ3810]
 gi|149745223|gb|EDM56474.1| translocase [Vibrio parahaemolyticus AQ3810]
          Length = 115

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 57/97 (58%), Gaps = 8/97 (8%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
           L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA  FF
Sbjct: 8   LLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILATVFF 67

Query: 59  ATSIALGMISRY-TSTRYKD-NMHRSLVDSIKDQGND 93
             S+ LG +S + T +++ D  + + +V+ +KD  ++
Sbjct: 68  VVSLLLGRMSTHKTESQWVDPTLGQPVVEQVKDAASE 104


>gi|28899233|ref|NP_798838.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260879072|ref|ZP_05891427.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           AN-5034]
 gi|260897743|ref|ZP_05906239.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           Peru-466]
 gi|260900799|ref|ZP_05909194.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           AQ4037]
 gi|28807457|dbj|BAC60722.1| preprotein translocase, SecG subunit [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308088981|gb|EFO38676.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           Peru-466]
 gi|308089558|gb|EFO39253.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           AN-5034]
 gi|308108181|gb|EFO45721.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           AQ4037]
          Length = 112

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 57/97 (58%), Gaps = 8/97 (8%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
           L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA  FF
Sbjct: 5   LLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILATVFF 64

Query: 59  ATSIALGMISRY-TSTRYKD-NMHRSLVDSIKDQGND 93
             S+ LG +S + T +++ D  + + +V+ +KD  ++
Sbjct: 65  VVSLLLGRMSTHKTESQWVDPTLGQPVVEQVKDAASE 101


>gi|328474231|gb|EGF45036.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus 10329]
          Length = 112

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 57/97 (58%), Gaps = 8/97 (8%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
           L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA  FF
Sbjct: 5   LLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILATVFF 64

Query: 59  ATSIALGMISRY-TSTRYKD-NMHRSLVDSIKDQGND 93
             S+ LG +S + T +++ D  + + +V+ +KD  ++
Sbjct: 65  VVSLLLGRMSTHKTESQWVDPTLGQPVVEQVKDAASE 101


>gi|209694187|ref|YP_002262115.1| preprotein translocase subunit SecG [Aliivibrio salmonicida
          LFI1238]
 gi|208008138|emb|CAQ78280.1| protein-export membrane protein SecG (preprotein translocase band
          subunit) [Aliivibrio salmonicida LFI1238]
          Length = 110

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 53/99 (53%), Gaps = 6/99 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRS--TAHSLGRFTAILA 54
          M   L+V++LI  VG++ ++L+Q    +    +FG+ ++ T   S  + + L R TAI A
Sbjct: 1  MHTILLVIYLIAAVGVIGLVLVQHGKGADMGASFGAGASNTVFGSGGSGNFLTRMTAICA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
            FF  S+ALG +S + S  +   + +   + + D  +D
Sbjct: 61 TVFFIISLALGNMSTHKSEGFDLKLDQQATEQVTDNVSD 99


>gi|304322179|ref|YP_003855822.1| hypothetical protein PB2503_13214 [Parvularcula bermudensis
          HTCC2503]
 gi|303301081|gb|ADM10680.1| hypothetical protein PB2503_13214 [Parvularcula bermudensis
          HTCC2503]
          Length = 138

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 39/71 (54%), Gaps = 3/71 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS---NFTSVRSTAHSLGRFTAILAFFF 57
          M   L+ +H ++V+ LV V+L+Q S+  A G      NF S R TA  L R T  L   F
Sbjct: 1  MTAVLLTLHTLIVIALVGVVLLQRSEGGALGMGGGGGNFLSGRGTADVLTRSTTALGAAF 60

Query: 58 FATSIALGMIS 68
          FATS+ L + S
Sbjct: 61 FATSLLLAITS 71


>gi|114799731|ref|YP_760497.1| preprotein translocase, SecG subunit [Hyphomonas neptunium ATCC
           15444]
 gi|114739905|gb|ABI78030.1| preprotein translocase, SecG subunit [Hyphomonas neptunium ATCC
           15444]
          Length = 151

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 58/124 (46%), Gaps = 19/124 (15%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS----SNFTSVRSTAHSLGRFTAILAFF 56
           MQ  ++V+H++  + ++ ++L+Q S+    G      ++  S R  A +L R T I    
Sbjct: 1   MQNVILVIHILACLAMIGLVLVQKSEGGGLGIGGGAGNSLMSGRGAAGALVRTTMIFGAI 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFG---------DGSSPKLDSVS 107
           FFATS+ L  I+     R  DN  R+ ++ I D+ N             D S+P L+  S
Sbjct: 61  FFATSLILTSIAN----RQSDN--RTGIERILDESNPQTAPQDGPVDLFDPSAPLLEETS 114

Query: 108 AKSS 111
             S 
Sbjct: 115 PASP 118


>gi|255261282|ref|ZP_05340624.1| preprotein translocase subunit SecG [Thalassiobium sp. R2A62]
 gi|255103617|gb|EET46291.1| preprotein translocase subunit SecG [Thalassiobium sp. R2A62]
          Length = 121

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 12/116 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT-----SVRSTAHSLGRFTAILAF 55
           M+  +++VHL++ + L+  +L+Q S+    G           S RS A +LG+ T ILA 
Sbjct: 1   MENVVLIVHLLLALSLIGAVLLQRSEGGGLGMGGGGGGGGAMSNRSAATALGKVTWILAI 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
            F  TS+AL +I+   S         S++D + D    + GD   P+ DS+   S+
Sbjct: 61  AFICTSVALTIIAASNSA------GSSVIDRLGDAPAVS-GDADVPEGDSLLPPSA 109


>gi|157962881|ref|YP_001502915.1| preprotein translocase subunit SecG [Shewanella pealeana ATCC
          700345]
 gi|157847881|gb|ABV88380.1| preprotein translocase, SecG subunit [Shewanella pealeana ATCC
          700345]
          Length = 111

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 44/74 (59%), Gaps = 6/74 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M   LMVV+L+V +GLV +ILIQ        ++FG+ ++ T   S+     L R TAILA
Sbjct: 1  MYEVLMVVYLLVSIGLVGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAILA 60

Query: 55 FFFFATSIALGMIS 68
            FFA S+ +G +S
Sbjct: 61 VAFFALSLTIGNLS 74


>gi|162139843|ref|YP_318446.2| preprotein translocase subunit SecG [Nitrobacter winogradskyi
          Nb-255]
          Length = 124

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 2/70 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  ++V+HLI+V  L  V+L+Q S+    G      F S R TA+ L R T+ LA  FF
Sbjct: 1  MQTAVIVIHLIIVATLTVVVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTSFLAAGFF 60

Query: 59 ATSIALGMIS 68
           TS+ L  ++
Sbjct: 61 VTSLLLSWLA 70


>gi|259416202|ref|ZP_05740122.1| preprotein translocase subunit SecG [Silicibacter sp. TrichCH4B]
 gi|259347641|gb|EEW59418.1| preprotein translocase subunit SecG [Silicibacter sp. TrichCH4B]
          Length = 121

 Score = 43.5 bits (101), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 6/108 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAH----SLGRFTAILAFF 56
           M+  ++++HL++ +GL+ V+L+Q S+    G          T      +L + T +LA  
Sbjct: 1   MENVVLIIHLLLALGLIAVVLLQRSEGGGLGMGGGGGGGAMTGRAAATALSKVTWVLAIA 60

Query: 57  FFATSIALGMISRYTSTR--YKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
           F ATSI L +++   S R    D++  S  DS  D      G+   P 
Sbjct: 61  FIATSITLTVLAAQKSGRSSITDSLVPSTQDSTPDAPTSPLGNDLLPP 108


>gi|91229507|ref|ZP_01262931.1| translocase [Vibrio alginolyticus 12G01]
 gi|269968322|ref|ZP_06182344.1| translocase [Vibrio alginolyticus 40B]
 gi|91187393|gb|EAS73748.1| translocase [Vibrio alginolyticus 12G01]
 gi|269827073|gb|EEZ81385.1| translocase [Vibrio alginolyticus 40B]
          Length = 112

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 57/97 (58%), Gaps = 8/97 (8%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
           L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA  FF
Sbjct: 5   LLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRTTAILATVFF 64

Query: 59  ATSIALGMISRY-TSTRYKD-NMHRSLVDSIKDQGND 93
             S+ LG +S + T +++ D  + + +V+ +KD  ++
Sbjct: 65  IVSLLLGRMSTHQTESQWVDPTLGQPVVEQVKDAASE 101


>gi|163752376|ref|ZP_02159571.1| preprotein translocase, SecG subunit [Shewanella benthica KT99]
 gi|161327748|gb|EDP98935.1| preprotein translocase, SecG subunit [Shewanella benthica KT99]
          Length = 106

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 53/97 (54%), Gaps = 13/97 (13%)

Query: 6  MVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFFA 59
          MVV+L+V +GLV +ILIQ        ++FG+ ++ T   S+     L R TA+LA  FFA
Sbjct: 1  MVVYLLVAIGLVGLILIQQGKGADMGASFGAGASATLFGSSGAGNFLTRSTAVLAIGFFA 60

Query: 60 TSIALGMISRYTSTRYKD------NMHRSLVDSIKDQ 90
           S+ +G +S    TR +D      N    +VD + ++
Sbjct: 61 LSLIIGNLSA-NHTRSEDAWNDLSNDAAQVVDQVSEE 96


>gi|269961977|ref|ZP_06176332.1| translocase [Vibrio harveyi 1DA3]
 gi|269833300|gb|EEZ87404.1| translocase [Vibrio harveyi 1DA3]
          Length = 112

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 57/97 (58%), Gaps = 8/97 (8%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
           L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA  FF
Sbjct: 5   LLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILATVFF 64

Query: 59  ATSIALGMISRY-TSTRYKD-NMHRSLVDSIKDQGND 93
             S+ LG +S + T +++ D  + + +V+ +KD  ++
Sbjct: 65  IISLLLGRMSTHKTESQWVDPTLGQPVVEQVKDAASE 101


>gi|29654740|ref|NP_820432.1| protein translocase subunit [Coxiella burnetii RSA 493]
 gi|153207275|ref|ZP_01946039.1| preprotein translocase, SecG subunit [Coxiella burnetii 'MSU Goat
          Q177']
 gi|154707766|ref|YP_001423955.1| protein translocase subunit [Coxiella burnetii Dugway 5J108-111]
 gi|161831118|ref|YP_001597294.1| preprotein translocase, SecG subunit [Coxiella burnetii RSA 331]
 gi|165918781|ref|ZP_02218867.1| preprotein translocase, SecG subunit [Coxiella burnetii RSA 334]
 gi|212212181|ref|YP_002303117.1| protein translocase subunit [Coxiella burnetii CbuG_Q212]
 gi|212218211|ref|YP_002304998.1| protein translocase subunit [Coxiella burnetii CbuK_Q154]
 gi|29542008|gb|AAO90946.1| protein translocase subunit [Coxiella burnetii RSA 493]
 gi|120576763|gb|EAX33387.1| preprotein translocase, SecG subunit [Coxiella burnetii 'MSU Goat
          Q177']
 gi|154357052|gb|ABS78514.1| protein translocase subunit [Coxiella burnetii Dugway 5J108-111]
 gi|161762985|gb|ABX78627.1| preprotein translocase, SecG subunit [Coxiella burnetii RSA 331]
 gi|165917505|gb|EDR36109.1| preprotein translocase, SecG subunit [Coxiella burnetii RSA 334]
 gi|212010591|gb|ACJ17972.1| protein translocase subunit [Coxiella burnetii CbuG_Q212]
 gi|212012473|gb|ACJ19853.1| protein translocase subunit [Coxiella burnetii CbuK_Q154]
          Length = 98

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 50/90 (55%), Gaps = 12/90 (13%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSN---FTSVRSTAHSLGRFTAIL 53
          MQ  ++++H+++ V L+ ++L+Q    +   +AFGS S+   F SV +T   L + T  L
Sbjct: 1  MQSIILIIHVLIAVCLIALVLLQHGKGADAGAAFGSGSSNTMFGSVGATPF-LMKITIFL 59

Query: 54 AFFFFATSIALGMISRYTSTRYKDNMHRSL 83
          A  FFATSI L     Y ++R+   M   L
Sbjct: 60 AAAFFATSIGL----SYLASRHPGTMAPPL 85


>gi|226946310|ref|YP_002801383.1| preprotein translocase subunit SecG [Azotobacter vinelandii DJ]
 gi|226721237|gb|ACO80408.1| Preprotein translocase SecG subunit [Azotobacter vinelandii DJ]
          Length = 129

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 6/74 (8%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSNFTSVRSTAHS--LGRFTAILAF 55
          +  ++V HL+  +G++ ++LIQ    +   ++FGS ++ T   S   S  L R TAILA 
Sbjct: 5  ETIVIVFHLLAALGVIALVLIQQGKGAEAGASFGSGASATVFGSQGSSTFLSRVTAILAT 64

Query: 56 FFFATSIALGMISR 69
           FF TS+ LG +++
Sbjct: 65 AFFLTSLGLGFLAK 78


>gi|119504347|ref|ZP_01626427.1| secretion protein SecG [marine gamma proteobacterium HTCC2080]
 gi|119459855|gb|EAW40950.1| secretion protein SecG [marine gamma proteobacterium HTCC2080]
          Length = 142

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (58%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS-------AFGSSSNFTSVRSTAHSLGRFTAIL 53
          M+  ++VVHL+V +G++ +I++Q    +       A GS + F SV S A+ L + TA L
Sbjct: 1  MEQIILVVHLLVALGIIGLIMMQQGKGADIGASFGAGGSQTLFGSVGS-ANLLTKLTAWL 59

Query: 54 AFFFFATSIALGMIS 68
             FFA+S  L MI+
Sbjct: 60 VAAFFASSFGLAMIA 74


>gi|254469843|ref|ZP_05083248.1| preprotein translocase, SecG subunit [Pseudovibrio sp. JE062]
 gi|211961678|gb|EEA96873.1| preprotein translocase, SecG subunit [Pseudovibrio sp. JE062]
          Length = 121

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 36/65 (55%), Gaps = 14/65 (21%)

Query: 38  SVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIK--------D 89
           S R TA+ L R TAILA  FFATS+AL +++RY      D    SL+D +         +
Sbjct: 42  SSRGTANVLTRGTAILAVCFFATSLALSLLARY------DERPGSLLDQVPAGSATQGTE 95

Query: 90  QGNDN 94
           QG+ N
Sbjct: 96  QGSGN 100


>gi|156975666|ref|YP_001446573.1| preprotein translocase subunit SecG [Vibrio harveyi ATCC
          BAA-1116]
 gi|156527260|gb|ABU72346.1| hypothetical protein VIBHAR_03401 [Vibrio harveyi ATCC BAA-1116]
          Length = 112

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 55/93 (59%), Gaps = 8/93 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA  FF
Sbjct: 5  LLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILATVFF 64

Query: 59 ATSIALGMISRY-TSTRYKD-NMHRSLVDSIKD 89
            S+ LG +S + T +++ D  + + +V+ +KD
Sbjct: 65 IVSLLLGRMSTHKTESQWVDPTLGQPVVEQVKD 97


>gi|86136597|ref|ZP_01055176.1| preprotein translocase, SecG subunit [Roseobacter sp. MED193]
 gi|85827471|gb|EAQ47667.1| preprotein translocase, SecG subunit [Roseobacter sp. MED193]
          Length = 124

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 52/97 (53%), Gaps = 7/97 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRSTAHSLGRFTAILAF 55
          M+  ++++HL++ +GL+ V+L+Q S+       + G      S RS A +LG+ T +LA 
Sbjct: 1  MENVVLIIHLLLALGLIAVVLLQRSEGGGLGMGSGGGGGGAMSGRSAATALGKVTWVLAI 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
           F  TSI L +++   S     ++   ++ S  + GN
Sbjct: 61 CFICTSITLTVLAAKKSA--GSSVADGILPSTTESGN 95


>gi|296116176|ref|ZP_06834794.1| preprotein translocase, SecG subunit [Gluconacetobacter hansenii
          ATCC 23769]
 gi|295977282|gb|EFG84042.1| preprotein translocase, SecG subunit [Gluconacetobacter hansenii
          ATCC 23769]
          Length = 101

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-----NFTSVRSTAHSLGRFTAILAF 55
          M   L+++HL V V L+  ILIQ S+    G  S     +F S R TA  L R TA+L  
Sbjct: 1  MITVLLLLHLFVTVALIGTILIQRSEGGGLGIGSSQGMGSFMSGRGTATLLTRSTAVLGT 60

Query: 56 FFFATSIALGMISRYTS 72
           F   S+ L +++R  S
Sbjct: 61 IFMVLSLTLAIMNRGAS 77


>gi|15599941|ref|NP_253435.1| preprotein translocase subunit SecG [Pseudomonas aeruginosa PAO1]
 gi|152989544|ref|YP_001350789.1| preprotein translocase subunit SecG [Pseudomonas aeruginosa PA7]
 gi|218893842|ref|YP_002442711.1| preprotein translocase subunit SecG [Pseudomonas aeruginosa
          LESB58]
 gi|254238517|ref|ZP_04931840.1| secretion protein SecG [Pseudomonas aeruginosa C3719]
 gi|254244351|ref|ZP_04937673.1| secretion protein SecG [Pseudomonas aeruginosa 2192]
 gi|296391574|ref|ZP_06881049.1| preprotein translocase subunit SecG [Pseudomonas aeruginosa PAb1]
 gi|313109728|ref|ZP_07795668.1| secretion protein SecG [Pseudomonas aeruginosa 39016]
 gi|13959569|sp|Q9HV52|SECG_PSEAE RecName: Full=Protein-export membrane protein secG
 gi|9951009|gb|AAG08133.1|AE004888_8 secretion protein SecG [Pseudomonas aeruginosa PAO1]
 gi|126170448|gb|EAZ55959.1| secretion protein SecG [Pseudomonas aeruginosa C3719]
 gi|126197729|gb|EAZ61792.1| secretion protein SecG [Pseudomonas aeruginosa 2192]
 gi|150964702|gb|ABR86727.1| protein-export membrane protein SecG [Pseudomonas aeruginosa PA7]
 gi|218774070|emb|CAW29886.1| secretion protein SecG [Pseudomonas aeruginosa LESB58]
 gi|310882170|gb|EFQ40764.1| secretion protein SecG [Pseudomonas aeruginosa 39016]
          Length = 129

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 51/92 (55%), Gaps = 9/92 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ---SSDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          ++  ++VVHL++ +GLV +IL+Q    +D+ A FG+ ++ T    + +A  L R T ILA
Sbjct: 2  LEKVVIVVHLLMALGLVGLILVQHGKGADAGASFGAGASATVFGSQGSATFLSRITGILA 61

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDS 86
            FF TS+ L   ++  S   +   H  L D 
Sbjct: 62 AVFFLTSLGLAYFAKEKSDALQ---HIGLPDP 90


>gi|302036467|ref|YP_003796789.1| preprotein translocase, membrane subunit SecG [Candidatus
          Nitrospira defluvii]
 gi|300604531|emb|CBK40863.1| Preprotein translocase, membrane subunit SecG [Candidatus
          Nitrospira defluvii]
          Length = 117

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 7/75 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSN--FTSVRSTAHSLGRFTAILA 54
          M   L+++H+IV + ++  IL+QS   +    AFG SS   F S R  A+ L +FT I A
Sbjct: 1  MYTLLIIIHVIVCLLMIGAILLQSGKGAEIGAAFGGSSQTVFGS-RGPANFLSKFTVITA 59

Query: 55 FFFFATSIALGMISR 69
          F F  TS++L +I++
Sbjct: 60 FVFMFTSLSLAIIAK 74


>gi|27365054|ref|NP_760582.1| preprotein translocase subunit SecG [Vibrio vulnificus CMCP6]
 gi|37680895|ref|NP_935504.1| preprotein translocase subunit SecG [Vibrio vulnificus YJ016]
 gi|320155438|ref|YP_004187817.1| preprotein translocase subunit SecG [Vibrio vulnificus MO6-24/O]
 gi|27361200|gb|AAO10109.1| preprotein translocase, SecG subunit [Vibrio vulnificus CMCP6]
 gi|37199645|dbj|BAC95475.1| preprotein translocase subunit SecG [Vibrio vulnificus YJ016]
 gi|319930750|gb|ADV85614.1| preprotein translocase subunit SecG [Vibrio vulnificus MO6-24/O]
          Length = 110

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 52/92 (56%), Gaps = 7/92 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA  FF
Sbjct: 5  LLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILATVFF 64

Query: 59 ATSIALGMISRY-TSTRYKDNMHRSLVDSIKD 89
            S+ LG +S +   +++ D     +V+ ++D
Sbjct: 65 IVSLTLGRMSTHKAESQWVDPTQGQVVEQVQD 96


>gi|308050587|ref|YP_003914153.1| protein translocase subunit secG [Ferrimonas balearica DSM 9799]
 gi|307632777|gb|ADN77079.1| protein translocase subunit secG [Ferrimonas balearica DSM 9799]
          Length = 106

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 55/93 (59%), Gaps = 8/93 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          LMVV+L+V +G++ ++LIQ    +S  ++FG+ ++ T   S+     L R TA+LA  FF
Sbjct: 5  LMVVYLLVALGIIGLVLIQQGQGASMGASFGAGASATLFGSSGSGNFLTRATALLATAFF 64

Query: 59 ATSIALGMISRYTS--TRYKDNMHRSLVDSIKD 89
            S+ LG +S +++  T   D ++  +V+   +
Sbjct: 65 VLSLVLGRMSAHSAKPTEGWDEINVPVVEQPAE 97


>gi|116052894|ref|YP_793211.1| preprotein translocase subunit SecG [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115588115|gb|ABJ14130.1| secretion protein SecG [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 129

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 60/114 (52%), Gaps = 15/114 (13%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQ---SSDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
           ++  ++VVHL++ +GLV +IL+Q    +D+ A FG+ ++ T    + +A  L R T ILA
Sbjct: 2   LEKVVIVVHLLMALGLVGLILVQHGKGADAGASFGAGASATVFGSQGSATFLSRITGILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVD-SIKDQGNDNFGDGSSPKLDSVS 107
             FF TS+ L   ++  S   +   H  L D ++ +Q  +      +P  D V 
Sbjct: 62  AVFFLTSLGLAYFAKEKSDALQ---HIGLPDPAVLEQKQEK-----APAADDVP 107


>gi|17982794|gb|AAL52028.1| hypothetical protein BMEI0847 [Brucella melitensis bv. 1 str.
          16M]
          Length = 129

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 31/46 (67%), Gaps = 1/46 (2%)

Query: 36 FTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHR 81
          F + R  A++L R TAILA  FFATS+ LG+++RY   R  D ++R
Sbjct: 19 FMTARGAANALTRTTAILAIGFFATSLLLGIMARY-GERPTDILNR 63


>gi|237805249|ref|ZP_04591953.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          oryzae str. 1_6]
 gi|331026357|gb|EGI06412.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          oryzae str. 1_6]
          Length = 142

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 47/75 (62%), Gaps = 6/75 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          ++  ++V HL+  +G+V ++L+Q    +D+ A FG+ ++ T    + TA  L +FTAILA
Sbjct: 18 LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTATFLSKFTAILA 77

Query: 55 FFFFATSIALGMISR 69
            FF TS+ LG  ++
Sbjct: 78 ACFFITSLGLGYFAK 92


>gi|294083770|ref|YP_003550527.1| preprotein translocase SecG subunit [Candidatus Puniceispirillum
          marinum IMCC1322]
 gi|292663342|gb|ADE38443.1| preprotein translocase SecG subunit [Candidatus Puniceispirillum
          marinum IMCC1322]
          Length = 103

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 5/73 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
          MQ  ++ +H+++ +GLV  +L+Q S+    G         F + R TA+ + R T +LA 
Sbjct: 1  MQTLVLTIHILIALGLVGAVLLQRSEGGGLGIGGGGSGGGFMTARGTANLMTRVTTVLAA 60

Query: 56 FFFATSIALGMIS 68
           FF TSI L +++
Sbjct: 61 GFFTTSIILAIMA 73


>gi|315499881|ref|YP_004088684.1| preprotein translocase, secg subunit [Asticcacaulis excentricus
          CB 48]
 gi|315417893|gb|ADU14533.1| preprotein translocase, SecG subunit [Asticcacaulis excentricus
          CB 48]
          Length = 180

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 50/95 (52%), Gaps = 12/95 (12%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGS---SSNFTSVRSTAHSLGRFTAILAFFFFA 59
          + L+ + +++ + LV +IL+Q S+  A G     S F S R   + L + T+ILAF FFA
Sbjct: 4  VILLSIQILIGIALVGLILVQRSEGGALGMGGGPSGFMSARGAGNFLTKATSILAFLFFA 63

Query: 60 TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN 94
            IAL ++S        D    S+VD +   G DN
Sbjct: 64 NCIALTVVSNL------DRRGTSVVDQV---GADN 89


>gi|89067833|ref|ZP_01155277.1| preprotein translocase, SecG subunit [Oceanicola granulosus
           HTCC2516]
 gi|89046431|gb|EAR52487.1| preprotein translocase, SecG subunit [Oceanicola granulosus
           HTCC2516]
          Length = 120

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 52/104 (50%), Gaps = 9/104 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV---RSTAHSLGRFTAILAFFF 57
           M+  +++VHL++ + L+ V+L+Q S+    G       +   RS A +LG+ T  LA  F
Sbjct: 1   MENVILIVHLLLALSLIGVVLMQRSEGGGLGIGGGGGGMMTGRSAATALGKVTWGLAVAF 60

Query: 58  FATSIALGMISRYTST------RYKDNMHRSLVDSIKDQGNDNF 95
             TSIAL +++   S       R  D    +  D++ D G ++ 
Sbjct: 61  IITSIALTIMAARDSASGSVLDRITDTPAGAASDALPDLGGESL 104


>gi|167625062|ref|YP_001675356.1| preprotein translocase subunit SecG [Shewanella halifaxensis
          HAW-EB4]
 gi|167355084|gb|ABZ77697.1| preprotein translocase, SecG subunit [Shewanella halifaxensis
          HAW-EB4]
          Length = 111

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 43/70 (61%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          LM+++L+V +GLV +ILIQ        ++FG+ ++ T   S+     L R TA+LA  FF
Sbjct: 5  LMIIYLMVAIGLVGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAVLAVAFF 64

Query: 59 ATSIALGMIS 68
          A S+ +G +S
Sbjct: 65 ALSLTIGNLS 74


>gi|311277851|ref|YP_003940082.1| preprotein translocase, SecG subunit [Enterobacter cloacae SCF1]
 gi|308747046|gb|ADO46798.1| preprotein translocase, SecG subunit [Enterobacter cloacae SCF1]
          Length = 109

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 50/92 (54%), Gaps = 8/92 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q    +    +FG+ ++ T   S+     + R TAILA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAILATLFF 64

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
            S+ALG I+  T+   K +   +L     +Q
Sbjct: 65 IISLALGNIN--TNKTNKGSEWENLTAPKSEQ 94


>gi|237798560|ref|ZP_04587021.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          oryzae str. 1_6]
 gi|237803809|ref|ZP_04591394.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          oryzae str. 1_6]
 gi|331021413|gb|EGI01470.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          oryzae str. 1_6]
 gi|331025789|gb|EGI05845.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          oryzae str. 1_6]
          Length = 126

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 47/75 (62%), Gaps = 6/75 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          ++  ++V HL+  +G+V ++L+Q    +D+ A FG+ ++ T    + TA  L +FTAILA
Sbjct: 2  LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTATFLSKFTAILA 61

Query: 55 FFFFATSIALGMISR 69
            FF TS+ LG  ++
Sbjct: 62 ACFFITSLGLGYFAK 76


>gi|323491476|ref|ZP_08096659.1| preprotein translocase subunit SecG [Vibrio brasiliensis LMG 20546]
 gi|323314260|gb|EGA67341.1| preprotein translocase subunit SecG [Vibrio brasiliensis LMG 20546]
          Length = 110

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 57/110 (51%), Gaps = 12/110 (10%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
           L+V++L+  VG++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 5   LLVIYLLAAVGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFATVFF 64

Query: 59  ATSIALGMISRY-TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             S+ LG +S + T +++ D     ++     Q  D+  D  +P+ D + 
Sbjct: 65  VISLVLGNMSTHKTESQWVDPTQGQVI-----QQADDASDIPAPQGDEIP 109


>gi|229592639|ref|YP_002874758.1| preprotein translocase subunit SecG [Pseudomonas fluorescens
          SBW25]
 gi|229364505|emb|CAY52355.1| general secretory pathway, protein-export membrane protein
          [Pseudomonas fluorescens SBW25]
          Length = 127

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 6/75 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFTSVRSTAHS--LGRFTAILA 54
          ++  ++V HL+  +G+V ++L+Q    +D+ A FG+ ++ T   S   S  L +FTAILA
Sbjct: 2  LETVVVVFHLLAALGVVALVLLQQGKGADAGASFGAGASNTVFGSQGSSTFLSKFTAILA 61

Query: 55 FFFFATSIALGMISR 69
            FF TS+ LG  ++
Sbjct: 62 AGFFITSLGLGYFAK 76


>gi|114562165|ref|YP_749678.1| preprotein translocase subunit SecG [Shewanella frigidimarina
          NCIMB 400]
 gi|114333458|gb|ABI70840.1| protein translocase subunit secG [Shewanella frigidimarina NCIMB
          400]
          Length = 111

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (58%), Gaps = 9/82 (10%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV+L+V +GL+ +ILIQ        ++FG+ ++ T   S+     L R TA+LA  FF
Sbjct: 5  LIVVYLVVALGLIGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAVLAIGFF 64

Query: 59 ATSIALGMIS---RYTSTRYKD 77
          A S+ +G +S      + ++KD
Sbjct: 65 ALSLVIGNLSANHTEQNEQWKD 86


>gi|160871839|ref|ZP_02061971.1| preprotein translocase SecG subunit [Rickettsiella grylli]
 gi|159120638|gb|EDP45976.1| preprotein translocase SecG subunit [Rickettsiella grylli]
          Length = 116

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 53/91 (58%), Gaps = 9/91 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHS--LGRFTAILA 54
          +Q FL+++H+I+ + L+ ++LIQ    +     FGS+++ T   S   S  L + T + A
Sbjct: 2  LQQFLVLMHVIISLALIALVLIQQDKGAELGATFGSAASQTVFGSQGSSSFLLKLTGLFA 61

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVD 85
            FF TS++LG ++ +   R K +  ++LV+
Sbjct: 62 LLFFMTSLSLGYLAGH---RAKQDPIQNLVN 89


>gi|260459246|ref|ZP_05807501.1| preprotein translocase, SecG subunit [Mesorhizobium opportunistum
          WSM2075]
 gi|259034800|gb|EEW36056.1| preprotein translocase, SecG subunit [Mesorhizobium opportunistum
          WSM2075]
          Length = 158

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 46/72 (63%), Gaps = 2/72 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL+VV+ LV V+L+Q S+    G      F + R  A++L R TAILA  FF
Sbjct: 1  MQTVLIVIHLMVVLALVGVVLLQRSEGGGLGIGGGSGFMTARGAANALTRATAILAAAFF 60

Query: 59 ATSIALGMISRY 70
           TS+ L +I+RY
Sbjct: 61 VTSLTLSIIARY 72


>gi|91792364|ref|YP_562015.1| preprotein translocase subunit SecG [Shewanella denitrificans
          OS217]
 gi|91714366|gb|ABE54292.1| protein translocase subunit secG [Shewanella denitrificans OS217]
          Length = 110

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          LMVV+L+V +GLV +ILIQ        ++FG+ ++ T   S+     L R TA+LA  FF
Sbjct: 5  LMVVYLMVSIGLVGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAVLAIGFF 64

Query: 59 ATSIALGMIS 68
          A S+ +G +S
Sbjct: 65 ALSLIIGNLS 74


>gi|163802300|ref|ZP_02196194.1| translocase [Vibrio sp. AND4]
 gi|159173829|gb|EDP58643.1| translocase [Vibrio sp. AND4]
          Length = 112

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 56/97 (57%), Gaps = 8/97 (8%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
           L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA  FF
Sbjct: 5   LLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRTTAILATVFF 64

Query: 59  ATSIALGMISRY-TSTRYKD-NMHRSLVDSIKDQGND 93
             S+ LG +S +   +++ D  + + +V+ IKD  ++
Sbjct: 65  IISLLLGRMSTHKAESQWVDPTLGQPVVEQIKDAASE 101


>gi|294142063|ref|YP_003558041.1| preprotein translocase subunit SecG [Shewanella violacea DSS12]
 gi|293328532|dbj|BAJ03263.1| preprotein translocase, SecG subunit [Shewanella violacea DSS12]
          Length = 111

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 54/98 (55%), Gaps = 13/98 (13%)

Query: 5   LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
           L+V++L+V +GLV +ILIQ        ++FG+ ++ T   S+     L R TA+LA  FF
Sbjct: 5   LIVIYLLVAIGLVGLILIQQGKGADMGASFGAGASATLFGSSGAGNFLTRSTAVLAIGFF 64

Query: 59  ATSIALGMISRYTSTRYKD------NMHRSLVDSIKDQ 90
           A S+ +G +S    T+ +D      N    +VD + ++
Sbjct: 65  ALSLIIGNLSA-NHTKSEDAWSDLSNEAAQVVDQVSEE 101


>gi|13470810|ref|NP_102379.1| preprotein translocase subunit SecG [Mesorhizobium loti
          MAFF303099]
 gi|14021553|dbj|BAB48165.1| protein-export membrane protein [Mesorhizobium loti MAFF303099]
          Length = 154

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 46/72 (63%), Gaps = 2/72 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL+VV+ LV V+L+Q S+    G      F + R  A++L R TAILA  FF
Sbjct: 1  MQTVLIVIHLMVVLALVGVVLLQRSEGGGLGIGGGSGFMTARGAANALTRATAILAAAFF 60

Query: 59 ATSIALGMISRY 70
           TS+ L +I+RY
Sbjct: 61 VTSLTLSIIARY 72


>gi|298488453|ref|ZP_07006484.1| preprotein translocase subunit [Pseudomonas savastanoi pv.
          savastanoi NCPPB 3335]
 gi|298157078|gb|EFH98167.1| preprotein translocase subunit [Pseudomonas savastanoi pv.
          savastanoi NCPPB 3335]
          Length = 142

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 49/80 (61%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          ++  ++V HL+  +G+V ++L+Q    +D+ A FG+ ++ T    + T+  L +FTAILA
Sbjct: 18 LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 77

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF TS+ LG  ++  + +
Sbjct: 78 ACFFITSLGLGYFAKEKAQQ 97


>gi|94501387|ref|ZP_01307907.1| preprotein translocase, SecG subunit [Oceanobacter sp. RED65]
 gi|94426500|gb|EAT11488.1| preprotein translocase, SecG subunit [Oceanobacter sp. RED65]
          Length = 120

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 62/123 (50%), Gaps = 12/123 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLG------RFTAILA 54
           M+  +++ H+IV + ++ ++LIQ    +  G+S    + ++   S G      R T++LA
Sbjct: 1   MESIILIFHIIVAIAIIGLVLIQQGKGAEAGASFGGGASQTVFGSAGSGNFLTRSTSVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKD--QGNDNFGDGSSPKLDSVSAKSSS 112
             FFATS AL     Y + +  D +  + + S+++  Q  D   +   P ++  + ++ +
Sbjct: 61  VVFFATSFAL----AYVAKQKADGLVDAGLPSVQEVQQIEDAVQESEVPVVEESAPETDA 116

Query: 113 SVV 115
            +V
Sbjct: 117 PIV 119


>gi|289624599|ref|ZP_06457553.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          aesculi str. NCPPB3681]
 gi|289646958|ref|ZP_06478301.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          aesculi str. 2250]
 gi|330868243|gb|EGH02952.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          aesculi str. 0893_23]
          Length = 126

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 49/80 (61%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          ++  ++V HL+  +G+V ++L+Q    +D+ A FG+ ++ T    + T+  L +FTAILA
Sbjct: 2  LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF TS+ LG  ++  + +
Sbjct: 62 ACFFITSLGLGYFAKEKAQQ 81


>gi|66047410|ref|YP_237251.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          syringae B728a]
 gi|289676021|ref|ZP_06496911.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          syringae FF5]
 gi|302185429|ref|ZP_07262102.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          syringae 642]
 gi|3024606|sp|P95577|SECG_PSEU2 RecName: Full=Protein-export membrane protein secG
 gi|1835602|gb|AAC45132.1| SecG [Pseudomonas syringae pv. syringae]
 gi|63258117|gb|AAY39213.1| Preprotein translocase SecG subunit [Pseudomonas syringae pv.
          syringae B728a]
 gi|330888661|gb|EGH21322.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          mori str. 301020]
 gi|330895308|gb|EGH27646.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          japonica str. M301072PT]
 gi|330937943|gb|EGH41730.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          pisi str. 1704B]
 gi|330950308|gb|EGH50568.1| preprotein translocase subunit SecG [Pseudomonas syringae Cit 7]
 gi|330969648|gb|EGH69714.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          aceris str. M302273PT]
 gi|330981087|gb|EGH79190.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          aptata str. DSM 50252]
          Length = 126

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 49/80 (61%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          ++  ++V HL+  +G+V ++L+Q    +D+ A FG+ ++ T    + T+  L +FTAILA
Sbjct: 2  LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF TS+ LG  ++  + +
Sbjct: 62 ACFFITSLGLGYFAKEKAQQ 81


>gi|114764013|ref|ZP_01443254.1| preprotein translocase, SecG subunit [Pelagibaca bermudensis
          HTCC2601]
 gi|114543605|gb|EAU46619.1| preprotein translocase, SecG subunit [Roseovarius sp. HTCC2601]
          Length = 127

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 2/70 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV--RSTAHSLGRFTAILAFFFF 58
          MQ  +++VHL++ + L+  +L+Q S+    G      ++  R+ A +LG+ T ILA  F 
Sbjct: 1  MQNVILIVHLLLALSLIGAVLLQRSEGGGLGMGGGGGAMSQRAAATALGKVTWILAIGFI 60

Query: 59 ATSIALGMIS 68
           TSI L +++
Sbjct: 61 VTSITLTILA 70


>gi|28871627|ref|NP_794246.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          tomato str. DC3000]
 gi|213966650|ref|ZP_03394801.1| preprotein translocase, SecG subunit [Pseudomonas syringae pv.
          tomato T1]
 gi|301383160|ref|ZP_07231578.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          tomato Max13]
 gi|302063405|ref|ZP_07254946.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          tomato K40]
 gi|302133778|ref|ZP_07259768.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          tomato NCPPB 1108]
 gi|28854879|gb|AAO57941.1| preprotein translocase, SecG subunit [Pseudomonas syringae pv.
          tomato str. DC3000]
 gi|213928500|gb|EEB62044.1| preprotein translocase, SecG subunit [Pseudomonas syringae pv.
          tomato T1]
 gi|331016645|gb|EGH96701.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          lachrymans str. M302278PT]
          Length = 126

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 49/80 (61%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          ++  ++V HL+  +G+V ++L+Q    +D+ A FG+ ++ T    + T+  L +FTAILA
Sbjct: 2  LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF TS+ LG  ++  + +
Sbjct: 62 ACFFITSLGLGYFAKEKAQQ 81


>gi|330877236|gb|EGH11385.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          morsprunorum str. M302280PT]
          Length = 126

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 49/80 (61%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          ++  ++V HL+  +G+V ++L+Q    +D+ A FG+ ++ T    + T+  L +FTAILA
Sbjct: 2  LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF TS+ LG  ++  + +
Sbjct: 62 ACFFITSLGLGYFAKEKAQQ 81


>gi|157148744|ref|YP_001456063.1| preprotein translocase subunit SecG [Citrobacter koseri ATCC
          BAA-895]
 gi|157085949|gb|ABV15627.1| hypothetical protein CKO_04576 [Citrobacter koseri ATCC BAA-895]
          Length = 110

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q    +    +FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ALG I+
Sbjct: 65 IISLALGNIN 74


>gi|209963460|ref|YP_002296375.1| preprotein translocase, SecG subunit, putative [Rhodospirillum
          centenum SW]
 gi|209956926|gb|ACI97562.1| preprotein translocase, SecG subunit, putative [Rhodospirillum
          centenum SW]
          Length = 117

 Score = 41.6 bits (96), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M+  ++VVHL++ V LV V+LIQ S+        G+     + R +A+ L R TAILA  
Sbjct: 1  MEKVVLVVHLLIAVSLVGVVLIQKSEGGGLGIGGGTMGGLMTTRGSANLLTRTTAILAAC 60

Query: 57 FFATSIALGMISRYT 71
          FF TS+ L  ++  T
Sbjct: 61 FFTTSLVLAAMTGAT 75


>gi|85058352|ref|YP_454054.1| preprotein translocase subunit SecG [Sodalis glossinidius str.
           'morsitans']
 gi|84778872|dbj|BAE73649.1| protein-export protein SecG [Sodalis glossinidius str. 'morsitans']
          Length = 110

 Score = 41.6 bits (96), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 51/103 (49%), Gaps = 14/103 (13%)

Query: 5   LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
           L+V+ L+V VGLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5   LLVIFLLVAVGLVALIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAVLATLFF 64

Query: 59  ATSIALGMI--------SRYTSTRYKDNMHRSLVDSIKDQGND 93
             S+ LG +        S++ +        ++  ++    GND
Sbjct: 65  VLSLVLGNLSSNHGQKGSQWDNLNQAQQADKAPAEAPAKPGND 107


>gi|300113264|ref|YP_003759839.1| preprotein translocase subunit SecG [Nitrosococcus watsonii
          C-113]
 gi|299539201|gb|ADJ27518.1| preprotein translocase, SecG subunit [Nitrosococcus watsonii
          C-113]
          Length = 153

 Score = 41.6 bits (96), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 42/74 (56%), Gaps = 6/74 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSNFT--SVRSTAHSLGRFTAILA 54
          M   L+V H++V + LV ++LIQ    +   +AFGS ++ T    R +   L R +AILA
Sbjct: 1  MHSVLLVFHIVVAIALVGLVLIQHGKGADAGAAFGSGASATVFGARGSGSFLTRASAILA 60

Query: 55 FFFFATSIALGMIS 68
            FF TS++L   S
Sbjct: 61 AAFFITSLSLAYFS 74


>gi|71734190|ref|YP_276314.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          phaseolicola 1448A]
 gi|257482264|ref|ZP_05636305.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          tabaci ATCC 11528]
 gi|71554743|gb|AAZ33954.1| preprotein translocase, SecG subunit [Pseudomonas syringae pv.
          phaseolicola 1448A]
 gi|320330000|gb|EFW85987.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          glycinea str. race 4]
 gi|330875223|gb|EGH09372.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          glycinea str. race 4]
 gi|330987052|gb|EGH85155.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          lachrymans str. M301315]
 gi|331011496|gb|EGH91552.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          tabaci ATCC 11528]
          Length = 126

 Score = 41.6 bits (96), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 49/80 (61%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          ++  ++V HL+  +G+V ++L+Q    +D+ A FG+ ++ T    + T+  L +FTAILA
Sbjct: 2  LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF TS+ LG  ++  + +
Sbjct: 62 ACFFITSLGLGYFAKEKAQQ 81


>gi|312113151|ref|YP_004010747.1| preprotein translocase, SecG subunit [Rhodomicrobium vannielii
          ATCC 17100]
 gi|311218280|gb|ADP69648.1| preprotein translocase, SecG subunit [Rhodomicrobium vannielii
          ATCC 17100]
          Length = 119

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS-----TAHSLGRFTAILAFFFFA 59
          L+V+H++V V +V +IL+Q S+  A G                A+ + R TAILA  FF 
Sbjct: 5  LLVLHIVVAVTMVVIILLQRSEGGALGMGGGGGGGGFVSGRGAANVMTRTTAILAAIFFL 64

Query: 60 TSIALGMI-SRYTST 73
          TSI LG++  R T T
Sbjct: 65 TSITLGILGQRKTPT 79


>gi|262393379|ref|YP_003285233.1| preprotein translocase subunit SecG [Vibrio sp. Ex25]
 gi|262336973|gb|ACY50768.1| preprotein translocase subunit SecG [Vibrio sp. Ex25]
          Length = 112

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 53/97 (54%), Gaps = 8/97 (8%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
           L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA  FF
Sbjct: 5   LLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRTTAILATVFF 64

Query: 59  ATSIALGMIS--RYTSTRYKDNMHRSLVDSIKDQGND 93
             S+ LG +S  +  S      + + +V+ +KD  ++
Sbjct: 65  IVSLLLGRMSTHKIESQWVDPTLGQPVVEQVKDAASE 101


>gi|330963972|gb|EGH64232.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          actinidiae str. M302091]
          Length = 126

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 49/80 (61%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          ++  ++V HL+  +G+V ++L+Q    +D+ A FG+ ++ T    + T+  L +FTAILA
Sbjct: 2  LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF TS+ LG  ++  + +
Sbjct: 62 ACFFITSLGLGYFAKEKAQQ 81


>gi|77457003|ref|YP_346508.1| preprotein translocase subunit SecG [Pseudomonas fluorescens
          Pf0-1]
 gi|77381006|gb|ABA72519.1| general secretory pathway, protein-export membrane protein
          [Pseudomonas fluorescens Pf0-1]
          Length = 127

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 6/75 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFTSVRSTAHS--LGRFTAILA 54
          ++  ++V HL+  +G+V ++L+Q    +D+ A FG+ ++ T   S   S  L +FTAILA
Sbjct: 2  LETVVVVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGSQGSSTFLSKFTAILA 61

Query: 55 FFFFATSIALGMISR 69
            FF TS+ LG  ++
Sbjct: 62 AGFFITSLGLGYFAK 76


>gi|329893947|ref|ZP_08269982.1| Preprotein translocase subunit SecG (TC 3.A.5.1.1) [gamma
          proteobacterium IMCC3088]
 gi|328923402|gb|EGG30719.1| Preprotein translocase subunit SecG (TC 3.A.5.1.1) [gamma
          proteobacterium IMCC3088]
          Length = 124

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 49/83 (59%), Gaps = 6/83 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRS--TAHSLGRFTAILA 54
          M+  ++VVHL+V + ++ +I+IQ        ++FG+ ++ T + S  + ++L + T+ L 
Sbjct: 1  MEQIILVVHLLVALAIIGLIMIQQGKGADMGASFGAGASQTLLGSAGSGNALTKATSWLV 60

Query: 55 FFFFATSIALGMISRYTSTRYKD 77
            FFATS AL +++   +   +D
Sbjct: 61 AAFFATSFALAVVANEKTAPVED 83


>gi|319783644|ref|YP_004143120.1| preprotein translocase, SecG subunit [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
 gi|317169532|gb|ADV13070.1| preprotein translocase, SecG subunit [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
          Length = 156

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 2/72 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          M+  L+V+HL+VV+ LV V+L+Q S+    G      F + R  A++L R TAILA  FF
Sbjct: 1  METVLIVIHLMVVLALVGVVLLQRSEGGGLGIGGGSGFMTARGAANALTRATAILAAAFF 60

Query: 59 ATSIALGMISRY 70
          ATS+ L +++RY
Sbjct: 61 ATSLTLSIVARY 72


>gi|162147715|ref|YP_001602176.1| protein translocase subunit secG [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|209542339|ref|YP_002274568.1| preprotein translocase subunit SecG [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|161786292|emb|CAP55874.1| protein translocase subunit secG [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|209530016|gb|ACI49953.1| preprotein translocase, SecG subunit [Gluconacetobacter
          diazotrophicus PAl 5]
          Length = 111

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 5/74 (6%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAFGSSS-----NFTSVRSTAHSLGRFTAILAFFFFA 59
          L+ +HL V + L+  +LIQ S+    G  S     +F S R TA+ L R T++LA  F  
Sbjct: 5  LLFLHLFVTLALIGTVLIQRSEGGGLGIGSSQGMGSFMSGRGTANLLTRTTSVLAGIFMI 64

Query: 60 TSIALGMISRYTST 73
           S+ L +++R  ST
Sbjct: 65 LSLTLAVMNRGAST 78


>gi|110616589|gb|ABF05256.1| protein export - membrane protein [Shigella flexneri 5 str. 8401]
          Length = 135

 Score = 41.2 bits (95), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 43/76 (56%), Gaps = 6/76 (7%)

Query: 5   LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
           L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 30  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 89

Query: 59  ATSIALGMISRYTSTR 74
             S+ LG I+   + R
Sbjct: 90  IISLVLGNINSNKTNR 105


>gi|330958052|gb|EGH58312.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          maculicola str. ES4326]
          Length = 126

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 49/80 (61%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          ++  ++V HL+  +G+V ++L+Q    +D+ A FG+ ++ T    + T+  L +FTAILA
Sbjct: 2  LETVVIVFHLMGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF TS+ LG  ++  + +
Sbjct: 62 ACFFITSLGLGYFAKEKAQQ 81


>gi|219856327|ref|YP_002473449.1| hypothetical protein CKR_2984 [Clostridium kluyveri NBRC 12016]
 gi|219570051|dbj|BAH08035.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 80

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAF------GSSSNFTSV---RSTAHSLGRFTA 51
          M IFL++  L++ V L+CVIL+Q   ++        G S +F S    R++   L R T 
Sbjct: 4  MHIFLIIAQLVIGVMLICVILMQPGKTNGLSGFISGGPSESFYSKNKSRTSEAMLSRITV 63

Query: 52 ILAFFFFATSIALGMI 67
          +LA  F A  I   MI
Sbjct: 64 VLAILFAAICIVQTMI 79


>gi|281602558|gb|ADA75542.1| Preprotein translocase IISP family, auxillary membrane component
          [Shigella flexneri 2002017]
          Length = 126

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 43/76 (56%), Gaps = 6/76 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 21 LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 80

Query: 59 ATSIALGMISRYTSTR 74
            S+ LG I+   + R
Sbjct: 81 IISLVLGNINSNKTNR 96


>gi|153955986|ref|YP_001396751.1| hypothetical protein CKL_3377 [Clostridium kluyveri DSM 555]
 gi|146348844|gb|EDK35380.1| Hypothetical protein CKL_3377 [Clostridium kluyveri DSM 555]
          Length = 77

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAF------GSSSNFTSV---RSTAHSLGRFTA 51
          M IFL++  L++ V L+CVIL+Q   ++        G S +F S    R++   L R T 
Sbjct: 1  MHIFLIIAQLVIGVMLICVILMQPGKTNGLSGFISGGPSESFYSKNKSRTSEAMLSRITV 60

Query: 52 ILAFFFFATSIALGMI 67
          +LA  F A  I   MI
Sbjct: 61 VLAILFAAICIVQTMI 76


>gi|24114464|ref|NP_708974.1| preprotein translocase subunit SecG [Shigella flexneri 2a str.
          301]
 gi|30064513|ref|NP_838684.1| preprotein translocase subunit SecG [Shigella flexneri 2a str.
          2457T]
 gi|82545587|ref|YP_409534.1| preprotein translocase subunit SecG [Shigella boydii Sb227]
 gi|162139328|ref|YP_690561.2| preprotein translocase subunit SecG [Shigella flexneri 5 str.
          8401]
 gi|24053646|gb|AAN44681.1| protein translocase membrane component [Shigella flexneri 2a str.
          301]
 gi|30042772|gb|AAP18495.1| protein translocase membrane component [Shigella flexneri 2a str.
          2457T]
 gi|81246998|gb|ABB67706.1| SecG [Shigella boydii Sb227]
 gi|313648583|gb|EFS13025.1| preprotein translocase, SecG subunit [Shigella flexneri 2a str.
          2457T]
          Length = 110

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 43/76 (56%), Gaps = 6/76 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 64

Query: 59 ATSIALGMISRYTSTR 74
            S+ LG I+   + R
Sbjct: 65 IISLVLGNINSNKTNR 80


>gi|262042733|ref|ZP_06015887.1| protein-export membrane protein SecG [Klebsiella pneumoniae
          subsp. rhinoscleromatis ATCC 13884]
 gi|259039958|gb|EEW41075.1| protein-export membrane protein SecG [Klebsiella pneumoniae
          subsp. rhinoscleromatis ATCC 13884]
          Length = 115

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 47/83 (56%), Gaps = 8/83 (9%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV ++++Q        ++FG+ ++ T   S+     + R T ILA  FF
Sbjct: 5  LLVVFLIVAIGLVGLVMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTGILAALFF 64

Query: 59 ATSIALGMISRYTSTR--YKDNM 79
            S+ALG I+   +++    DN+
Sbjct: 65 IISLALGNINSNKTSKGSEWDNL 87


>gi|254507459|ref|ZP_05119593.1| preprotein translocase, SecG subunit [Vibrio parahaemolyticus 16]
 gi|219549529|gb|EED26520.1| preprotein translocase, SecG subunit [Vibrio parahaemolyticus 16]
          Length = 110

 Score = 40.8 bits (94), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 49/92 (53%), Gaps = 7/92 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  VG++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 5  LLVIYLLAAVGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFATVFF 64

Query: 59 ATSIALGMISRY-TSTRYKDNMHRSLVDSIKD 89
            S+ LG +S + T +++ D     ++    D
Sbjct: 65 ILSLVLGNMSTHKTESQWVDPTQGQIIQQADD 96


>gi|329297287|ref|ZP_08254623.1| SecG [Plautia stali symbiont]
          Length = 111

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%), Gaps = 6/67 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   ST     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSTGSGNFMTRMTAVLATLFF 64

Query: 59 ATSIALG 65
            S+ LG
Sbjct: 65 IISLILG 71


>gi|152972099|ref|YP_001337245.1| preprotein translocase subunit SecG [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|206580958|ref|YP_002236413.1| preprotein translocase, SecG subunit [Klebsiella pneumoniae 342]
 gi|288933397|ref|YP_003437456.1| preprotein translocase subunit G [Klebsiella variicola At-22]
 gi|329997756|ref|ZP_08302906.1| preprotein translocase, SecG subunit [Klebsiella sp. MS 92-3]
 gi|150956948|gb|ABR78978.1| protein-export membrane protein [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|206570016|gb|ACI11792.1| preprotein translocase, SecG subunit [Klebsiella pneumoniae 342]
 gi|288888126|gb|ADC56444.1| preprotein translocase, SecG subunit [Klebsiella variicola At-22]
 gi|328538916|gb|EGF64976.1| preprotein translocase, SecG subunit [Klebsiella sp. MS 92-3]
          Length = 109

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 47/83 (56%), Gaps = 8/83 (9%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV ++++Q        ++FG+ ++ T   S+     + R T ILA  FF
Sbjct: 5  LLVVFLIVAIGLVGLVMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTGILAALFF 64

Query: 59 ATSIALGMISRYTSTR--YKDNM 79
            S+ALG I+   +++    DN+
Sbjct: 65 IISLALGNINSNKTSKGSEWDNL 87


>gi|120597897|ref|YP_962471.1| preprotein translocase subunit SecG [Shewanella sp. W3-18-1]
 gi|146293931|ref|YP_001184355.1| preprotein translocase subunit SecG [Shewanella putrefaciens
          CN-32]
 gi|120557990|gb|ABM23917.1| protein translocase subunit secG [Shewanella sp. W3-18-1]
 gi|145565621|gb|ABP76556.1| protein translocase subunit secG [Shewanella putrefaciens CN-32]
          Length = 111

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (51%), Gaps = 15/99 (15%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M   L+V++L+V +GL+ ++LIQ        ++FG+ ++ T   S+     L R TAILA
Sbjct: 1  MYEVLLVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
            FF  S+ +G +S           H    DS K+ G+D
Sbjct: 61 IAFFTLSLIIGNLSAN---------HAKNEDSWKNLGSD 90


>gi|319427308|gb|ADV55382.1| preprotein translocase, SecG subunit [Shewanella putrefaciens
          200]
          Length = 111

 Score = 40.8 bits (94), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (51%), Gaps = 15/99 (15%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M   L+V++L+V +GL+ ++LIQ        ++FG+ ++ T   S+     L R TAILA
Sbjct: 1  MYEVLLVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
            FF  S+ +G +S           H    DS K+ G+D
Sbjct: 61 IAFFTLSLIIGNLSAN---------HAKNEDSWKNLGSD 90


>gi|270265056|ref|ZP_06193319.1| hypothetical protein SOD_k00920 [Serratia odorifera 4Rx13]
 gi|270040990|gb|EFA14091.1| hypothetical protein SOD_k00920 [Serratia odorifera 4Rx13]
          Length = 111

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 50/92 (54%), Gaps = 8/92 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+V+ L++ +GLV +I++Q    +    +FG+ ++ T   S+     + R TAILA  FF
Sbjct: 5  LLVIFLLISIGLVALIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAILAALFF 64

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
            S+ LG +S  T+   K +   +L   +K +
Sbjct: 65 VISLILGNLS--TNQSKKGSEWENLGQPVKSE 94


>gi|221639795|ref|YP_002526057.1| preprotein translocase subunit SecG [Rhodobacter sphaeroides
          KD131]
 gi|221160576|gb|ACM01556.1| Preprotein translocase SecG subunit [Rhodobacter sphaeroides
          KD131]
          Length = 227

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
          MQ  +++VHLI+ + L+ V+L+Q S+            + R  A+++ R T I A  F  
Sbjct: 1  MQNVVLIVHLILALLLIGVVLLQRSEGGGLGMGGGGAMTGRQAANAMTRMTWIFAIAFIG 60

Query: 60 TSIAL 64
          TSIAL
Sbjct: 61 TSIAL 65


>gi|126739990|ref|ZP_01755680.1| preprotein translocase, SecG subunit [Roseobacter sp. SK209-2-6]
 gi|126718809|gb|EBA15521.1| preprotein translocase, SecG subunit [Roseobacter sp. SK209-2-6]
          Length = 122

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 9/104 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV---RSTAHSLGRFTAILAFFF 57
           M+  ++++HL++ +GL+ V+L+Q S+    G           RS A +L + T  LA  F
Sbjct: 1   MENVVLIIHLLLALGLIAVVLLQRSEGGGLGMGGGGGGAMTGRSAATALSKVTWALAIAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
             TS+ L +++   S         S+ D I+     + G  S+P
Sbjct: 61  ICTSVTLTVLAAQKSA------GSSVTDRIEATDGADEGAASAP 98


>gi|332174439|gb|AEE23693.1| preprotein translocase, SecG subunit [Glaciecola agarilytica
          4H-3-7+YE-5]
          Length = 123

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 38/67 (56%), Gaps = 6/67 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV+LIV + L+  +LIQ    +    +FGS  + T   ST     L R TAILA FFF
Sbjct: 6  LIVVYLIVAIMLIGFVLIQQGKGADMGASFGSGGSNTVFGSTGSGNFLTRTTAILATFFF 65

Query: 59 ATSIALG 65
            S+ LG
Sbjct: 66 VISLILG 72


>gi|260775412|ref|ZP_05884309.1| preprotein translocase subunit SecG [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608593|gb|EEX34758.1| preprotein translocase subunit SecG [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 111

 Score = 40.8 bits (94), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 56/110 (50%), Gaps = 11/110 (10%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
           L+V++L+  VG++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 5   LLVIYLLAAVGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFATVFF 64

Query: 59  ATSIALGMISRY-TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             S+ LG +S + T +++ D     ++     Q +D   +  +P  D + 
Sbjct: 65  ILSLVLGNMSTHKTESQWVDPTQGQVI----QQADDAASEVPAPTGDEIP 110


>gi|109897896|ref|YP_661151.1| preprotein translocase subunit SecG [Pseudoalteromonas atlantica
          T6c]
 gi|109700177|gb|ABG40097.1| protein translocase subunit secG [Pseudoalteromonas atlantica
          T6c]
          Length = 123

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 38/67 (56%), Gaps = 6/67 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV+LIV + L+  +LIQ    +    +FGS  + T   ST     L R TAILA FFF
Sbjct: 6  LIVVYLIVAIMLIGFVLIQQGKGADMGASFGSGGSNTVFGSTGSGNFLTRTTAILATFFF 65

Query: 59 ATSIALG 65
            S+ LG
Sbjct: 66 VISLILG 72


>gi|83952238|ref|ZP_00960970.1| preprotein translocase, SecG subunit [Roseovarius nubinhibens
          ISM]
 gi|83837244|gb|EAP76541.1| preprotein translocase, SecG subunit [Roseovarius nubinhibens
          ISM]
          Length = 121

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 42/74 (56%), Gaps = 2/74 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAH--SLGRFTAILAFFFF 58
          M+  ++ +HL+V + L+ V+L+Q S+    G      +V   +   +LG+ T +L F  F
Sbjct: 1  MENVVLTIHLLVTLALIGVVLLQRSEGGGLGMGGGGGAVAGRSAATALGKLTWVLGFGLF 60

Query: 59 ATSIALGMISRYTS 72
          ATSIAL +I+   S
Sbjct: 61 ATSIALTVIAAEKS 74


>gi|261856551|ref|YP_003263834.1| preprotein translocase, SecG subunit [Halothiobacillus
          neapolitanus c2]
 gi|261837020|gb|ACX96787.1| preprotein translocase, SecG subunit [Halothiobacillus
          neapolitanus c2]
          Length = 152

 Score = 40.8 bits (94), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 6/73 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSNFT--SVRSTAHSLGRFTAILA 54
          MQ  +++ H+++ + L+ ++LIQ    +   +AFGS S+ T    R  A  L + T  L 
Sbjct: 1  MQTLILIGHVLIGLALIGLVLIQHGKGADAGAAFGSGSSGTVFGARGAATFLQKLTGWLV 60

Query: 55 FFFFATSIALGMI 67
            FFATS+ L  +
Sbjct: 61 VAFFATSLLLAYV 73


>gi|290511552|ref|ZP_06550921.1| preprotein translocase SecG subunit [Klebsiella sp. 1_1_55]
 gi|289776545|gb|EFD84544.1| preprotein translocase SecG subunit [Klebsiella sp. 1_1_55]
          Length = 121

 Score = 40.4 bits (93), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 47/83 (56%), Gaps = 8/83 (9%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV ++++Q        ++FG+ ++ T   S+     + R T ILA  FF
Sbjct: 17 LLVVFLIVAIGLVGLVMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTGILAALFF 76

Query: 59 ATSIALGMISRYTSTR--YKDNM 79
            S+ALG I+   +++    DN+
Sbjct: 77 IISLALGNINSNKTSKGSEWDNL 99


>gi|238896682|ref|YP_002921427.1| preprotein translocase subunit SecG [Klebsiella pneumoniae
          NTUH-K2044]
 gi|238549009|dbj|BAH65360.1| preprotein translocase inner membrane secretion subunit
          [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 121

 Score = 40.4 bits (93), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 47/83 (56%), Gaps = 8/83 (9%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV ++++Q        ++FG+ ++ T   S+     + R T ILA  FF
Sbjct: 17 LLVVFLIVAIGLVGLVMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTGILAALFF 76

Query: 59 ATSIALGMISRYTSTR--YKDNM 79
            S+ALG I+   +++    DN+
Sbjct: 77 IISLALGNINSNKTSKGSEWDNL 99


>gi|261253853|ref|ZP_05946426.1| preprotein translocase subunit SecG [Vibrio orientalis CIP
          102891]
 gi|323499458|ref|ZP_08104430.1| preprotein translocase subunit SecG [Vibrio sinaloensis DSM
          21326]
 gi|260937244|gb|EEX93233.1| preprotein translocase subunit SecG [Vibrio orientalis CIP
          102891]
 gi|323315514|gb|EGA68553.1| preprotein translocase subunit SecG [Vibrio sinaloensis DSM
          21326]
          Length = 110

 Score = 40.4 bits (93), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 49/92 (53%), Gaps = 7/92 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  VG++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 5  LLVIYLLAAVGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFATVFF 64

Query: 59 ATSIALGMISRY-TSTRYKDNMHRSLVDSIKD 89
            S+ LG +S + T +++ D     ++    D
Sbjct: 65 ILSLVLGNMSTHKTESQWVDPTQGQVIQQADD 96


>gi|320322531|gb|EFW78624.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
          glycinea str. B076]
          Length = 126

 Score = 40.4 bits (93), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 49/80 (61%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          ++  ++V HL+  +G+V ++L+Q    +D+ A FG+ ++ T    + T+  L +FTAI+A
Sbjct: 2  LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAIIA 61

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF TS+ LG  ++  + +
Sbjct: 62 ACFFITSLGLGYFAKEKAQQ 81


>gi|148651970|ref|YP_001279063.1| preprotein translocase subunit SecG [Psychrobacter sp. PRwf-1]
 gi|148571054|gb|ABQ93113.1| protein translocase subunit secG [Psychrobacter sp. PRwf-1]
          Length = 105

 Score = 40.4 bits (93), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 44/71 (61%), Gaps = 6/71 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQ---SSDSSA-FGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          ++ +H+IV + ++ +ILIQ    +D+ A FG+ ++ T      +A+ L R TAILA  FF
Sbjct: 5  ILAIHIIVAIAMIGLILIQHGKGADAGASFGAGASGTVFGAAGSANFLTRATAILAIIFF 64

Query: 59 ATSIALGMISR 69
           TS+ L + +R
Sbjct: 65 TTSLTLAVHAR 75


>gi|302343399|ref|YP_003807928.1| preprotein translocase, SecG subunit [Desulfarculus baarsii DSM
          2075]
 gi|301640012|gb|ADK85334.1| preprotein translocase, SecG subunit [Desulfarculus baarsii DSM
          2075]
          Length = 137

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 5/69 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSNFTSVRSTAHS-LGRFTAILAF 55
          MQI L+++HL+    LV V+L+Q    +S  +AFG +S      S A + LG+ T I+A 
Sbjct: 1  MQIALILLHLVACAILVLVVLLQTGKGASLGAAFGGASQTVFGSSGAQTFLGKMTTIVAV 60

Query: 56 FFFATSIAL 64
           F  TS+ L
Sbjct: 61 IFMVTSLTL 69


>gi|254361631|ref|ZP_04977769.1| Sec family Type II general secretory pathway preprotein translocase
           SecG [Mannheimia haemolytica PHL213]
 gi|261496381|ref|ZP_05992775.1| Sec family Type II general secretory pathway preprotein translocase
           SecG [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153093149|gb|EDN74165.1| Sec family Type II general secretory pathway preprotein translocase
           SecG [Mannheimia haemolytica PHL213]
 gi|261307966|gb|EEY09275.1| Sec family Type II general secretory pathway preprotein translocase
           SecG [Mannheimia haemolytica serotype A2 str. OVINE]
          Length = 108

 Score = 40.4 bits (93), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 59/100 (59%), Gaps = 11/100 (11%)

Query: 5   LMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFTSVRS--TAHSLGRFTAILAFFFF 58
           L +V+L+V V L+  +L+Q    +D+ A FG+ ++ T   S  +A+ L R TA+LA  FF
Sbjct: 6   LTIVYLVVAVLLIAFVLMQQGKGADAGASFGAGASATVFGSAGSANFLSRTTALLATIFF 65

Query: 59  ATSIALGMISRY---TSTRYKD--NMHRSLVDSIKDQGND 93
           A S+ +G +S +     ++++D   + +  V+ +K + +D
Sbjct: 66  AISLVIGNLSSHNVAPKSQFEDLSQVEQKQVEPVKIENSD 105


>gi|146308626|ref|YP_001189091.1| preprotein translocase subunit SecG [Pseudomonas mendocina ymp]
 gi|145576827|gb|ABP86359.1| protein translocase subunit secG [Pseudomonas mendocina ymp]
          Length = 125

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 47/75 (62%), Gaps = 6/75 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          ++  ++V+HL+  +G+V ++L+Q    +D+ A FG+ ++ T    + +A  L +FTAILA
Sbjct: 2  LETVIVVLHLLGAIGVVVLVLLQQGKGADAGASFGAGASATVFGSQGSATFLSKFTAILA 61

Query: 55 FFFFATSIALGMISR 69
            FF TS+ L   ++
Sbjct: 62 TGFFITSLGLAFFAK 76


>gi|312885111|ref|ZP_07744796.1| preprotein translocase subunit SecG [Vibrio caribbenthicus ATCC
          BAA-2122]
 gi|309367211|gb|EFP94778.1| preprotein translocase subunit SecG [Vibrio caribbenthicus ATCC
          BAA-2122]
          Length = 111

 Score = 40.4 bits (93), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 50/94 (53%), Gaps = 7/94 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  VG++ ++LIQ    +    +FG+ ++ T      + + L R TA+ A  FF
Sbjct: 5  LLVIYLLAAVGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAVFATVFF 64

Query: 59 ATSIALGMISRYTS-TRYKDNMHRSLVDSIKDQG 91
            S+ALG +S + S  +  D      ++  K+ G
Sbjct: 65 VISLALGNMSTHKSDAQGVDVSQGQFIEKTKNNG 98


>gi|153001792|ref|YP_001367473.1| preprotein translocase subunit SecG [Shewanella baltica OS185]
 gi|151366410|gb|ABS09410.1| preprotein translocase, SecG subunit [Shewanella baltica OS185]
          Length = 111

 Score = 40.4 bits (93), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (51%), Gaps = 15/99 (15%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M   L+V++L+V +GL+ ++LIQ        ++FG+ ++ T   S+     L R TAILA
Sbjct: 1  MYEVLVVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
            FF  S+ +G +S           H    DS K+ G+D
Sbjct: 61 IAFFTLSLLIGNLSAN---------HAKNEDSWKNLGSD 90


>gi|317046738|ref|YP_004114386.1| preprotein translocase subunit SecG [Pantoea sp. At-9b]
 gi|316948355|gb|ADU67830.1| preprotein translocase, SecG subunit [Pantoea sp. At-9b]
          Length = 110

 Score = 40.0 bits (92), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%), Gaps = 6/67 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   ST     + R TA+LA  FF
Sbjct: 5  LLVVFLIVALGLVGLIMLQQGKGADMGASFGAGASATLFGSTGSGNFMTRMTAVLATLFF 64

Query: 59 ATSIALG 65
            S+ LG
Sbjct: 65 IISLILG 71


>gi|149192455|ref|ZP_01870648.1| protein-export membrane protein [Vibrio shilonii AK1]
 gi|148833706|gb|EDL50750.1| protein-export membrane protein [Vibrio shilonii AK1]
          Length = 111

 Score = 40.0 bits (92), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 50/96 (52%), Gaps = 7/96 (7%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
           L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 5   LLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFAIVFF 64

Query: 59  ATSIALG-MISRYTSTRYKDNMHRSLVDSIKDQGND 93
             S+ LG M +    +++ D     +V+   D  +D
Sbjct: 65  VISLVLGNMYTHKGESQWVDPSQGQVVEQQVDAASD 100


>gi|16762055|ref|NP_457672.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Typhi str. CT18]
 gi|16766589|ref|NP_462204.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Typhimurium str. LT2]
 gi|29143544|ref|NP_806886.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Typhi str. Ty2]
 gi|56415222|ref|YP_152297.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. ATCC 9150]
 gi|167552062|ref|ZP_02345815.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Saintpaul str. SARA29]
 gi|167990144|ref|ZP_02571244.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168231900|ref|ZP_02656958.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Kentucky str. CDC 191]
 gi|168237991|ref|ZP_02663049.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Schwarzengrund str. SL480]
 gi|168243125|ref|ZP_02668057.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Heidelberg str. SL486]
 gi|168262698|ref|ZP_02684671.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Hadar str. RI_05P066]
 gi|168463486|ref|ZP_02697403.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Newport str. SL317]
 gi|168819641|ref|ZP_02831641.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Weltevreden str. HI_N05-537]
 gi|194446778|ref|YP_002042549.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Newport str. SL254]
 gi|194448171|ref|YP_002047320.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Heidelberg str. SL476]
 gi|194471973|ref|ZP_03077957.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Kentucky str. CVM29188]
 gi|194734665|ref|YP_002116240.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Schwarzengrund str. CVM19633]
 gi|197250047|ref|YP_002148217.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Agona str. SL483]
 gi|197262591|ref|ZP_03162665.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Saintpaul str. SARA23]
 gi|197364152|ref|YP_002143789.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|198245348|ref|YP_002217264.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Dublin str. CT_02021853]
 gi|200388900|ref|ZP_03215512.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Virchow str. SL491]
 gi|204928325|ref|ZP_03219525.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Javiana str. GA_MM04042433]
 gi|205354194|ref|YP_002227995.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 287/91]
 gi|207858541|ref|YP_002245192.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Enteritidis str. P125109]
 gi|213029357|ref|ZP_03343804.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Typhi str. 404ty]
 gi|213052985|ref|ZP_03345863.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Typhi str. E00-7866]
 gi|213425429|ref|ZP_03358179.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Typhi str. E02-1180]
 gi|213622801|ref|ZP_03375584.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-2068]
 gi|213645862|ref|ZP_03375915.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Typhi str. J185]
 gi|213865086|ref|ZP_03387205.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Typhi str. M223]
 gi|238910086|ref|ZP_04653923.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Tennessee str. CDC07-0191]
 gi|289825805|ref|ZP_06544973.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-3139]
 gi|25306332|pir||AD0902 protein-export membrane protein [imported] - Salmonella enterica
          subsp. enterica serovar Typhi (strain CT18)
 gi|16421850|gb|AAL22163.1| preprotein translocase IISP family protein [Salmonella enterica
          subsp. enterica serovar Typhimurium str. LT2]
 gi|16504358|emb|CAD07810.1| protein-export membrane protein [Salmonella enterica subsp.
          enterica serovar Typhi]
 gi|29139178|gb|AAO70746.1| export membrane protein [Salmonella enterica subsp. enterica
          serovar Typhi str. Ty2]
 gi|56129479|gb|AAV78985.1| protein-export membrane protein [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. ATCC 9150]
 gi|194405441|gb|ACF65663.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Newport str. SL254]
 gi|194406475|gb|ACF66694.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Heidelberg str. SL476]
 gi|194458337|gb|EDX47176.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Kentucky str. CVM29188]
 gi|194710167|gb|ACF89388.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Schwarzengrund str. CVM19633]
 gi|195633471|gb|EDX51885.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Newport str. SL317]
 gi|197095629|emb|CAR61197.1| protein-export membrane protein [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|197213750|gb|ACH51147.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Agona str. SL483]
 gi|197240846|gb|EDY23466.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Saintpaul str. SARA23]
 gi|197289167|gb|EDY28536.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Schwarzengrund str. SL480]
 gi|197939864|gb|ACH77197.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Dublin str. CT_02021853]
 gi|199605998|gb|EDZ04543.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Virchow str. SL491]
 gi|204322647|gb|EDZ07844.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Javiana str. GA_MM04042433]
 gi|205273975|emb|CAR38981.1| protein-export membrane protein [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 287/91]
 gi|205323209|gb|EDZ11048.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Saintpaul str. SARA29]
 gi|205331185|gb|EDZ17949.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205333739|gb|EDZ20503.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Kentucky str. CDC 191]
 gi|205337750|gb|EDZ24514.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Heidelberg str. SL486]
 gi|205343277|gb|EDZ30041.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Weltevreden str. HI_N05-537]
 gi|205348487|gb|EDZ35118.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
          enterica serovar Hadar str. RI_05P066]
 gi|206710344|emb|CAR34702.1| protein-export membrane protein [Salmonella enterica subsp.
          enterica serovar Enteritidis str. P125109]
 gi|261248457|emb|CBG26294.1| protein-export membrane protein [Salmonella enterica subsp.
          enterica serovar Typhimurium str. D23580]
 gi|301159841|emb|CBW19360.1| protein-export membrane protein [Salmonella enterica subsp.
          enterica serovar Typhimurium str. SL1344]
 gi|312914317|dbj|BAJ38291.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Typhimurium str. T000240]
 gi|320087737|emb|CBY97501.1| Protein-export membrane protein secG Preprotein translocase band
          1 subunit; P12 [Salmonella enterica subsp. enterica
          serovar Weltevreden str. 2007-60-3289-1]
 gi|321225975|gb|EFX51029.1| Preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Typhimurium str. TN061786]
 gi|322615296|gb|EFY12217.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 315996572]
 gi|322618345|gb|EFY15236.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-1]
 gi|322622850|gb|EFY19694.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-3]
 gi|322626828|gb|EFY23625.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-4]
 gi|322631397|gb|EFY28157.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 515920-1]
 gi|322635336|gb|EFY32050.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 515920-2]
 gi|322643335|gb|EFY39899.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 531954]
 gi|322647093|gb|EFY43594.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322648896|gb|EFY45341.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. OH_2009072675]
 gi|322655088|gb|EFY51399.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657691|gb|EFY53959.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 19N]
 gi|322664187|gb|EFY60385.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 81038-01]
 gi|322667470|gb|EFY63632.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674718|gb|EFY70810.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 414877]
 gi|322675649|gb|EFY71722.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 366867]
 gi|322682285|gb|EFY78308.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 413180]
 gi|322684888|gb|EFY80886.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 446600]
 gi|323131651|gb|ADX19081.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Typhimurium str. 4/74]
 gi|323191865|gb|EFZ77113.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 609458-1]
 gi|323199024|gb|EFZ84121.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 556150-1]
 gi|323204276|gb|EFZ89285.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 609460]
 gi|323207623|gb|EFZ92570.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 507440-20]
 gi|323211324|gb|EFZ96168.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 556152]
 gi|323214734|gb|EFZ99483.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB101509-0077]
 gi|323221214|gb|EGA05640.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB102109-0047]
 gi|323224045|gb|EGA08338.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB110209-0055]
 gi|323230306|gb|EGA14425.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB111609-0052]
 gi|323233282|gb|EGA17376.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 2009083312]
 gi|323239319|gb|EGA23369.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 2009085258]
 gi|323242430|gb|EGA26456.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. 315731156]
 gi|323246940|gb|EGA30906.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2009159199]
 gi|323254127|gb|EGA37947.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008282]
 gi|323255244|gb|EGA39021.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008283]
 gi|323262707|gb|EGA46263.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008284]
 gi|323264017|gb|EGA47525.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008285]
 gi|323269403|gb|EGA52858.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008287]
 gi|326625042|gb|EGE31387.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Dublin str. 3246]
 gi|326629315|gb|EGE35658.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 9]
          Length = 110

 Score = 40.0 bits (92), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLVLGNIN 74


>gi|126175442|ref|YP_001051591.1| preprotein translocase subunit SecG [Shewanella baltica OS155]
 gi|217972312|ref|YP_002357063.1| preprotein translocase subunit SecG [Shewanella baltica OS223]
 gi|304410268|ref|ZP_07391887.1| preprotein translocase, SecG subunit [Shewanella baltica OS183]
 gi|307302021|ref|ZP_07581779.1| preprotein translocase, SecG subunit [Shewanella baltica BA175]
 gi|125998647|gb|ABN62722.1| protein translocase subunit secG [Shewanella baltica OS155]
 gi|217497447|gb|ACK45640.1| preprotein translocase, SecG subunit [Shewanella baltica OS223]
 gi|304351677|gb|EFM16076.1| preprotein translocase, SecG subunit [Shewanella baltica OS183]
 gi|306914059|gb|EFN44480.1| preprotein translocase, SecG subunit [Shewanella baltica BA175]
          Length = 111

 Score = 40.0 bits (92), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (51%), Gaps = 15/99 (15%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M   L+V++L+V +GL+ ++LIQ        ++FG+ ++ T   S+     L R TAILA
Sbjct: 1  MYEVLVVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
            FF  S+ +G +S           H    DS K+ G+D
Sbjct: 61 IAFFTLSLLIGNLSAN---------HAKNEDSWKNLGSD 90


>gi|162139538|ref|YP_218219.2| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Choleraesuis str. SC-B67]
 gi|224585088|ref|YP_002638887.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Paratyphi C strain RKS4594]
 gi|224469616|gb|ACN47446.1| protein-export membrane protein [Salmonella enterica subsp.
          enterica serovar Paratyphi C strain RKS4594]
 gi|322716288|gb|EFZ07859.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          enterica serovar Choleraesuis str. A50]
          Length = 110

 Score = 40.0 bits (92), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLVLGNIN 74


>gi|71064647|ref|YP_263374.1| preprotein translocase subunit SecG [Psychrobacter arcticus
          273-4]
 gi|71037632|gb|AAZ17940.1| protein translocase subunit secG [Psychrobacter arcticus 273-4]
          Length = 102

 Score = 40.0 bits (92), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 6/75 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ---SSDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          M  F++ +H+IV + ++ +ILIQ    +D+ A FG+ S+ T      TA+ L R TA+L 
Sbjct: 1  MFTFILTLHIIVAIAMIGLILIQHGKGADAGASFGAGSSGTVFGAAGTANFLTRATAVLT 60

Query: 55 FFFFATSIALGMISR 69
            FF TS++L + +R
Sbjct: 61 AIFFITSMSLAVHAR 75


>gi|218710448|ref|YP_002418069.1| preprotein translocase subunit SecG [Vibrio splendidus LGP32]
 gi|218323467|emb|CAV19644.1| Preprotein translocase subunit SecG [Vibrio splendidus LGP32]
          Length = 124

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 50/92 (54%), Gaps = 7/92 (7%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
           L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 19  LLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFATTFF 78

Query: 59  ATSIALGMISRY-TSTRYKDNMHRSLVDSIKD 89
             S+ LG +S + T +++ D     ++   +D
Sbjct: 79  ILSLVLGNMSTHKTESQWIDPTQGQVIQQAED 110


>gi|26110186|gb|AAN82372.1|AE016767_132 Protein-export membrane protein secG [Escherichia coli CFT073]
 gi|91074170|gb|ABE09051.1| protein-export membrane protein SecG [Escherichia coli UTI89]
          Length = 126

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 21 LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 80

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 81 IISLVLGNIN 90


>gi|306816483|ref|ZP_07450615.1| preprotein translocase subunit SecG [Escherichia coli NC101]
 gi|222034892|emb|CAP77635.1| Protein-export membrane protein secG [Escherichia coli LF82]
 gi|305850048|gb|EFM50507.1| preprotein translocase subunit SecG [Escherichia coli NC101]
 gi|312947732|gb|ADR28559.1| preprotein translocase subunit SecG [Escherichia coli O83:H1 str.
          NRG 857C]
 gi|324008775|gb|EGB77994.1| preprotein translocase, SecG subunit [Escherichia coli MS 57-2]
          Length = 110

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLVLGNIN 74


>gi|170765735|ref|ZP_02900546.1| preprotein translocase, SecG subunit [Escherichia albertii
          TW07627]
 gi|170124881|gb|EDS93812.1| preprotein translocase, SecG subunit [Escherichia albertii
          TW07627]
          Length = 110

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 43/76 (56%), Gaps = 6/76 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 64

Query: 59 ATSIALGMISRYTSTR 74
            S+ LG I+   + +
Sbjct: 65 IISLVLGNINSNKTNK 80


>gi|15833308|ref|NP_312081.1| preprotein translocase subunit SecG [Escherichia coli O157:H7
          str. Sakai]
 gi|16131065|ref|NP_417642.1| preprotein translocase membrane subunit [Escherichia coli str.
          K-12 substr. MG1655]
 gi|74313712|ref|YP_312131.1| preprotein translocase subunit SecG [Shigella sonnei Ss046]
 gi|89109938|ref|AP_003718.1| preprotein translocase membrane subunit [Escherichia coli str.
          K-12 substr. W3110]
 gi|110643415|ref|YP_671145.1| preprotein translocase subunit SecG [Escherichia coli 536]
 gi|117625469|ref|YP_858792.1| preprotein translocase subunit SecG [Escherichia coli APEC O1]
 gi|161486108|ref|NP_755798.2| preprotein translocase subunit SecG [Escherichia coli CFT073]
 gi|162138366|ref|YP_542582.2| preprotein translocase subunit SecG [Escherichia coli UTI89]
 gi|168749232|ref|ZP_02774254.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4113]
 gi|168754154|ref|ZP_02779161.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4401]
 gi|168762139|ref|ZP_02787146.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4501]
 gi|168769591|ref|ZP_02794598.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4486]
 gi|168773160|ref|ZP_02798167.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4196]
 gi|168781316|ref|ZP_02806323.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4076]
 gi|168786058|ref|ZP_02811065.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC869]
 gi|168797774|ref|ZP_02822781.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC508]
 gi|170082710|ref|YP_001732030.1| preprotein translocase membrane subunit [Escherichia coli str.
          K-12 substr. DH10B]
 gi|187733049|ref|YP_001881910.1| preprotein translocase subunit SecG [Shigella boydii CDC 3083-94]
 gi|191172219|ref|ZP_03033762.1| preprotein translocase, SecG subunit [Escherichia coli F11]
 gi|193062136|ref|ZP_03043232.1| preprotein translocase, SecG subunit [Escherichia coli E22]
 gi|194430232|ref|ZP_03062730.1| preprotein translocase, SecG subunit [Escherichia coli B171]
 gi|194433719|ref|ZP_03065994.1| preprotein translocase, SecG subunit [Shigella dysenteriae 1012]
 gi|195938393|ref|ZP_03083775.1| preprotein translocase subunit SecG [Escherichia coli O157:H7
          str. EC4024]
 gi|208806607|ref|ZP_03248944.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4206]
 gi|208814133|ref|ZP_03255462.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4045]
 gi|208818987|ref|ZP_03259307.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4042]
 gi|209400768|ref|YP_002272645.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4115]
 gi|215488491|ref|YP_002330922.1| preprotein translocase subunit SecG [Escherichia coli O127:H6
          str. E2348/69]
 gi|217326643|ref|ZP_03442726.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. TW14588]
 gi|218550458|ref|YP_002384249.1| preprotein translocase subunit SecG [Escherichia fergusonii ATCC
          35469]
 gi|218555745|ref|YP_002388658.1| preprotein translocase subunit SecG [Escherichia coli IAI1]
 gi|218560245|ref|YP_002393158.1| preprotein translocase subunit SecG [Escherichia coli S88]
 gi|218691465|ref|YP_002399677.1| preprotein translocase subunit SecG [Escherichia coli ED1a]
 gi|218696880|ref|YP_002404547.1| preprotein translocase subunit SecG [Escherichia coli 55989]
 gi|218701944|ref|YP_002409573.1| preprotein translocase subunit SecG [Escherichia coli IAI39]
 gi|218706795|ref|YP_002414314.1| preprotein translocase subunit SecG [Escherichia coli UMN026]
 gi|227887896|ref|ZP_04005701.1| Sec family type II general secretory pathway preprotein
          translocase SecG [Escherichia coli 83972]
 gi|238902277|ref|YP_002928073.1| preprotein translocase membrane subunit [Escherichia coli BW2952]
 gi|254795124|ref|YP_003079961.1| preprotein translocase subunit SecG [Escherichia coli O157:H7
          str. TW14359]
 gi|256024251|ref|ZP_05438116.1| preprotein translocase subunit SecG [Escherichia sp. 4_1_40B]
 gi|260845988|ref|YP_003223766.1| preprotein translocase membrane subunit [Escherichia coli O103:H2
          str. 12009]
 gi|261228185|ref|ZP_05942466.1| preprotein translocase membrane subunit [Escherichia coli O157:H7
          str. FRIK2000]
 gi|261255041|ref|ZP_05947574.1| preprotein translocase membrane subunit [Escherichia coli O157:H7
          str. FRIK966]
 gi|291284549|ref|YP_003501367.1| Preprotein translocase IISP family, auxillary membrane component
          [Escherichia coli O55:H7 str. CB9615]
 gi|293406784|ref|ZP_06650710.1| protein-export membrane protein secG [Escherichia coli FVEC1412]
 gi|293412547|ref|ZP_06655270.1| preprotein translocase subunit SecG [Escherichia coli B354]
 gi|298382525|ref|ZP_06992122.1| preprotein translocase SecG subunit [Escherichia coli FVEC1302]
 gi|300897939|ref|ZP_07116318.1| preprotein translocase, SecG subunit [Escherichia coli MS 198-1]
 gi|300918931|ref|ZP_07135490.1| preprotein translocase, SecG subunit [Escherichia coli MS 115-1]
 gi|300938085|ref|ZP_07152863.1| preprotein translocase, SecG subunit [Escherichia coli MS 21-1]
 gi|300948824|ref|ZP_07162892.1| preprotein translocase, SecG subunit [Escherichia coli MS 116-1]
 gi|300955760|ref|ZP_07168105.1| preprotein translocase, SecG subunit [Escherichia coli MS 175-1]
 gi|300980133|ref|ZP_07174853.1| preprotein translocase, SecG subunit [Escherichia coli MS 200-1]
 gi|300990776|ref|ZP_07179348.1| preprotein translocase, SecG subunit [Escherichia coli MS 45-1]
 gi|301022030|ref|ZP_07185973.1| preprotein translocase, SecG subunit [Escherichia coli MS 69-1]
 gi|301025981|ref|ZP_07189463.1| preprotein translocase, SecG subunit [Escherichia coli MS 196-1]
 gi|301047982|ref|ZP_07195024.1| preprotein translocase, SecG subunit [Escherichia coli MS 185-1]
 gi|301644885|ref|ZP_07244857.1| preprotein translocase, SecG subunit [Escherichia coli MS 146-1]
 gi|307139860|ref|ZP_07499216.1| preprotein translocase subunit SecG [Escherichia coli H736]
 gi|312968488|ref|ZP_07782697.1| preprotein translocase, SecG subunit [Escherichia coli 2362-75]
 gi|331643873|ref|ZP_08345004.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli H736]
 gi|331648975|ref|ZP_08350063.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli M605]
 gi|331654779|ref|ZP_08355779.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli M718]
 gi|331659462|ref|ZP_08360404.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli TA206]
 gi|331664787|ref|ZP_08365692.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli TA143]
 gi|331684822|ref|ZP_08385414.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli H299]
 gi|84028696|sp|P0AGA1|SECG_ECO57 RecName: Full=Protein-export membrane protein secG; AltName:
          Full=P12; AltName: Full=Preprotein translocase band 1
          subunit
 gi|84028697|sp|P0AGA0|SECG_ECOL6 RecName: Full=Protein-export membrane protein secG; AltName:
          Full=P12; AltName: Full=Preprotein translocase band 1
          subunit
 gi|84028698|sp|P0AG99|SECG_ECOLI RecName: Full=Protein-export membrane protein SecG; AltName:
          Full=P12; AltName: Full=Preprotein translocase band 1
          subunit
 gi|431135|dbj|BAA03930.1| p12 [Escherichia coli]
 gi|606113|gb|AAA57976.1| p12 [Escherichia coli str. K-12 substr. MG1655]
 gi|746404|gb|AAA97511.1| membrane protein [Escherichia coli]
 gi|1789565|gb|AAC76207.1| preprotein translocase membrane subunit [Escherichia coli str.
          K-12 substr. MG1655]
 gi|13363527|dbj|BAB37477.1| protein-export protein SecG [Escherichia coli O157:H7 str. Sakai]
 gi|73857189|gb|AAZ89896.1| SecG [Shigella sonnei Ss046]
 gi|85675969|dbj|BAE77219.1| preprotein translocase membrane subunit [Escherichia coli str.
          K12 substr. W3110]
 gi|110345007|gb|ABG71244.1| protein-export membrane protein SecG [Escherichia coli 536]
 gi|115514593|gb|ABJ02668.1| putative export membrane protein [Escherichia coli APEC O1]
 gi|169890545|gb|ACB04252.1| preprotein translocase membrane subunit [Escherichia coli str.
          K-12 substr. DH10B]
 gi|187430041|gb|ACD09315.1| preprotein translocase, SecG subunit [Shigella boydii CDC
          3083-94]
 gi|187770894|gb|EDU34738.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4196]
 gi|188016351|gb|EDU54473.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4113]
 gi|189001111|gb|EDU70097.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4076]
 gi|189358577|gb|EDU76996.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4401]
 gi|189361469|gb|EDU79888.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4486]
 gi|189367573|gb|EDU85989.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4501]
 gi|189373954|gb|EDU92370.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC869]
 gi|189379688|gb|EDU98104.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC508]
 gi|190907529|gb|EDV67125.1| preprotein translocase, SecG subunit [Escherichia coli F11]
 gi|192932356|gb|EDV84954.1| preprotein translocase, SecG subunit [Escherichia coli E22]
 gi|194411733|gb|EDX28057.1| preprotein translocase, SecG subunit [Escherichia coli B171]
 gi|194417982|gb|EDX34076.1| preprotein translocase, SecG subunit [Shigella dysenteriae 1012]
 gi|208726408|gb|EDZ76009.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4206]
 gi|208735410|gb|EDZ84097.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4045]
 gi|208739110|gb|EDZ86792.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4042]
 gi|209162168|gb|ACI39601.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. EC4115]
 gi|209758288|gb|ACI77456.1| protein-export protein SecG [Escherichia coli]
 gi|209758290|gb|ACI77457.1| protein-export protein SecG [Escherichia coli]
 gi|209758292|gb|ACI77458.1| protein-export protein SecG [Escherichia coli]
 gi|209758294|gb|ACI77459.1| protein-export protein SecG [Escherichia coli]
 gi|209758296|gb|ACI77460.1| protein-export protein SecG [Escherichia coli]
 gi|215266563|emb|CAS11002.1| preprotein translocase membrane subunit [Escherichia coli O127:H6
          str. E2348/69]
 gi|217319010|gb|EEC27435.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7
          str. TW14588]
 gi|218353612|emb|CAU99807.1| preprotein translocase membrane subunit [Escherichia coli 55989]
 gi|218357999|emb|CAQ90645.1| preprotein translocase membrane subunit [Escherichia fergusonii
          ATCC 35469]
 gi|218362513|emb|CAR00137.1| preprotein translocase membrane subunit [Escherichia coli IAI1]
 gi|218367014|emb|CAR04785.1| preprotein translocase membrane subunit [Escherichia coli S88]
 gi|218371930|emb|CAR19786.1| preprotein translocase membrane subunit [Escherichia coli IAI39]
 gi|218429029|emb|CAR09976.2| preprotein translocase membrane subunit [Escherichia coli ED1a]
 gi|218433892|emb|CAR14809.1| preprotein translocase membrane subunit [Escherichia coli UMN026]
 gi|227835292|gb|EEJ45758.1| Sec family type II general secretory pathway preprotein
          translocase SecG [Escherichia coli 83972]
 gi|238863271|gb|ACR65269.1| preprotein translocase membrane subunit [Escherichia coli BW2952]
 gi|254594524|gb|ACT73885.1| preprotein translocase membrane subunit [Escherichia coli O157:H7
          str. TW14359]
 gi|257761135|dbj|BAI32632.1| preprotein translocase membrane subunit [Escherichia coli O103:H2
          str. 12009]
 gi|260447798|gb|ACX38220.1| preprotein translocase, SecG subunit [Escherichia coli DH1]
 gi|281180217|dbj|BAI56547.1| preprotein translocase [Escherichia coli SE15]
 gi|284923198|emb|CBG36292.1| protein-export membrane protein [Escherichia coli 042]
 gi|290764422|gb|ADD58383.1| Preprotein translocase IISP family, auxillary membrane component
          [Escherichia coli O55:H7 str. CB9615]
 gi|291426790|gb|EFE99822.1| protein-export membrane protein secG [Escherichia coli FVEC1412]
 gi|291469318|gb|EFF11809.1| preprotein translocase subunit SecG [Escherichia coli B354]
 gi|294493447|gb|ADE92203.1| preprotein translocase, SecG subunit [Escherichia coli IHE3034]
 gi|298277665|gb|EFI19181.1| preprotein translocase SecG subunit [Escherichia coli FVEC1302]
 gi|299879876|gb|EFI88087.1| preprotein translocase, SecG subunit [Escherichia coli MS 196-1]
 gi|300300125|gb|EFJ56510.1| preprotein translocase, SecG subunit [Escherichia coli MS 185-1]
 gi|300307855|gb|EFJ62375.1| preprotein translocase, SecG subunit [Escherichia coli MS 200-1]
 gi|300317393|gb|EFJ67177.1| preprotein translocase, SecG subunit [Escherichia coli MS 175-1]
 gi|300358369|gb|EFJ74239.1| preprotein translocase, SecG subunit [Escherichia coli MS 198-1]
 gi|300397745|gb|EFJ81283.1| preprotein translocase, SecG subunit [Escherichia coli MS 69-1]
 gi|300407084|gb|EFJ90622.1| preprotein translocase, SecG subunit [Escherichia coli MS 45-1]
 gi|300413957|gb|EFJ97267.1| preprotein translocase, SecG subunit [Escherichia coli MS 115-1]
 gi|300451713|gb|EFK15333.1| preprotein translocase, SecG subunit [Escherichia coli MS 116-1]
 gi|300456945|gb|EFK20438.1| preprotein translocase, SecG subunit [Escherichia coli MS 21-1]
 gi|301076830|gb|EFK91636.1| preprotein translocase, SecG subunit [Escherichia coli MS 146-1]
 gi|307555269|gb|ADN48044.1| protein-export membrane protein SecG [Escherichia coli ABU 83972]
 gi|307625226|gb|ADN69530.1| preprotein translocase subunit SecG [Escherichia coli UM146]
 gi|309703601|emb|CBJ02941.1| protein-export membrane protein [Escherichia coli ETEC H10407]
 gi|312286706|gb|EFR14617.1| preprotein translocase, SecG subunit [Escherichia coli 2362-75]
 gi|315137761|dbj|BAJ44920.1| preprotein translocase IISP family [Escherichia coli DH1]
 gi|315288923|gb|EFU48321.1| preprotein translocase, SecG subunit [Escherichia coli MS 110-3]
 gi|315294921|gb|EFU54260.1| preprotein translocase, SecG subunit [Escherichia coli MS 153-1]
 gi|315297874|gb|EFU57144.1| preprotein translocase, SecG subunit [Escherichia coli MS 16-3]
 gi|320174539|gb|EFW49675.1| Preprotein translocase subunit SecG [Shigella dysenteriae CDC
          74-1112]
 gi|320181450|gb|EFW56368.1| Preprotein translocase subunit SecG [Shigella boydii ATCC 9905]
 gi|320186662|gb|EFW61386.1| Preprotein translocase subunit SecG [Shigella flexneri CDC
          796-83]
 gi|320189528|gb|EFW64187.1| Preprotein translocase subunit SecG [Escherichia coli O157:H7
          str. EC1212]
 gi|320194660|gb|EFW69290.1| Preprotein translocase subunit SecG [Escherichia coli WV_060327]
 gi|320640245|gb|EFX09817.1| preprotein translocase subunit SecG [Escherichia coli O157:H7
          str. G5101]
 gi|320645542|gb|EFX14551.1| preprotein translocase subunit SecG [Escherichia coli O157:H-
          str. 493-89]
 gi|320650852|gb|EFX19309.1| preprotein translocase subunit SecG [Escherichia coli O157:H-
          str. H 2687]
 gi|320656233|gb|EFX24145.1| preprotein translocase subunit SecG [Escherichia coli O55:H7 str.
          3256-97 TW 07815]
 gi|320661923|gb|EFX29331.1| preprotein translocase subunit SecG [Escherichia coli O55:H7 str.
          USDA 5905]
 gi|320666758|gb|EFX33737.1| preprotein translocase subunit SecG [Escherichia coli O157:H7
          str. LSU-61]
 gi|323162867|gb|EFZ48702.1| preprotein translocase, SecG subunit [Escherichia coli E128010]
 gi|323165134|gb|EFZ50924.1| preprotein translocase, SecG subunit [Shigella sonnei 53G]
 gi|323173565|gb|EFZ59194.1| preprotein translocase, SecG subunit [Escherichia coli LT-68]
 gi|323183129|gb|EFZ68527.1| preprotein translocase, SecG subunit [Escherichia coli 1357]
 gi|323189204|gb|EFZ74488.1| preprotein translocase, SecG subunit [Escherichia coli RN587/1]
 gi|323936131|gb|EGB32425.1| preprotein translocase SecG [Escherichia coli E1520]
 gi|323951306|gb|EGB47181.1| preprotein translocase SecG subunit [Escherichia coli H252]
 gi|323957678|gb|EGB53392.1| preprotein translocase SecG subunit [Escherichia coli H263]
 gi|323966355|gb|EGB61789.1| preprotein translocase SecG subunit [Escherichia coli M863]
 gi|323979108|gb|EGB74186.1| preprotein translocase SecG subunit [Escherichia coli TW10509]
 gi|324012098|gb|EGB81317.1| preprotein translocase, SecG subunit [Escherichia coli MS 60-1]
 gi|324115221|gb|EGC09185.1| preprotein translocase SecG subunit [Escherichia fergusonii B253]
 gi|324119540|gb|EGC13422.1| preprotein translocase SecG subunit [Escherichia coli E1167]
 gi|326337875|gb|EGD61709.1| Preprotein translocase subunit SecG [Escherichia coli O157:H7
          str. 1125]
 gi|326347445|gb|EGD71170.1| Preprotein translocase subunit SecG [Escherichia coli O157:H7
          str. 1044]
 gi|330909229|gb|EGH37743.1| preprotein translocase subunit SecG [Escherichia coli AA86]
 gi|331037344|gb|EGI09568.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli H736]
 gi|331042722|gb|EGI14864.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli M605]
 gi|331048161|gb|EGI20238.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli M718]
 gi|331054044|gb|EGI26073.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli TA206]
 gi|331058035|gb|EGI30017.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli TA143]
 gi|331078437|gb|EGI49643.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli H299]
 gi|332086095|gb|EGI91257.1| preprotein translocase, SecG subunit [Shigella boydii 5216-82]
          Length = 110

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLVLGNIN 74


>gi|237706074|ref|ZP_04536555.1| LOW QUALITY PROTEIN: preprotein translocase IISP family
           [Escherichia sp. 3_2_53FAA]
 gi|254038340|ref|ZP_04872398.1| LOW QUALITY PROTEIN: preprotein translocase IISP family
           [Escherichia sp. 1_1_43]
 gi|226839964|gb|EEH71985.1| LOW QUALITY PROTEIN: preprotein translocase IISP family
           [Escherichia sp. 1_1_43]
 gi|226899114|gb|EEH85373.1| LOW QUALITY PROTEIN: preprotein translocase IISP family
           [Escherichia sp. 3_2_53FAA]
          Length = 141

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5   LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
           L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 36  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 95

Query: 59  ATSIALGMIS 68
             S+ LG I+
Sbjct: 96  IISLVLGNIN 105


>gi|93004902|ref|YP_579339.1| preprotein translocase subunit SecG [Psychrobacter cryohalolentis
          K5]
 gi|92392580|gb|ABE73855.1| protein translocase subunit secG [Psychrobacter cryohalolentis
          K5]
          Length = 102

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 6/75 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ---SSDSSA-FGSSSNFT--SVRSTAHSLGRFTAILA 54
          M  F++ +H+IV + ++ +ILIQ    +D+ A FG+ S+ T      TA+ L R TA+L 
Sbjct: 1  MFTFILALHIIVAIAMIGLILIQHGKGADAGASFGAGSSGTVFGAAGTANFLTRATAVLT 60

Query: 55 FFFFATSIALGMISR 69
            FF TS+ L + +R
Sbjct: 61 AIFFITSMTLAVHAR 75


>gi|157368733|ref|YP_001476722.1| preprotein translocase subunit SecG [Serratia proteamaculans 568]
 gi|157320497|gb|ABV39594.1| preprotein translocase, SecG subunit [Serratia proteamaculans
          568]
          Length = 111

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 50/92 (54%), Gaps = 8/92 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+V+ L++ +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVIFLLISIGLVALIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAVLATLFF 64

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
            S+ LG +S  T+   K +   +L   +K +
Sbjct: 65 VISLILGNLS--TNQTKKGSEWENLGQPVKSE 94


>gi|170680429|ref|YP_001745447.1| preprotein translocase subunit SecG [Escherichia coli SMS-3-5]
 gi|170518147|gb|ACB16325.1| preprotein translocase, SecG subunit [Escherichia coli SMS-3-5]
          Length = 110

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLVLGNIN 74


>gi|323376931|gb|ADX49199.1| preprotein translocase, SecG subunit [Escherichia coli KO11]
          Length = 126

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 21 LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 80

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 81 IISLVLGNIN 90


>gi|331674711|ref|ZP_08375470.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli TA280]
 gi|331068150|gb|EGI39546.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli TA280]
          Length = 110

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLVLGNIN 74


>gi|126462773|ref|YP_001043887.1| preprotein translocase subunit SecG [Rhodobacter sphaeroides ATCC
          17029]
 gi|126104437|gb|ABN77115.1| preprotein translocase, SecG subunit [Rhodobacter sphaeroides
          ATCC 17029]
          Length = 203

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
          MQ  +++VHLI+ + L+ V+L+Q S+            + R  A+++ R T I A  F  
Sbjct: 1  MQNVVLIVHLILALLLIGVVLLQRSEGGGLGMGGGGAMTGRQAANAMTRMTWIFAIAFIG 60

Query: 60 TSIAL 64
          TSIAL
Sbjct: 61 TSIAL 65


>gi|283788199|ref|YP_003368064.1| protein-export membrane protein [Citrobacter rodentium ICC168]
 gi|282951653|emb|CBG91353.1| protein-export membrane protein [Citrobacter rodentium ICC168]
          Length = 126

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 21 LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 80

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 81 IISLVLGNIN 90


>gi|332090680|gb|EGI95774.1| preprotein translocase, SecG subunit [Shigella boydii 3594-74]
          Length = 105

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 6  MVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFFA 59
          MVV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF 
Sbjct: 1  MVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFFI 60

Query: 60 TSIALGMISRYTSTR 74
           S+ LG I+   + +
Sbjct: 61 ISLVLGNINSNKTNK 75


>gi|161506144|ref|YP_001573256.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
          arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867491|gb|ABX24114.1| hypothetical protein SARI_04332 [Salmonella enterica subsp.
          arizonae serovar 62:z4,z23:--]
          Length = 110

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLVLGNIN 74


>gi|30142057|gb|AAO17817.1| SecG [Citrobacter rodentium]
          Length = 110

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLVLGNIN 74


>gi|77463939|ref|YP_353443.1| preprotein translocase subunit SecG [Rhodobacter sphaeroides
          2.4.1]
 gi|77388357|gb|ABA79542.1| Preprotein translocase SecG subunit [Rhodobacter sphaeroides
          2.4.1]
          Length = 208

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
          MQ  +++VHLI+ + L+ V+L+Q S+            + R  A+++ R T I A  F  
Sbjct: 1  MQNVVLIVHLILALLLIGVVLLQRSEGGGLGMGGGGAMTGRQAANAMTRMTWIFAIAFIG 60

Query: 60 TSIAL 64
          TSIAL
Sbjct: 61 TSIAL 65


>gi|312170902|emb|CBX79161.1| Protein-export membrane protein secG [Erwinia amylovora ATCC
          BAA-2158]
          Length = 110

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S      + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSNGSGNFMTRMTAVLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLILGNIN 74


>gi|183600363|ref|ZP_02961856.1| hypothetical protein PROSTU_03926 [Providencia stuartii ATCC
          25827]
 gi|188020154|gb|EDU58194.1| hypothetical protein PROSTU_03926 [Providencia stuartii ATCC
          25827]
          Length = 112

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 54/98 (55%), Gaps = 9/98 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M I L++V L+V +GL+ +I++Q        ++FG+ ++ T   S+     + R T ILA
Sbjct: 1  MYIALLIVFLLVAIGLIGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTGILA 60

Query: 55 FFFFATSIALGMIS--RY-TSTRYKDNMHRSLVDSIKD 89
            FF  S+ LG ++  +Y T +++++    + V+   D
Sbjct: 61 AVFFIISLILGNMTANKYGTGSKWENISEPAKVEQPTD 98


>gi|157155933|ref|YP_001464650.1| preprotein translocase subunit SecG [Escherichia coli E24377A]
 gi|157162658|ref|YP_001459976.1| preprotein translocase subunit SecG [Escherichia coli HS]
 gi|170018575|ref|YP_001723529.1| preprotein translocase subunit SecG [Escherichia coli ATCC 8739]
 gi|188492818|ref|ZP_03000088.1| preprotein translocase, SecG subunit [Escherichia coli 53638]
 gi|191168047|ref|ZP_03029847.1| preprotein translocase, SecG subunit [Escherichia coli B7A]
 gi|193067481|ref|ZP_03048449.1| preprotein translocase, SecG subunit [Escherichia coli E110019]
 gi|194438755|ref|ZP_03070841.1| preprotein translocase, SecG subunit [Escherichia coli 101-1]
 gi|209920650|ref|YP_002294734.1| preprotein translocase subunit SecG [Escherichia coli SE11]
 gi|253771991|ref|YP_003034822.1| preprotein translocase subunit SecG [Escherichia coli
          'BL21-Gold(DE3)pLysS AG']
 gi|254163117|ref|YP_003046225.1| preprotein translocase subunit SecG [Escherichia coli B str.
          REL606]
 gi|256018907|ref|ZP_05432772.1| preprotein translocase subunit SecG [Shigella sp. D9]
 gi|260857302|ref|YP_003231193.1| preprotein translocase membrane subunit [Escherichia coli O26:H11
          str. 11368]
 gi|260869926|ref|YP_003236328.1| preprotein translocase membrane subunit [Escherichia coli O111:H-
          str. 11128]
 gi|293449509|ref|ZP_06663930.1| preprotein translocase SecG subunit [Escherichia coli B088]
 gi|297518209|ref|ZP_06936595.1| preprotein translocase subunit SecG [Escherichia coli OP50]
 gi|300817573|ref|ZP_07097789.1| preprotein translocase, SecG subunit [Escherichia coli MS 107-1]
 gi|300823862|ref|ZP_07103986.1| preprotein translocase, SecG subunit [Escherichia coli MS 119-7]
 gi|300904360|ref|ZP_07122213.1| preprotein translocase, SecG subunit [Escherichia coli MS 84-1]
 gi|300926086|ref|ZP_07141904.1| preprotein translocase, SecG subunit [Escherichia coli MS 182-1]
 gi|300929865|ref|ZP_07145311.1| preprotein translocase, SecG subunit [Escherichia coli MS 187-1]
 gi|301301768|ref|ZP_07207902.1| preprotein translocase, SecG subunit [Escherichia coli MS 124-1]
 gi|301326403|ref|ZP_07219757.1| preprotein translocase, SecG subunit [Escherichia coli MS 78-1]
 gi|307313120|ref|ZP_07592746.1| preprotein translocase, SecG subunit [Escherichia coli W]
 gi|309793752|ref|ZP_07688178.1| preprotein translocase, SecG subunit [Escherichia coli MS 145-7]
 gi|312972551|ref|ZP_07786725.1| preprotein translocase, SecG subunit [Escherichia coli 1827-70]
 gi|331670002|ref|ZP_08370847.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli TA271]
 gi|331679254|ref|ZP_08379926.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli H591]
 gi|157068338|gb|ABV07593.1| preprotein translocase, SecG subunit [Escherichia coli HS]
 gi|157077963|gb|ABV17671.1| preprotein translocase, SecG subunit [Escherichia coli E24377A]
 gi|169753503|gb|ACA76202.1| preprotein translocase, SecG subunit [Escherichia coli ATCC 8739]
 gi|188488017|gb|EDU63120.1| preprotein translocase, SecG subunit [Escherichia coli 53638]
 gi|190901916|gb|EDV61665.1| preprotein translocase, SecG subunit [Escherichia coli B7A]
 gi|192959438|gb|EDV89873.1| preprotein translocase, SecG subunit [Escherichia coli E110019]
 gi|194422227|gb|EDX38228.1| preprotein translocase, SecG subunit [Escherichia coli 101-1]
 gi|209913909|dbj|BAG78983.1| preprotein translocase [Escherichia coli SE11]
 gi|242378718|emb|CAQ33508.1| secG, subunit of SecEGY-Secretion Complex and Sec Protein
          Secretion Complex [Escherichia coli BL21(DE3)]
 gi|253323035|gb|ACT27637.1| preprotein translocase, SecG subunit [Escherichia coli
          'BL21-Gold(DE3)pLysS AG']
 gi|253975018|gb|ACT40689.1| protein-export membrane protein [Escherichia coli B str. REL606]
 gi|253979174|gb|ACT44844.1| protein-export membrane protein [Escherichia coli BL21(DE3)]
 gi|257755951|dbj|BAI27453.1| preprotein translocase membrane subunit [Escherichia coli O26:H11
          str. 11368]
 gi|257766282|dbj|BAI37777.1| preprotein translocase membrane subunit [Escherichia coli O111:H-
          str. 11128]
 gi|291322599|gb|EFE62028.1| preprotein translocase SecG subunit [Escherichia coli B088]
 gi|300403711|gb|EFJ87249.1| preprotein translocase, SecG subunit [Escherichia coli MS 84-1]
 gi|300417851|gb|EFK01162.1| preprotein translocase, SecG subunit [Escherichia coli MS 182-1]
 gi|300462227|gb|EFK25720.1| preprotein translocase, SecG subunit [Escherichia coli MS 187-1]
 gi|300523630|gb|EFK44699.1| preprotein translocase, SecG subunit [Escherichia coli MS 119-7]
 gi|300529871|gb|EFK50933.1| preprotein translocase, SecG subunit [Escherichia coli MS 107-1]
 gi|300842749|gb|EFK70509.1| preprotein translocase, SecG subunit [Escherichia coli MS 124-1]
 gi|300846892|gb|EFK74652.1| preprotein translocase, SecG subunit [Escherichia coli MS 78-1]
 gi|306907031|gb|EFN37539.1| preprotein translocase, SecG subunit [Escherichia coli W]
 gi|308122709|gb|EFO59971.1| preprotein translocase, SecG subunit [Escherichia coli MS 145-7]
 gi|310334928|gb|EFQ01133.1| preprotein translocase, SecG subunit [Escherichia coli 1827-70]
 gi|315062481|gb|ADT76808.1| preprotein translocase membrane subunit [Escherichia coli W]
 gi|315257100|gb|EFU37068.1| preprotein translocase, SecG subunit [Escherichia coli MS 85-1]
 gi|320202089|gb|EFW76664.1| Preprotein translocase subunit SecG [Escherichia coli EC4100B]
 gi|323154388|gb|EFZ40589.1| preprotein translocase, SecG subunit [Escherichia coli EPECa14]
 gi|323178649|gb|EFZ64225.1| preprotein translocase, SecG subunit [Escherichia coli 1180]
 gi|323941725|gb|EGB37904.1| preprotein translocase SecG subunit [Escherichia coli E482]
 gi|323946971|gb|EGB42987.1| preprotein translocase SecG [Escherichia coli H120]
 gi|323961170|gb|EGB56784.1| preprotein translocase SecG subunit [Escherichia coli H489]
 gi|323970262|gb|EGB65533.1| preprotein translocase SecG subunit [Escherichia coli TA007]
 gi|324018300|gb|EGB87519.1| preprotein translocase, SecG subunit [Escherichia coli MS 117-3]
 gi|331062915|gb|EGI34829.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli TA271]
 gi|331073319|gb|EGI44642.1| protein-export membrane protein SecG (Preprotein translocase band
          1subunit) (P12) [Escherichia coli H591]
 gi|332102347|gb|EGJ05693.1| preprotein translocase subunit SecG [Shigella sp. D9]
          Length = 110

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLVLGNIN 74


>gi|114771698|ref|ZP_01449102.1| adenylosuccinate synthetase [alpha proteobacterium HTCC2255]
 gi|114547770|gb|EAU50660.1| adenylosuccinate synthetase [alpha proteobacterium HTCC2255]
          Length = 120

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
          MQ  ++V+HLI+ V L+ ++L+Q S+       G  +N    R  A  L + T I+A  F
Sbjct: 1  MQNVVLVIHLILSVSLIGIVLLQRSEGGGLGIGGGGNNSGGGRPKAAPLAKVTWIIAIAF 60

Query: 58 FATSIALGMISRYTS 72
            TSI L +I+   S
Sbjct: 61 LITSITLTIIAAKNS 75


>gi|161616299|ref|YP_001590264.1| hypothetical protein SPAB_04107 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161365663|gb|ABX69431.1| hypothetical protein SPAB_04107 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|267995488|gb|ACY90373.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
          Length = 175

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5   LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
           L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 70  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLATLFF 129

Query: 59  ATSIALGMIS 68
             S+ LG I+
Sbjct: 130 IISLVLGNIN 139


>gi|188532501|ref|YP_001906298.1| preprotein translocase subunit SecG [Erwinia tasmaniensis Et1/99]
 gi|188027543|emb|CAO95390.1| Protein-export membrane protein SecG (Preprotein translocase band
          1 subunit) [Erwinia tasmaniensis Et1/99]
          Length = 110

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S      + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSNGSGNFMTRMTAVLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLILGNIN 74


>gi|259907039|ref|YP_002647395.1| preprotein translocase subunit SecG [Erwinia pyrifoliae Ep1/96]
 gi|224962661|emb|CAX54116.1| Protein-export membrane protein SecG (Preprotein translocase band
          1 subunit) [Erwinia pyrifoliae Ep1/96]
 gi|283476835|emb|CAY72673.1| Protein-export membrane protein secG [Erwinia pyrifoliae DSM
          12163]
 gi|310766251|gb|ADP11201.1| protein-export protein [Erwinia sp. Ejp617]
          Length = 110

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S      + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSNGSGNFMTRMTAVLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLILGNIN 74


>gi|62129435|gb|AAX67138.1| preprotein translocase IISP family, auxillary membrane component
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
          Length = 175

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5   LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
           L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 70  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLATLFF 129

Query: 59  ATSIALGMIS 68
             S+ LG I+
Sbjct: 130 IISLVLGNIN 139


>gi|292486834|ref|YP_003529704.1| protein-export membrane protein SecG [Erwinia amylovora CFBP1430]
 gi|292900768|ref|YP_003540137.1| protein-export protein [Erwinia amylovora ATCC 49946]
 gi|291200616|emb|CBJ47748.1| protein-export protein [Erwinia amylovora ATCC 49946]
 gi|291552251|emb|CBA19288.1| Protein-export membrane protein secG [Erwinia amylovora CFBP1430]
          Length = 110

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S      + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSNGSGNFMTRMTAVLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLILGNIN 74


>gi|329113483|ref|ZP_08242264.1| Protein Translocase Subunit SecG [Acetobacter pomorum DM001]
 gi|326697308|gb|EGE48968.1| Protein Translocase Subunit SecG [Acetobacter pomorum DM001]
          Length = 114

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 5/62 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
          M   L+++H  V + L+ V+LIQ S+    G  S+     F S R TA+ L R TA+LA 
Sbjct: 1  MTTALLILHFCVTIALIGVVLIQRSEGGGLGIGSSQGMGAFMSGRGTANLLTRTTAVLAG 60

Query: 56 FF 57
           F
Sbjct: 61 VF 62


>gi|257095320|ref|YP_003168961.1| preprotein translocase subunit SecG [Candidatus Accumulibacter
          phosphatis clade IIA str. UW-1]
 gi|257047844|gb|ACV37032.1| preprotein translocase, SecG subunit [Candidatus Accumulibacter
          phosphatis clade IIA str. UW-1]
          Length = 123

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 51/90 (56%), Gaps = 10/90 (11%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILAFFFF 58
          ++VVH++  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA  FF
Sbjct: 8  VLVVHILAAMGVIGLVLVQHGKGADMGAAFGSGASGSLFGATGSANFLSRATAVLATVFF 67

Query: 59 ATSIALGMIS----RYTSTRYKDNMHRSLV 84
           TS++L  I+    + T +  +D ++ + V
Sbjct: 68 VTSLSLAYIASSKPKTTGSVMQDAVNSTPV 97


>gi|258542320|ref|YP_003187753.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-01]
 gi|256633398|dbj|BAH99373.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-01]
 gi|256636457|dbj|BAI02426.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-03]
 gi|256639510|dbj|BAI05472.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-07]
 gi|256642566|dbj|BAI08521.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-22]
 gi|256645621|dbj|BAI11569.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-26]
 gi|256648674|dbj|BAI14615.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-32]
 gi|256651727|dbj|BAI17661.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-01-42C]
 gi|256654718|dbj|BAI20645.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-12]
          Length = 114

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 5/62 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
          M   L+++H  V + L+ V+LIQ S+    G  S+     F S R TA+ L R TA+LA 
Sbjct: 1  MTTALLILHFCVTIALIGVVLIQRSEGGGLGIGSSQGMGAFMSGRGTANLLTRTTAVLAG 60

Query: 56 FF 57
           F
Sbjct: 61 VF 62


>gi|114327491|ref|YP_744648.1| protein translocase subunit secG [Granulibacter bethesdensis
          CGDNIH1]
 gi|114315665|gb|ABI61725.1| protein translocase subunit secG [Granulibacter bethesdensis
          CGDNIH1]
          Length = 133

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS-----SNFTSVRSTAHSLGRFTAILAF 55
          M   L+++HL V + L+ V+LIQ S+    G        +F S R TA+ L R TAILA 
Sbjct: 1  MNTVLLIIHLFVTLALIGVVLIQRSEGGGLGIGGSQGMGSFMSGRGTANLLTRTTAILAT 60

Query: 56 FFF 58
           F 
Sbjct: 61 LFM 63


>gi|50119650|ref|YP_048817.1| preprotein translocase subunit SecG [Pectobacterium atrosepticum
          SCRI1043]
 gi|49610176|emb|CAG73616.1| protein-export membrane protein [Pectobacterium atrosepticum
          SCRI1043]
          Length = 110

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+V+ L+V +GLV +I++Q    +    +FG+ ++ T   S+  S  + R TAILA  FF
Sbjct: 5  LLVIFLLVSIGLVALIMLQQGKGADMGASFGAGASATLFGSSGSSNFMTRMTAILATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG +S
Sbjct: 65 IISLILGNLS 74


>gi|260596199|ref|YP_003208770.1| protein-export membrane protein secG [Cronobacter turicensis
          z3032]
 gi|260215376|emb|CBA27397.1| Protein-export membrane protein secG [Cronobacter turicensis
          z3032]
          Length = 122

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 17 LLVVFLIVALGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLATLFF 76

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 77 IISLVLGNIN 86


>gi|209518516|ref|ZP_03267337.1| preprotein translocase, SecG subunit [Burkholderia sp. H160]
 gi|209501061|gb|EEA01096.1| preprotein translocase, SecG subunit [Burkholderia sp. H160]
          Length = 128

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRY 70
            FFAT++AL  +  Y
Sbjct: 64 ALFFATTLALTYLGAY 79


>gi|156935697|ref|YP_001439613.1| preprotein translocase subunit SecG [Cronobacter sakazakii ATCC
          BAA-894]
 gi|156533951|gb|ABU78777.1| hypothetical protein ESA_03566 [Cronobacter sakazakii ATCC
          BAA-894]
          Length = 110

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVALGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLVLGNIN 74


>gi|84516438|ref|ZP_01003797.1| preprotein translocase, SecG subunit [Loktanella vestfoldensis
          SKA53]
 gi|84509474|gb|EAQ05932.1| preprotein translocase, SecG subunit [Loktanella vestfoldensis
          SKA53]
          Length = 117

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 2/70 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV--RSTAHSLGRFTAILAFFFF 58
          M+  ++++HLI+ + L+  +L+Q S+    G      +   R  A ++ +FT +LA  F 
Sbjct: 1  MENVVLIIHLILALSLIGTVLLQRSEGGGLGMGGGGGTANSRPPASAISKFTWMLAAAFI 60

Query: 59 ATSIALGMIS 68
          ATSI L +I+
Sbjct: 61 ATSITLTLIA 70


>gi|86148841|ref|ZP_01067103.1| translocase [Vibrio sp. MED222]
 gi|85833368|gb|EAQ51564.1| translocase [Vibrio sp. MED222]
          Length = 110

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 50/92 (54%), Gaps = 7/92 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 5  LLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFATTFF 64

Query: 59 ATSIALGMISRY-TSTRYKDNMHRSLVDSIKD 89
            S+ LG +S + T +++ D     ++   +D
Sbjct: 65 ILSLVLGNMSTHKTESQWIDPTQGQVIQQAED 96


>gi|82778489|ref|YP_404838.1| preprotein translocase subunit SecG [Shigella dysenteriae Sd197]
 gi|309785503|ref|ZP_07680134.1| preprotein translocase, SecG subunit [Shigella dysenteriae 1617]
 gi|81242637|gb|ABB63347.1| protein export - membrane protein [Shigella dysenteriae Sd197]
 gi|308926623|gb|EFP72099.1| preprotein translocase, SecG subunit [Shigella dysenteriae 1617]
          Length = 110

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GL+ +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLIGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLVLGNIN 74


>gi|293416605|ref|ZP_06659244.1| protein-export membrane protein secG [Escherichia coli B185]
 gi|291431961|gb|EFF04944.1| protein-export membrane protein secG [Escherichia coli B185]
          Length = 110

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GL+ +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLIGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLVLGNIN 74


>gi|295676036|ref|YP_003604560.1| preprotein translocase, SecG subunit [Burkholderia sp. CCGE1002]
 gi|295435879|gb|ADG15049.1| preprotein translocase, SecG subunit [Burkholderia sp. CCGE1002]
          Length = 131

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRY 70
            FFAT++AL  +  Y
Sbjct: 64 ALFFATTLALTYLGAY 79


>gi|116625814|ref|YP_827970.1| protein translocase subunit secG [Candidatus Solibacter usitatus
          Ellin6076]
 gi|116228976|gb|ABJ87685.1| protein translocase subunit secG [Candidatus Solibacter usitatus
          Ellin6076]
          Length = 142

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 6/74 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
          M I L +VH+IV + L+ V+L+QS  ++    AFG   + T+   R +A  L + T I A
Sbjct: 1  MYILLWIVHVIVCLFLIIVVLLQSGKAADLAGAFGGMGSQTAFGPRGSATLLSKATTISA 60

Query: 55 FFFFATSIALGMIS 68
            F  TS++L +++
Sbjct: 61 ILFMITSLSLSILA 74


>gi|262370083|ref|ZP_06063410.1| preprotein translocase subunit SecG [Acinetobacter johnsonii
          SH046]
 gi|262315122|gb|EEY96162.1| preprotein translocase subunit SecG [Acinetobacter johnsonii
          SH046]
          Length = 109

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 45/88 (51%), Gaps = 24/88 (27%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ-------------SSDSSAFGS--SSNFTSVRSTAHS 45
          MQ F++VVH+I+ V ++ +IL+Q                ++ FG+  S NF         
Sbjct: 1  MQTFVLVVHIILAVLMIVLILVQHGKGADAGASFGGGGAATVFGASGSGNF--------- 51

Query: 46 LGRFTAILAFFFFATSIALGMISRYTST 73
          L R TA+L   FF TS++L + ++  +T
Sbjct: 52 LTRLTAVLTALFFITSLSLAVFAKKQTT 79


>gi|300718580|ref|YP_003743383.1| Protein-export membrane protein SecG (Preprotein translocase band
          1 subunit) [Erwinia billingiae Eb661]
 gi|299064416|emb|CAX61536.1| Protein-export membrane protein SecG (Preprotein translocase band
          1 subunit) [Erwinia billingiae Eb661]
          Length = 110

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 8/68 (11%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS-------AFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
          L+VV LIV +GLV +I++Q    +       A GS++ F S   + + + R TA+LA  F
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGGSATLFGS-NGSGNFMTRMTAVLATLF 63

Query: 58 FATSIALG 65
          F  S+ LG
Sbjct: 64 FIISLILG 71


>gi|297538987|ref|YP_003674756.1| preprotein translocase subunit SecG [Methylotenera sp. 301]
 gi|297258334|gb|ADI30179.1| preprotein translocase, SecG subunit [Methylotenera sp. 301]
          Length = 118

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 43/76 (56%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          M+  ++V+H+I  +G++ ++L+Q    +    +FGS  S +   V  +A+ + R TA+  
Sbjct: 1  MEKLVLVIHVIAALGVIALVLLQHGKGADMGASFGSGASGSLFGVSGSANFMSRATAVFV 60

Query: 55 FFFFATSIALGMISRY 70
            FF TS+ L  +S +
Sbjct: 61 LIFFTTSLTLAYMSSH 76


>gi|254457333|ref|ZP_05070761.1| preprotein translocase SecG subunit [Campylobacterales bacterium
          GD 1]
 gi|207086125|gb|EDZ63409.1| preprotein translocase SecG subunit [Campylobacterales bacterium
          GD 1]
          Length = 112

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 11/93 (11%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
          FL++V +I+VV LV  +L+Q S S       GS+ +    +     L + T ++ F F +
Sbjct: 5  FLLIVQIILVVILVIAVLLQKSSSIGLGAYSGSNESVFGAKGPNSFLAKTTFLIGFLFVS 64

Query: 60 TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
           +IALG +       Y      S+VD++ +  N
Sbjct: 65 NTIALGYL-------YSSTAQTSVVDNMVETTN 90


>gi|146276923|ref|YP_001167082.1| preprotein translocase subunit SecG [Rhodobacter sphaeroides ATCC
          17025]
 gi|145555164|gb|ABP69777.1| protein translocase subunit secG [Rhodobacter sphaeroides ATCC
          17025]
          Length = 207

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD--SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          MQ  +++VHLI+ + L+ V+L+Q S+      G      + R  A+++ R T + A  F 
Sbjct: 1  MQNVVLIVHLILALLLIGVVLLQRSEGGGLGMGGGGGAMTGRQAANAMTRLTWVFAVAFI 60

Query: 59 ATSIAL 64
           TSIAL
Sbjct: 61 GTSIAL 66


>gi|253686970|ref|YP_003016160.1| preprotein translocase, SecG subunit [Pectobacterium carotovorum
          subsp. carotovorum PC1]
 gi|251753548|gb|ACT11624.1| preprotein translocase, SecG subunit [Pectobacterium carotovorum
          subsp. carotovorum PC1]
          Length = 110

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+V+ L+V +GLV +I++Q    +    +FG+ ++ T   S+     + R TAILA  FF
Sbjct: 5  LLVIFLLVSIGLVALIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAILATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG +S
Sbjct: 65 IISLVLGNLS 74


>gi|291616007|ref|YP_003518749.1| SecG [Pantoea ananatis LMG 20103]
 gi|291151037|gb|ADD75621.1| SecG [Pantoea ananatis LMG 20103]
 gi|327396258|dbj|BAK13680.1| protein-export membrane protein SecG [Pantoea ananatis AJ13355]
          Length = 113

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 6/67 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S      + R TA+LA  FF
Sbjct: 7  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSNGSGNFMTRMTAVLATLFF 66

Query: 59 ATSIALG 65
            S+ LG
Sbjct: 67 VISLILG 73


>gi|260771176|ref|ZP_05880103.1| preprotein translocase subunit SecG [Vibrio furnissii CIP 102972]
 gi|260613773|gb|EEX38965.1| preprotein translocase subunit SecG [Vibrio furnissii CIP 102972]
 gi|315179218|gb|ADT86132.1| preprotein translocase subunit SecG [Vibrio furnissii NCTC 11218]
          Length = 112

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 48/88 (54%), Gaps = 7/88 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  VG++ ++LIQ        ++FG+ ++ T      + + L R TAI A  FF
Sbjct: 5  LLVIYLLAAVGIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFATVFF 64

Query: 59 ATSIALGMISRY-TSTRYKDNMHRSLVD 85
            S+ LG +S + T +++ D     ++ 
Sbjct: 65 IISLVLGNMSTHKTESQWVDPSQGQVIQ 92


>gi|90416129|ref|ZP_01224061.1| preprotein translocase IISP family, auxillary membrane component
          [marine gamma proteobacterium HTCC2207]
 gi|90331854|gb|EAS47068.1| preprotein translocase IISP family, auxillary membrane component
          [marine gamma proteobacterium HTCC2207]
          Length = 116

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLG------RFTAILA 54
          M+ F+++ H +V V L+ +IL+Q    +  G+S      ++   S G      R TAIL+
Sbjct: 1  MENFILIFHFLVAVFLIGLILVQQGKGAEAGASFGAGGSQTVFGSGGSWNFFSRMTAILS 60

Query: 55 FFFFATSIALGMISR 69
            FF TS++L +I++
Sbjct: 61 TIFFVTSVSLAVIAK 75


>gi|254797206|ref|YP_003082046.1| preprotein translocase, SecG subunit [Neorickettsia risticii str.
          Illinois]
 gi|254590444|gb|ACT69806.1| preprotein translocase, SecG subunit [Neorickettsia risticii str.
          Illinois]
          Length = 107

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFFFF 58
          +FL+V+  IV V +V ++L Q+S SS  G+ ++       VRS +    RFT +L   FF
Sbjct: 2  LFLIVLQFIVAVLIVILVLCQNSGSSVPGALTSGRRGLFPVRSASGLFVRFTWVLLLLFF 61

Query: 59 ATSIALGMISRYTSTR 74
            +I LG ++  ++T 
Sbjct: 62 LNTIFLGRLNFASNTE 77


>gi|84387289|ref|ZP_00990310.1| translocase [Vibrio splendidus 12B01]
 gi|84377936|gb|EAP94798.1| translocase [Vibrio splendidus 12B01]
          Length = 110

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 50/92 (54%), Gaps = 7/92 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TA+ A  FF
Sbjct: 5  LLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAVFATTFF 64

Query: 59 ATSIALGMISRY-TSTRYKDNMHRSLVDSIKD 89
            S+ LG +S + T +++ D     ++   +D
Sbjct: 65 ILSLVLGNMSTHKTESQWIDPTQGQVIQQAED 96


>gi|293393156|ref|ZP_06637471.1| homoserine dehydrogenase [Serratia odorifera DSM 4582]
 gi|291424302|gb|EFE97516.1| homoserine dehydrogenase [Serratia odorifera DSM 4582]
          Length = 111

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 49/92 (53%), Gaps = 8/92 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+V+ L++ +GLV +I++Q    +    +FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVIFLLISIGLVALIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAVLATLFF 64

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
            S+ LG +S   S +  +    +L   +K +
Sbjct: 65 VISLILGNLSSNQSQKGSE--WENLGQPVKTE 94


>gi|126735304|ref|ZP_01751050.1| preprotein translocase, SecG subunit, putative [Roseobacter sp.
           CCS2]
 gi|126715859|gb|EBA12724.1| preprotein translocase, SecG subunit, putative [Roseobacter sp.
           CCS2]
          Length = 118

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 53/111 (47%), Gaps = 15/111 (13%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV---RSTAHSLGRFTAILAFFF 57
           M+  ++++HLI+ + L+  +L+Q S+    G           R  A ++ +FT  LA  F
Sbjct: 1   MENVVLIIHLILALALIGTVLLQRSEGGGLGMGGGGGGATGSRPAATAMSKFTWALAAAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIK-DQGND-----NFGDGSSPK 102
             TSI+L +I+        +    S+VD +  D G+D     +FGD   P 
Sbjct: 61  ICTSISLTLIAA------SNTAGSSVVDQLGIDPGSDAPLLPDFGDSLLPP 105


>gi|253991505|ref|YP_003042861.1| preprotein translocase subunit SecG [Photorhabdus asymbiotica
          subsp. asymbiotica ATCC 43949]
 gi|211638383|emb|CAR67005.1| protein-export membrane protein secg (preprotein translocase band
          subunit) (p12) [Photorhabdus asymbiotica subsp.
          asymbiotica ATCC 43949]
 gi|253782955|emb|CAQ86120.1| protein-export membrane protein secg (preprotein translocase band
          subunit) (p12) [Photorhabdus asymbiotica]
          Length = 114

 Score = 38.9 bits (89), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 7/79 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L++V L+V +GL+ ++++Q        ++FG+ ++ T   S+     + R TAI A  FF
Sbjct: 5  LLIVFLLVAIGLIALVMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAIFAALFF 64

Query: 59 ATSIALG-MISRYTSTRYK 76
            S+ LG M S  T T  K
Sbjct: 65 IISLVLGNMTSNQTGTSSK 83


>gi|160876526|ref|YP_001555842.1| preprotein translocase subunit SecG [Shewanella baltica OS195]
 gi|160862048|gb|ABX50582.1| preprotein translocase, SecG subunit [Shewanella baltica OS195]
 gi|315268720|gb|ADT95573.1| preprotein translocase, SecG subunit [Shewanella baltica OS678]
          Length = 111

 Score = 38.5 bits (88), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 6/74 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M   L+V++L+V +GL+ ++LIQ        ++FG+ ++ T   S+     L R TAILA
Sbjct: 1  MYEVLVVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILA 60

Query: 55 FFFFATSIALGMIS 68
            FF  S+ +G +S
Sbjct: 61 IAFFTLSLLIGNLS 74


>gi|227328607|ref|ZP_03832631.1| preprotein translocase subunit SecG [Pectobacterium carotovorum
          subsp. carotovorum WPP14]
 gi|290454896|emb|CBJ57154.1| preprotein translocase subunit SecG [Pectobacterium carotovorum]
          Length = 110

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+V+ L+V +GLV +I++Q        ++FG+ ++ T   S+     + R TAILA  FF
Sbjct: 5  LLVIFLLVSIGLVALIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAILATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG +S
Sbjct: 65 IISLILGNLS 74


>gi|90022361|ref|YP_528188.1| protein translocase subunit secG [Saccharophagus degradans 2-40]
 gi|89951961|gb|ABD81976.1| protein translocase subunit secG [Saccharophagus degradans 2-40]
          Length = 129

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLG------RFTAILA 54
          M+  + +VHL+V + ++ +IL+Q    +  G+S    + ++   S G      R TA+L 
Sbjct: 1  MENIIFIVHLLVALAIIGLILMQQGKGAEMGASFGAGASQTLFGSGGSGNFFSRMTALLV 60

Query: 55 FFFFATSIALGMISRYTSTRYKD 77
            FF TS AL +I++  +   +D
Sbjct: 61 AVFFITSFALAIIAKKQADITED 83


>gi|329889378|ref|ZP_08267721.1| preprotein translocase, SecG subunit [Brevundimonas diminuta ATCC
          11568]
 gi|328844679|gb|EGF94243.1| preprotein translocase, SecG subunit [Brevundimonas diminuta ATCC
          11568]
          Length = 138

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 3/73 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS---SSNFTSVRSTAHSLGRFTAILAFFF 57
          +Q  L+V  +++ V L  VIL+Q S+  A G     S F + R   + L R T+ILA  F
Sbjct: 6  LQTILLVAMILISVALSAVILLQRSEGGALGMGGGPSGFMTARGAGNLLTRTTSILAIAF 65

Query: 58 FATSIALGMISRY 70
          F  +I L +   Y
Sbjct: 66 FVCAIGLTIAGNY 78


>gi|91776415|ref|YP_546171.1| preprotein translocase subunit SecG [Methylobacillus flagellatus
          KT]
 gi|91710402|gb|ABE50330.1| protein translocase subunit secG [Methylobacillus flagellatus KT]
          Length = 111

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 45/80 (56%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          M+  + V+H+I  +G+V ++L+Q    +    AFGS  S +   V  +++ + R TAI  
Sbjct: 1  METIVTVIHVIAALGVVALVLLQHGKGADMGAAFGSGASGSLFGVSGSSNFMSRATAICV 60

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF TS++L  ++ + S +
Sbjct: 61 AIFFVTSMSLAYLASHRSEQ 80


>gi|16125963|ref|NP_420527.1| hypothetical protein CC_1719 [Caulobacter crescentus CB15]
 gi|13423135|gb|AAK23695.1| hypothetical protein CC_1719 [Caulobacter crescentus CB15]
          Length = 211

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFFFATS 61
           L+ ++++V +GL+ V+L+Q S+  A G   N     + R     L R T IL   F   S
Sbjct: 62  LLAINIVVCLGLIGVVLLQRSEGGALGMGGNSGGLMTARGAGDLLTRITWILFSIFLTIS 121

Query: 62  IAL 64
           + L
Sbjct: 122 LVL 124


>gi|262401662|ref|ZP_06078228.1| preprotein translocase subunit SecG [Vibrio sp. RC586]
 gi|262352079|gb|EEZ01209.1| preprotein translocase subunit SecG [Vibrio sp. RC586]
          Length = 110

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 7/92 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 5  LLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFATIFF 64

Query: 59 ATSIALGMISRY-TSTRYKDNMHRSLVDSIKD 89
            S+ LG +S + T +++ D     ++    D
Sbjct: 65 VISLVLGNMSTHKTESQWVDPSQGQVIQQTGD 96


>gi|320355228|ref|YP_004196567.1| protein translocase subunit SecG [Desulfobulbus propionicus DSM
          2032]
 gi|320123730|gb|ADW19276.1| protein translocase subunit secG [Desulfobulbus propionicus DSM
          2032]
          Length = 124

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAF-----GSSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+VVH+IV + L+C++L+Q    +       GSS +          L + T + A 
Sbjct: 1  MTTILIVVHVIVCLFLICIVLLQHGKGADIGASFGGSSQSLFGTEGPVPLLNKITTLAAI 60

Query: 56 FFFATSIALGMIS 68
           F  TS+ L  +S
Sbjct: 61 VFMGTSVTLAYLS 73


>gi|89055671|ref|YP_511122.1| preprotein translocase subunit SecG [Jannaschia sp. CCS1]
 gi|88865220|gb|ABD56097.1| protein translocase subunit secG [Jannaschia sp. CCS1]
          Length = 123

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 54/113 (47%), Gaps = 13/113 (11%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV------RSTAHSLGRFTAILA 54
           M+  ++V+HLI+ + L+ V+L+Q S+    G              R  A +LG+ T   A
Sbjct: 1   MENVILVIHLILAICLIGVVLLQRSEGGGLGMGGGGGGGGGVMTGRQAATALGKLTWFFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKD-QGNDNFGDGSSPKLDSV 106
             F ATSI L +I+       +++   SL+D +      +   D + P +DS+
Sbjct: 61  VAFLATSITLTVIAA------QNSAGSSLLDDLGGLPAVEGDADSALPPIDSM 107


>gi|50083626|ref|YP_045136.1| preprotein translocase subunit SecG [Acinetobacter sp. ADP1]
 gi|49529602|emb|CAG67314.1| preprotein translocase IISP family, auxillary membrane component
           [Acinetobacter sp. ADP1]
          Length = 109

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 56/126 (44%), Gaps = 33/126 (26%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD-------------SSAFGS--SSNFTSVRSTAHS 45
           M  F++VVH+I+ V ++ ++LIQ                ++ FG+  S NF         
Sbjct: 1   MHTFVLVVHIILAVLIIGLVLIQHGKGADAGASFGGGGAATVFGASGSGNF--------- 51

Query: 46  LGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
           L R TA+L   FF TS++L + ++  +T            S+K     N    S+P+   
Sbjct: 52  LTRVTAVLTALFFVTSLSLAVFAKKQTTD---------AYSLKSVQTTNSAPASTPETSP 102

Query: 106 VSAKSS 111
            + KSS
Sbjct: 103 NAPKSS 108


>gi|296104886|ref|YP_003615032.1| preprotein translocase subunit SecG [Enterobacter cloacae subsp.
          cloacae ATCC 13047]
 gi|295059345|gb|ADF64083.1| preprotein translocase subunit SecG [Enterobacter cloacae subsp.
          cloacae ATCC 13047]
 gi|295097661|emb|CBK86751.1| protein translocase subunit secG [Enterobacter cloacae subsp.
          cloacae NCTC 9394]
          Length = 110

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 6/76 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRST--AHSLGRFTAILAFFFF 58
          L+V+ LIV + LV +I++Q    +    +FG+ ++ T   S+  A+ + R TAILA  FF
Sbjct: 5  LLVIFLIVAIALVALIMLQQGKGADMGASFGAGASGTLFGSSGSANFMTRTTAILATLFF 64

Query: 59 ATSIALGMISRYTSTR 74
            S+ LG I+   +++
Sbjct: 65 IISLVLGNINSNKTSK 80


>gi|221234727|ref|YP_002517163.1| protein translocase subunit SecG [Caulobacter crescentus NA1000]
 gi|220963899|gb|ACL95255.1| protein translocase subunit secG [Caulobacter crescentus NA1000]
          Length = 155

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 9/87 (10%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFFFATS 61
          L+ ++++V +GL+ V+L+Q S+  A G   N     + R     L R T IL   F   S
Sbjct: 6  LLAINIVVCLGLIGVVLLQRSEGGALGMGGNSGGLMTARGAGDLLTRITWILFSIFLTIS 65

Query: 62 IALGMISRYTSTRYKDNMHRSLVDSIK 88
          + L +++       + +   S+ DSIK
Sbjct: 66 LVLTILT------GRLDKSGSVADSIK 86


>gi|119944576|ref|YP_942256.1| preprotein translocase, SecG subunit [Psychromonas ingrahamii 37]
 gi|119863180|gb|ABM02657.1| protein translocase subunit secG [Psychromonas ingrahamii 37]
          Length = 107

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 39/74 (52%), Gaps = 6/74 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFT--SVRSTAHSLGRFTAILA 54
          M   L+VV+LIV + L+  +LIQ    +     FGS S+ T        + + R TAILA
Sbjct: 1  MYEILLVVYLIVAIILIGFVLIQQGKGAGMGASFGSGSSNTVFGASGAGNFMTRTTAILA 60

Query: 55 FFFFATSIALGMIS 68
            FF  S+ LG +S
Sbjct: 61 IVFFGLSLVLGNLS 74


>gi|186476765|ref|YP_001858235.1| preprotein translocase subunit SecG [Burkholderia phymatum
          STM815]
 gi|184193224|gb|ACC71189.1| preprotein translocase, SecG subunit [Burkholderia phymatum
          STM815]
          Length = 130

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 6/78 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +    AFGS  S +      +A+ L R TAILA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAILA 63

Query: 55 FFFFATSIALGMISRYTS 72
            FF T++AL  +  Y S
Sbjct: 64 AVFFVTTLALTYLGAYHS 81


>gi|258623145|ref|ZP_05718156.1| translocase [Vibrio mimicus VM573]
 gi|258584565|gb|EEW09303.1| translocase [Vibrio mimicus VM573]
          Length = 111

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 7/92 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 5  LLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFATIFF 64

Query: 59 ATSIALGMISRY-TSTRYKDNMHRSLVDSIKD 89
            S+ LG +S + T +++ D     ++    D
Sbjct: 65 VISLVLGNMSTHKTESQWVDPSQGQVIQQADD 96


>gi|296274576|ref|YP_003657207.1| preprotein translocase subunit SecG [Arcobacter nitrofigilis DSM
          7299]
 gi|296098750|gb|ADG94700.1| preprotein translocase, SecG subunit [Arcobacter nitrofigilis DSM
          7299]
          Length = 128

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 11/90 (12%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
          L+VV  I+ V L   IL+Q S S       GS+ +    +   + L + T +L   F   
Sbjct: 5  LLVVQFILAVLLTICILLQKSSSMGLGAYSGSNESLFGAKGPGNFLTKATMVLGLIFVLN 64

Query: 61 SIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
          ++ LG         Y +N  RS VD+++ +
Sbjct: 65 TLVLGYF-------YNENRQRSAVDNVQTE 87


>gi|119386420|ref|YP_917475.1| preprotein translocase subunit SecG [Paracoccus denitrificans
          PD1222]
 gi|119377015|gb|ABL71779.1| protein translocase subunit secG [Paracoccus denitrificans
          PD1222]
          Length = 176

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV---RSTAHSLGRFTAILAFFFFAT 60
           ++ VHLI+ V L+ V+L+Q S+    G       V   R  A++L R T I A  F  T
Sbjct: 5  IVLTVHLILAVLLIGVVLLQRSEGGGLGMGGGGGGVMTGRQAANALSRLTWIFAIGFIIT 64

Query: 61 SIALGMIS 68
          S+ L +I+
Sbjct: 65 SMTLTLIA 72


>gi|227112559|ref|ZP_03826215.1| preprotein translocase subunit SecG [Pectobacterium carotovorum
          subsp. brasiliensis PBR1692]
          Length = 110

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+V+ L+V +GLV +I++Q        ++FG+ ++ T   S+     + R TAILA  FF
Sbjct: 5  LLVIFLLVSIGLVALIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAILATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG +S
Sbjct: 65 IISLILGNLS 74


>gi|261342618|ref|ZP_05970476.1| homoserine dehydrogenase [Enterobacter cancerogenus ATCC 35316]
 gi|288315266|gb|EFC54204.1| homoserine dehydrogenase [Enterobacter cancerogenus ATCC 35316]
          Length = 110

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 6/76 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRST--AHSLGRFTAILAFFFF 58
          L+V+ LIV + LV +I++Q    +    +FG+ ++ T   S+  A+ + R TAILA  FF
Sbjct: 5  LLVIFLIVAIALVALIMLQQGKGADMGASFGAGASGTLFGSSGSANFMTRTTAILATLFF 64

Query: 59 ATSIALGMISRYTSTR 74
            S+ LG I+   +++
Sbjct: 65 IISLVLGNINSNKTSK 80


>gi|332181440|gb|AEE17128.1| preprotein translocase, SecG subunit [Treponema brennaborense DSM
          12168]
          Length = 118

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 20/87 (22%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSD------------SSAFGSSSNFTSVRSTAHSLGRFT 50
          I L+V  +I+ + LVC++L+Q+ +            S+AFGS S         + L + T
Sbjct: 6  IILLVAFVIICILLVCIVLVQNEEGGGMGGLFGGGNSAAFGSRSG--------NVLTKTT 57

Query: 51 AILAFFFFATSIALGMISRYTSTRYKD 77
           IL   FF +S  L +I++  S +  D
Sbjct: 58 YILVTLFFLSSFGLALINKAPSVKSLD 84


>gi|251791038|ref|YP_003005759.1| preprotein translocase subunit SecG [Dickeya zeae Ech1591]
 gi|247539659|gb|ACT08280.1| preprotein translocase, SecG subunit [Dickeya zeae Ech1591]
          Length = 111

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+V+ L+V +GLV +I++Q        ++FG+ ++ T   S+     + R TA+ A  FF
Sbjct: 5  LLVIFLLVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALFATLFF 64

Query: 59 ATSIALGMISRYTSTRYK--DNMHRSLVDSIKDQ 90
            S+ LG +S   S +    DN+ + +     +Q
Sbjct: 65 VLSLILGNMSSDHSKKGSGWDNLSQPVAPEKAEQ 98


>gi|261820125|ref|YP_003258231.1| preprotein translocase subunit SecG [Pectobacterium wasabiae
          WPP163]
 gi|261604138|gb|ACX86624.1| preprotein translocase, SecG subunit [Pectobacterium wasabiae
          WPP163]
          Length = 110

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+V+ L+V +GLV +I++Q        ++FG+ ++ T   S+     + R TAILA  FF
Sbjct: 5  LLVIFLLVSIGLVALIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAILATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG +S
Sbjct: 65 IISLILGNLS 74


>gi|326794267|ref|YP_004312087.1| preprotein translocase, SecG subunit [Marinomonas mediterranea
          MMB-1]
 gi|326545031|gb|ADZ90251.1| preprotein translocase, SecG subunit [Marinomonas mediterranea
          MMB-1]
          Length = 115

 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 6/74 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ---SSDSSA-FGSSSNFTSVRSTAHS--LGRFTAILA 54
          M+  ++VVH++  V ++ ++L+Q    +D+ A FG  ++ T   S   S   GR TA  A
Sbjct: 1  MEALILVVHVLAAVAIIALVLLQQGKGADAGASFGGGASQTVFGSQGGSSFFGRMTAFFA 60

Query: 55 FFFFATSIALGMIS 68
            FF TS  L  ++
Sbjct: 61 LVFFLTSFGLAYVA 74


>gi|254292206|ref|ZP_04962974.1| preprotein translocase, SecG subunit [Vibrio cholerae AM-19226]
 gi|150421887|gb|EDN13866.1| preprotein translocase, SecG subunit [Vibrio cholerae AM-19226]
          Length = 111

 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 7/92 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 5  LLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFATVFF 64

Query: 59 ATSIALGMISRY-TSTRYKDNMHRSLVDSIKD 89
            S+ LG +S + T +++ D     ++    D
Sbjct: 65 VISLVLGNMSTHKTESQWVDPSQGQVIQQTGD 96


>gi|262189771|ref|ZP_06048122.1| preprotein translocase subunit SecG [Vibrio cholerae CT 5369-93]
 gi|262034348|gb|EEY52737.1| preprotein translocase subunit SecG [Vibrio cholerae CT 5369-93]
          Length = 111

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 7/92 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 5  LLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFATVFF 64

Query: 59 ATSIALGMISRY-TSTRYKDNMHRSLVDSIKD 89
            S+ LG +S + T +++ D     ++    D
Sbjct: 65 VISLVLGNMSTHKTESQWLDPSQGQVIQQTGD 96


>gi|261492437|ref|ZP_05988993.1| Sec family Type II general secretory pathway preprotein translocase
           SecG [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261311896|gb|EEY13043.1| Sec family Type II general secretory pathway preprotein translocase
           SecG [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 114

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 59/106 (55%), Gaps = 17/106 (16%)

Query: 5   LMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFTSVRS--TAHSLGRFTAILAFFFF 58
           L +V+L+V V L+  +L+Q    +D+ A FG+ ++ T   S  +A+ L R TA+LA  FF
Sbjct: 6   LTIVYLVVAVLLIAFVLMQQGKGADAGASFGAGASATVFGSAGSANFLSRTTALLATIFF 65

Query: 59  ATSIALGMISRY---TSTRYKD--------NMHRSLVDSIKDQGND 93
           A S+ +G +S +     ++++D         + +  V+ +K + +D
Sbjct: 66  AISLVIGNLSSHNVAPKSQFEDLSQFEDLSQVEQKQVEPVKIENSD 111


>gi|238918421|ref|YP_002931935.1| preprotein translocase, SecG subunit, putative [Edwardsiella
          ictaluri 93-146]
 gi|238867989|gb|ACR67700.1| preprotein translocase, SecG subunit, putative [Edwardsiella
          ictaluri 93-146]
          Length = 111

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 48/87 (55%), Gaps = 8/87 (9%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRS--TAHSLGRFTAILAFFFF 58
          L+V+ L++ V L+ +I++Q    +    +FG+ ++ T   S  T + + R T ILA  FF
Sbjct: 5  LLVIFLLISVALIALIMLQQGKGADMGASFGAGASATLFGSSGTGNFMTRTTGILATLFF 64

Query: 59 ATSIALGMISRYTSTR--YKDNMHRSL 83
            S+ LG +S + S +    DN+ + +
Sbjct: 65 VLSLVLGNLSGHQSKQGSEWDNLGQPM 91


>gi|15803715|ref|NP_289749.1| preprotein translocase subunit SecG [Escherichia coli O157:H7
          EDL933]
 gi|25306329|pir||A85981 protein export membrane protein [imported] - Escherichia coli
          (strain O157:H7, substrain EDL933)
 gi|12517787|gb|AAG58309.1|AE005546_3 protein export - membrane protein [Escherichia coli O157:H7 str.
          EDL933]
          Length = 110

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GL  +I++Q    +    +FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLXGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLVLGNIN 74


>gi|217976696|ref|YP_002360843.1| preprotein translocase, SecG subunit [Methylocella silvestris
          BL2]
 gi|217502072|gb|ACK49481.1| preprotein translocase, SecG subunit [Methylocella silvestris
          BL2]
          Length = 123

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 44/74 (59%), Gaps = 2/74 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST--AHSLGRFTAILAFFFF 58
          MQ  L+V+HL++VV LV  +L+Q S+  A G       +     A+ L R TAILA  FF
Sbjct: 1  MQTVLIVIHLMIVVALVVTVLLQRSEGGALGVGGGGGFMTGRGQANVLTRATAILAALFF 60

Query: 59 ATSIALGMISRYTS 72
          ATS+ L  +++YT 
Sbjct: 61 ATSLGLTALAKYTQ 74


>gi|119774095|ref|YP_926835.1| preprotein translocase subunit SecG [Shewanella amazonensis SB2B]
 gi|119766595|gb|ABL99165.1| protein translocase subunit secG [Shewanella amazonensis SB2B]
          Length = 108

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+V++L+V +GL+ ++LIQ        ++FG+ ++ T   S+     L R TAILA  FF
Sbjct: 5  LIVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAILAVAFF 64

Query: 59 ATSIALGMIS 68
            S+ +G +S
Sbjct: 65 TLSLIIGNLS 74


>gi|15640660|ref|NP_230289.1| preprotein translocase subunit SecG [Vibrio cholerae O1 biovar El
          Tor str. N16961]
 gi|147675589|ref|YP_001216134.1| preprotein translocase subunit SecG [Vibrio cholerae O395]
 gi|153215849|ref|ZP_01950181.1| preprotein translocase, SecG subunit [Vibrio cholerae 1587]
 gi|153820383|ref|ZP_01973050.1| preprotein translocase, SecG subunit [Vibrio cholerae NCTC 8457]
 gi|227080821|ref|YP_002809372.1| preprotein translocase, SecG subunit [Vibrio cholerae M66-2]
 gi|254850874|ref|ZP_05240224.1| preprotein translocase subunit SecG [Vibrio cholerae MO10]
 gi|255744143|ref|ZP_05418096.1| preprotein translocase subunit SecG [Vibrio cholera CIRS 101]
 gi|262156119|ref|ZP_06029238.1| preprotein translocase subunit SecG [Vibrio cholerae INDRE 91/1]
 gi|262169939|ref|ZP_06037629.1| preprotein translocase subunit SecG [Vibrio cholerae RC27]
 gi|297580766|ref|ZP_06942692.1| preprotein translocase [Vibrio cholerae RC385]
 gi|298500756|ref|ZP_07010559.1| preprotein translocase subunit SecG [Vibrio cholerae MAK 757]
 gi|9655076|gb|AAF93806.1| preprotein translocase, SecG subunit [Vibrio cholerae O1 biovar
          El Tor str. N16961]
 gi|124114566|gb|EAY33386.1| preprotein translocase, SecG subunit [Vibrio cholerae 1587]
 gi|126509073|gb|EAZ71667.1| preprotein translocase, SecG subunit [Vibrio cholerae NCTC 8457]
 gi|146317472|gb|ABQ22011.1| preprotein translocase, SecG subunit [Vibrio cholerae O395]
 gi|227008709|gb|ACP04921.1| preprotein translocase, SecG subunit [Vibrio cholerae M66-2]
 gi|227012465|gb|ACP08675.1| preprotein translocase, SecG subunit [Vibrio cholerae O395]
 gi|254846579|gb|EET24993.1| preprotein translocase subunit SecG [Vibrio cholerae MO10]
 gi|255738083|gb|EET93475.1| preprotein translocase subunit SecG [Vibrio cholera CIRS 101]
 gi|262021673|gb|EEY40384.1| preprotein translocase subunit SecG [Vibrio cholerae RC27]
 gi|262030155|gb|EEY48800.1| preprotein translocase subunit SecG [Vibrio cholerae INDRE 91/1]
 gi|297535182|gb|EFH74017.1| preprotein translocase [Vibrio cholerae RC385]
 gi|297540537|gb|EFH76595.1| preprotein translocase subunit SecG [Vibrio cholerae MAK 757]
 gi|327483442|gb|AEA77849.1| Preprotein translocase subunit SecG [Vibrio cholerae LMA3894-4]
          Length = 111

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 7/92 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 5  LLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFATVFF 64

Query: 59 ATSIALGMISRY-TSTRYKDNMHRSLVDSIKD 89
            S+ LG +S + T +++ D     ++    D
Sbjct: 65 VISLVLGNMSTHKTESQWVDPSQGQVIQQAGD 96


>gi|195941094|ref|ZP_03086476.1| preprotein translocase subunit SecG [Escherichia coli O157:H7
          str. EC4024]
          Length = 105

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 6/76 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRST--AHSLGRFTAILAFFFF 58
          L+V+ LIV + LV +I++Q    +    +FG+ ++ T   S+  A+ + R TAILA  FF
Sbjct: 5  LLVIFLIVAIALVALIMLQQGKGADMGASFGAGASGTLFGSSGSANFMTRTTAILATLFF 64

Query: 59 ATSIALGMISRYTSTR 74
            S+ LG I+   +++
Sbjct: 65 IISLVLGNINSNKTSK 80


>gi|90409006|ref|ZP_01217136.1| Biopolymer transport protein [Psychromonas sp. CNPT3]
 gi|90309891|gb|EAS38046.1| Biopolymer transport protein [Psychromonas sp. CNPT3]
          Length = 109

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 6/74 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS--SNFTSVRSTAHSLGRF----TAILA 54
          M   L+VV+LIV V L+  +LIQ    +  G+S  S  ++    A   G F    TA+LA
Sbjct: 1  MYEMLLVVYLIVAVILIGFVLIQQGKGAGMGASFGSGASNTVFGASGAGNFMTRTTAVLA 60

Query: 55 FFFFATSIALGMIS 68
            FF  S+ALG +S
Sbjct: 61 IVFFILSLALGNLS 74


>gi|53718846|ref|YP_107832.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          K96243]
 gi|53725826|ref|YP_103435.1| preprotein translocase subunit SecG [Burkholderia mallei ATCC
          23344]
 gi|67642193|ref|ZP_00440953.1| preprotein translocase, SecG subunit [Burkholderia mallei GB8
          horse 4]
 gi|76810602|ref|YP_332843.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          1710b]
 gi|121599984|ref|YP_992468.1| preprotein translocase subunit SecG [Burkholderia mallei SAVP1]
 gi|124384029|ref|YP_001026729.1| preprotein translocase subunit SecG [Burkholderia mallei NCTC
          10229]
 gi|126441687|ref|YP_001058337.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          668]
 gi|126448705|ref|YP_001079986.1| preprotein translocase subunit SecG [Burkholderia mallei NCTC
          10247]
 gi|126451944|ref|YP_001065576.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          1106a]
 gi|134283962|ref|ZP_01770658.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          305]
 gi|167000369|ref|ZP_02266187.1| preprotein translocase, SecG subunit [Burkholderia mallei PRL-20]
 gi|167823451|ref|ZP_02454922.1| preprotein translocase subunit SecG [Burkholderia pseudomallei 9]
 gi|167893544|ref|ZP_02480946.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          7894]
 gi|167910226|ref|ZP_02497317.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          112]
 gi|167918259|ref|ZP_02505350.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          BCC215]
 gi|217419953|ref|ZP_03451459.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          576]
 gi|226195388|ref|ZP_03790977.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          Pakistan 9]
 gi|237811581|ref|YP_002896032.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          MSHR346]
 gi|242314803|ref|ZP_04813819.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1106b]
 gi|254175392|ref|ZP_04882052.1| preprotein translocase, SecG subunit [Burkholderia mallei ATCC
          10399]
 gi|254181188|ref|ZP_04887785.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1655]
 gi|254190551|ref|ZP_04897058.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          Pasteur 52237]
 gi|254195092|ref|ZP_04901521.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          S13]
 gi|254202111|ref|ZP_04908474.1| preprotein translocase, SecG subunit [Burkholderia mallei FMH]
 gi|254207441|ref|ZP_04913791.1| preprotein translocase, SecG subunit [Burkholderia mallei JHU]
 gi|254260244|ref|ZP_04951298.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1710a]
 gi|254298532|ref|ZP_04965984.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          406e]
 gi|254359863|ref|ZP_04976133.1| preprotein translocase, SecG subunit [Burkholderia mallei
          2002721280]
 gi|52209260|emb|CAH35205.1| general secretory pathway, protein-export membrane protein
          [Burkholderia pseudomallei K96243]
 gi|52429249|gb|AAU49842.1| preprotein translocase, SecG subunit [Burkholderia mallei ATCC
          23344]
 gi|76580055|gb|ABA49530.1| Preprotein translocase SecG subunit, putative [Burkholderia
          pseudomallei 1710b]
 gi|121228794|gb|ABM51312.1| preprotein translocase, SecG subunit [Burkholderia mallei SAVP1]
 gi|124292049|gb|ABN01318.1| preprotein translocase, SecG subunit [Burkholderia mallei NCTC
          10229]
 gi|126221180|gb|ABN84686.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          668]
 gi|126225586|gb|ABN89126.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1106a]
 gi|126241575|gb|ABO04668.1| preprotein translocase, SecG subunit [Burkholderia mallei NCTC
          10247]
 gi|134244751|gb|EBA44849.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          305]
 gi|147746358|gb|EDK53435.1| preprotein translocase, SecG subunit [Burkholderia mallei FMH]
 gi|147751335|gb|EDK58402.1| preprotein translocase, SecG subunit [Burkholderia mallei JHU]
 gi|148029103|gb|EDK87008.1| preprotein translocase, SecG subunit [Burkholderia mallei
          2002721280]
 gi|157808196|gb|EDO85366.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          406e]
 gi|157938226|gb|EDO93896.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          Pasteur 52237]
 gi|160696436|gb|EDP86406.1| preprotein translocase, SecG subunit [Burkholderia mallei ATCC
          10399]
 gi|169651840|gb|EDS84533.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          S13]
 gi|184211726|gb|EDU08769.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1655]
 gi|217397257|gb|EEC37273.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          576]
 gi|225932590|gb|EEH28588.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          Pakistan 9]
 gi|237503238|gb|ACQ95556.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          MSHR346]
 gi|238523289|gb|EEP86728.1| preprotein translocase, SecG subunit [Burkholderia mallei GB8
          horse 4]
 gi|242138042|gb|EES24444.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1106b]
 gi|243063703|gb|EES45889.1| preprotein translocase, SecG subunit [Burkholderia mallei PRL-20]
 gi|254218933|gb|EET08317.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1710a]
          Length = 125

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 6/78 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV L+  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTS 72
            FF  ++AL  +  Y S
Sbjct: 64 TIFFVATLALTYLGSYKS 81


>gi|229505738|ref|ZP_04395248.1| preprotein translocase subunit SecG [Vibrio cholerae BX 330286]
 gi|229509229|ref|ZP_04398714.1| preprotein translocase subunit SecG [Vibrio cholerae B33]
 gi|229519562|ref|ZP_04409005.1| preprotein translocase subunit SecG [Vibrio cholerae RC9]
 gi|229520931|ref|ZP_04410353.1| preprotein translocase subunit SecG [Vibrio cholerae TM 11079-80]
 gi|229530445|ref|ZP_04419833.1| preprotein translocase subunit SecG [Vibrio cholerae 12129(1)]
 gi|229608849|ref|YP_002879497.1| preprotein translocase subunit SecG [Vibrio cholerae MJ-1236]
 gi|229332218|gb|EEN97706.1| preprotein translocase subunit SecG [Vibrio cholerae 12129(1)]
 gi|229342164|gb|EEO07160.1| preprotein translocase subunit SecG [Vibrio cholerae TM 11079-80]
 gi|229344251|gb|EEO09226.1| preprotein translocase subunit SecG [Vibrio cholerae RC9]
 gi|229353801|gb|EEO18737.1| preprotein translocase subunit SecG [Vibrio cholerae B33]
 gi|229357961|gb|EEO22878.1| preprotein translocase subunit SecG [Vibrio cholerae BX 330286]
 gi|229371504|gb|ACQ61927.1| preprotein translocase subunit SecG [Vibrio cholerae MJ-1236]
          Length = 114

 Score = 38.1 bits (87), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 7/92 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 8  LLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFATVFF 67

Query: 59 ATSIALGMISRY-TSTRYKDNMHRSLVDSIKD 89
            S+ LG +S + T +++ D     ++    D
Sbjct: 68 VISLVLGNMSTHKTESQWVDPSQGQVIQQAGD 99


>gi|213422395|ref|ZP_03355461.1| hypothetical protein Salmonentericaenterica_33530 [Salmonella
          enterica subsp. enterica serovar Typhi str. E01-6750]
          Length = 82

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 8  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLATLFF 67

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 68 IISLVLGNIN 77


>gi|262377015|ref|ZP_06070241.1| preprotein translocase, SecG subunit [Acinetobacter lwoffii
          SH145]
 gi|262308053|gb|EEY89190.1| preprotein translocase, SecG subunit [Acinetobacter lwoffii
          SH145]
          Length = 109

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 25/91 (27%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ-------------SSDSSAFGS--SSNFTSVRSTAHS 45
          MQ F++VVH+I+ V ++ +IL+Q                ++ FG+  S NF         
Sbjct: 1  MQTFVLVVHIILAVLMIVLILVQHGKGADAGASFGGGGAATVFGASGSGNF--------- 51

Query: 46 LGRFTAILAFFFFATSIALGMISR-YTSTRY 75
          + R TAI    FF TS+ L ++++  TS  Y
Sbjct: 52 MTRLTAIFTALFFVTSLTLAILAKQQTSNAY 82


>gi|229512902|ref|ZP_04402369.1| preprotein translocase subunit SecG [Vibrio cholerae TMA 21]
 gi|229350151|gb|EEO15104.1| preprotein translocase subunit SecG [Vibrio cholerae TMA 21]
          Length = 114

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 7/92 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 8  LLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFATVFF 67

Query: 59 ATSIALGMISRY-TSTRYKDNMHRSLVDSIKD 89
            S+ LG +S + T +++ D     ++    D
Sbjct: 68 VISLVLGNMSTHKTESQWVDPSQGQVIQQTGD 99


>gi|104780025|ref|YP_606523.1| preprotein translocase subunit SecG [Pseudomonas entomophila L48]
 gi|95109012|emb|CAK13708.1| putative preprotein translocase SecG Subunit [Pseudomonas
          entomophila L48]
          Length = 130

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 52/98 (53%), Gaps = 9/98 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS-----SN--FTSVRSTAHSLGRFTAIL 53
          ++  ++V HL+  + LV ++L+Q    +  G+S     SN  F S + +A  L + TAIL
Sbjct: 2  LETVVVVFHLLAALALVVMVLLQQGKGAEAGASFGAGASNTVFGS-QGSATFLSKVTAIL 60

Query: 54 AFFFFATSIALGMISRYTSTRY-KDNMHRSLVDSIKDQ 90
          A  FF T++ LG  ++  + +  +  +    V  +K+Q
Sbjct: 61 AATFFLTALGLGYFAKQQAHQLTQAGLPDPAVLEVKEQ 98


>gi|258625323|ref|ZP_05720223.1| translocase [Vibrio mimicus VM603]
 gi|262172284|ref|ZP_06039962.1| preprotein translocase subunit SecG [Vibrio mimicus MB-451]
 gi|258582389|gb|EEW07238.1| translocase [Vibrio mimicus VM603]
 gi|261893360|gb|EEY39346.1| preprotein translocase subunit SecG [Vibrio mimicus MB-451]
          Length = 111

 Score = 38.1 bits (87), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 7/92 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 5  LLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFATIFF 64

Query: 59 ATSIALGMISRY-TSTRYKDNMHRSLVDSIKD 89
            S+ LG +S + T +++ D     ++    D
Sbjct: 65 VISLVLGNMSTHKTESQWVDPSQGQVIQQADD 96


>gi|307942207|ref|ZP_07657558.1| preprotein translocase subunit SecG [Roseibium sp. TrichSKD4]
 gi|307774493|gb|EFO33703.1| preprotein translocase subunit SecG [Roseibium sp. TrichSKD4]
          Length = 124

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 13/107 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M+  ++V+HL++V+ LV V+L+Q S+  A G          S R TA+ L R TAILA  
Sbjct: 1   METVVIVIHLMIVLALVLVVLLQRSEGGALGIGGGGGGGMMSARGTANVLTRATAILAVA 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF---GDGSS 100
           FF TS++L +I++       ++   S++D+     +D+     DG S
Sbjct: 61  FFITSLSLSLIAK------NEDRPSSILDATSPAASDSAPTTADGES 101


>gi|83719049|ref|YP_441613.1| preprotein translocase subunit SecG [Burkholderia thailandensis
          E264]
 gi|167580421|ref|ZP_02373295.1| preprotein translocase subunit SecG [Burkholderia thailandensis
          TXDOH]
 gi|167618530|ref|ZP_02387161.1| preprotein translocase subunit SecG [Burkholderia thailandensis
          Bt4]
 gi|257139691|ref|ZP_05587953.1| preprotein translocase subunit SecG [Burkholderia thailandensis
          E264]
 gi|83652874|gb|ABC36937.1| Preprotein translocase SecG subunit, putative [Burkholderia
          thailandensis E264]
          Length = 125

 Score = 37.7 bits (86), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 6/78 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV L+  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTS 72
            FF  ++AL  +  Y S
Sbjct: 64 TIFFVATLALTYLGSYKS 81


>gi|262163946|ref|ZP_06031685.1| preprotein translocase subunit SecG [Vibrio mimicus VM223]
 gi|262027474|gb|EEY46140.1| preprotein translocase subunit SecG [Vibrio mimicus VM223]
          Length = 114

 Score = 37.7 bits (86), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 7/92 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 8  LLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFATIFF 67

Query: 59 ATSIALGMISRY-TSTRYKDNMHRSLVDSIKD 89
            S+ LG +S + T +++ D     ++    D
Sbjct: 68 VISLVLGNMSTHKTESQWVDPSQGQVIQQADD 99


>gi|229525293|ref|ZP_04414698.1| preprotein translocase subunit SecG [Vibrio cholerae bv. albensis
          VL426]
 gi|229338874|gb|EEO03891.1| preprotein translocase subunit SecG [Vibrio cholerae bv. albensis
          VL426]
          Length = 114

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 7/92 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 8  LLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFATVFF 67

Query: 59 ATSIALGMISRY-TSTRYKDNMHRSLVDSIKD 89
            S+ LG +S + T +++ D     ++    D
Sbjct: 68 VISLVLGNMSTHKTESQWVDPSQGQVIQQAGD 99


>gi|237730092|ref|ZP_04560573.1| preprotein translocase IISP family [Citrobacter sp. 30_2]
 gi|226908698|gb|EEH94616.1| preprotein translocase IISP family [Citrobacter sp. 30_2]
          Length = 155

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 6/71 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
           M   L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+L 
Sbjct: 46  MHEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAVLG 105

Query: 55  FFFFATSIALG 65
             FF  S+ LG
Sbjct: 106 TLFFIISLVLG 116


>gi|94497169|ref|ZP_01303741.1| preprotein translocase, SecG subunit [Sphingomonas sp. SKA58]
 gi|94423274|gb|EAT08303.1| preprotein translocase, SecG subunit [Sphingomonas sp. SKA58]
          Length = 122

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
          FL+VV  I+   LV VIL+Q S+       GS + F S R  A  L R T ILA  F   
Sbjct: 4  FLLVVQAIIAALLVTVILMQKSEGGGLGVGGSPAGFMSARGAADFLTRSTTILASVFVLL 63

Query: 61 SIALGMIS 68
          SI + +I+
Sbjct: 64 SIVMAVIA 71


>gi|283836282|ref|ZP_06356023.1| homoserine dehydrogenase [Citrobacter youngae ATCC 29220]
 gi|291067645|gb|EFE05754.1| homoserine dehydrogenase [Citrobacter youngae ATCC 29220]
          Length = 110

 Score = 37.7 bits (86), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 6/71 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M   L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+L 
Sbjct: 1  MHEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAVLG 60

Query: 55 FFFFATSIALG 65
            FF  S+ LG
Sbjct: 61 TLFFIISLVLG 71


>gi|299136769|ref|ZP_07029952.1| preprotein translocase, SecG subunit [Acidobacterium sp. MP5ACTX8]
 gi|298601284|gb|EFI57439.1| preprotein translocase, SecG subunit [Acidobacterium sp. MP5ACTX8]
          Length = 124

 Score = 37.7 bits (86), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 42/76 (55%), Gaps = 7/76 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
           M I L+++H++V + L+ V+L+Q   S+    AFG   + T+   R  A+ L R T   A
Sbjct: 28  MIILLVILHVVVCLFLIGVVLVQQGKSADLAGAFGGQGSQTAFGPRGAANLLTRLTTWSA 87

Query: 55  FFFFATSIALG-MISR 69
             F  TSI L  M+SR
Sbjct: 88  IIFMLTSIGLTVMMSR 103


>gi|271499171|ref|YP_003332196.1| preprotein translocase subunit SecG [Dickeya dadantii Ech586]
 gi|270342726|gb|ACZ75491.1| preprotein translocase, SecG subunit [Dickeya dadantii Ech586]
          Length = 111

 Score = 37.7 bits (86), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+++ L+V +GLV +I++Q        ++FG+ ++ T   S+     + R TA+ A  FF
Sbjct: 5  LLIIFLLVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALFATLFF 64

Query: 59 ATSIALGMISRYTSTRYK--DNMHRSLVDSIKDQ 90
            S+ LG +S   S +    DN+ +       DQ
Sbjct: 65 VLSLILGNMSSDHSKKSSGWDNLSQPAAAEKADQ 98


>gi|123440810|ref|YP_001004801.1| preprotein translocase subunit SecG [Yersinia enterocolitica
          subsp. enterocolitica 8081]
 gi|238761765|ref|ZP_04622739.1| Protein-export membrane protein secG [Yersinia kristensenii ATCC
          33638]
 gi|332160076|ref|YP_004296653.1| preprotein translocase subunit SecG [Yersinia enterocolitica
          subsp. palearctica 105.5R(r)]
 gi|122087771|emb|CAL10557.1| protein-export membrane protein [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|238699879|gb|EEP92622.1| Protein-export membrane protein secG [Yersinia kristensenii ATCC
          33638]
 gi|318607364|emb|CBY28862.1| preprotein translocase subunit SecG [Yersinia enterocolitica
          subsp. palearctica Y11]
 gi|325664306|gb|ADZ40950.1| preprotein translocase subunit SecG [Yersinia enterocolitica
          subsp. palearctica 105.5R(r)]
 gi|330862033|emb|CBX72199.1| protein-export membrane protein secG [Yersinia enterocolitica
          W22703]
          Length = 111

 Score = 37.7 bits (86), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          L+V+ L++ +GLV +I++Q    +        G+S+       + + + R TA+LA  FF
Sbjct: 5  LLVIFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLAALFF 64

Query: 59 ATSIALGMIS 68
            S+ LG +S
Sbjct: 65 VISLILGNMS 74


>gi|78778260|ref|YP_394575.1| preprotein translocase subunit SecG [Sulfurimonas denitrificans
          DSM 1251]
 gi|78498800|gb|ABB45340.1| protein translocase subunit secG [Sulfurimonas denitrificans DSM
          1251]
          Length = 133

 Score = 37.7 bits (86), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
          FL++V +++VV LV  +L+Q S S       GS+ +    +  A  L + T  + F F  
Sbjct: 5  FLLIVQIVLVVMLVIAVLLQKSSSIGLGAYSGSNESVFGAKGPASFLAKTTFAIGFLFVI 64

Query: 60 TSIALG-MISRYTSTRYKDNMHRS 82
           +IALG M S   +    DN+  S
Sbjct: 65 NTIALGYMYSSAATDSIVDNITPS 88


>gi|238787591|ref|ZP_04631389.1| Protein-export membrane protein secG [Yersinia frederiksenii ATCC
          33641]
 gi|238724378|gb|EEQ16020.1| Protein-export membrane protein secG [Yersinia frederiksenii ATCC
          33641]
          Length = 111

 Score = 37.7 bits (86), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          L+V+ L++ +GLV +I++Q    +        G+S+       + + + R TA+LA  FF
Sbjct: 5  LLVIFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG +S
Sbjct: 65 VISLILGNMS 74


>gi|149202639|ref|ZP_01879611.1| preprotein translocase, SecG subunit [Roseovarius sp. TM1035]
 gi|149143921|gb|EDM31955.1| preprotein translocase, SecG subunit [Roseovarius sp. TM1035]
          Length = 120

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 53/111 (47%), Gaps = 11/111 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAH---SLGRFTAILAFFF 57
           M+  ++ VHL++ + L+ V+L+Q S+    G         +      +LG+ T ILA  F
Sbjct: 1   MENVVLTVHLLLALALIGVVLLQRSEGGGLGMGGGGGGAMTGRAAATALGKMTWILAAAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             TSI L +I+       ++    S++D + DQ      + ++P L  V A
Sbjct: 61  IVTSITLTIIAA------QNAAGVSVLDRLTDQ--PPAAETTTPALPDVDA 103


>gi|242310136|ref|ZP_04809291.1| preprotein translocase subunit SecG [Helicobacter pullorum MIT
          98-5489]
 gi|239523433|gb|EEQ63299.1| preprotein translocase subunit SecG [Helicobacter pullorum MIT
          98-5489]
          Length = 114

 Score = 37.7 bits (86), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 11/88 (12%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAFG----SSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
          L+VV  ++ + +  V+L+Q S S   G    S+ +    +  A  L + T +L F F   
Sbjct: 5  LLVVQFVLAIIITIVVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKTTFVLGFLFVVN 64

Query: 61 SIALGMISRYTSTRYKDNMHRSLVDSIK 88
          +IALG         Y  +  +S+VD+++
Sbjct: 65 TIALGYF-------YTKDSQKSIVDNVE 85


>gi|83754004|pdb|2AKH|X Chain X, Normal Mode-Based Flexible Fitted Coordinates Of A Non-
          Translocating Secyeg Protein-Conducting Channel Into
          The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome
          Complex From E. Coli
 gi|83754007|pdb|2AKH|A Chain A, Normal Mode-Based Flexible Fitted Coordinates Of A Non-
          Translocating Secyeg Protein-Conducting Channel Into
          The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome
          Complex From E. Coli
 gi|83754010|pdb|2AKI|X Chain X, Normal Mode-Based Flexible Fitted Coordinates Of A
          Translocating Secyeg Protein-Conducting Channel Into
          The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome
          Complex From E. Coli
 gi|83754013|pdb|2AKI|A Chain A, Normal Mode-Based Flexible Fitted Coordinates Of A
          Translocating Secyeg Protein-Conducting Channel Into
          The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome
          Complex From E. Coli
          Length = 77

 Score = 37.7 bits (86), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 5  LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG I+
Sbjct: 65 IISLVLGNIN 74


>gi|157165673|ref|YP_001467728.1| AraC family transcriptional regulator [Campylobacter concisus
           13826]
 gi|112800315|gb|EAT97659.1| protein-export membrane protein [Campylobacter concisus 13826]
          Length = 109

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 50/112 (44%), Gaps = 17/112 (15%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG----SSSNFTSVRSTAHSLGRFTAILAFF 56
           M +  +++  ++ V +   +L+Q S S   G    S+ +    +  A  L +FT ++   
Sbjct: 1   MSLIFLILQFVLAVVITIAVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFVVGVL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIK------DQGNDNFGDGSSPK 102
           F   ++ALG         Y  ++ RS+VDS+        + ND     S+P+
Sbjct: 61  FILNTLALGYF-------YNKDLKRSIVDSVDSKSLVIPKSNDVPAAPSAPQ 105


>gi|167585970|ref|ZP_02378358.1| hypothetical protein BuboB_11570 [Burkholderia ubonensis Bu]
          Length = 116

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (55%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV ++  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQVLAALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRATAVLA 63

Query: 55 FFFFATSIALGMISRYTST 73
            FF  ++AL  +  Y ST
Sbjct: 64 TIFFVATLALTYLGSYKST 82


>gi|167836048|ref|ZP_02462931.1| preprotein translocase subunit SecG [Burkholderia thailandensis
          MSMB43]
          Length = 125

 Score = 37.4 bits (85), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 6/78 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV L+  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTS 72
            FF  ++AL  +  Y S
Sbjct: 64 TIFFIATLALTYLGSYKS 81


>gi|269137760|ref|YP_003294460.1| preprotein translocase subunit SecG [Edwardsiella tarda EIB202]
 gi|267983420|gb|ACY83249.1| preprotein translocase subunit SecG [Edwardsiella tarda EIB202]
 gi|304557817|gb|ADM40481.1| Preprotein translocase subunit SecG [Edwardsiella tarda FL6-60]
          Length = 111

 Score = 37.4 bits (85), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 8/87 (9%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRS--TAHSLGRFTAILAFFFF 58
          L+V+ L+V V L+ +I++Q    +    +FG+ ++ T   S  T + + R T ILA  FF
Sbjct: 5  LLVIFLLVSVALIALIMLQQGKGADMGASFGAGASATLFGSSGTGNFMTRTTGILATLFF 64

Query: 59 ATSIALGMISRYTSTR--YKDNMHRSL 83
            S+ LG +S + S +    DN+ + +
Sbjct: 65 VLSLVLGNLSGHQSKQGSEWDNLGQPV 91


>gi|254482491|ref|ZP_05095730.1| preprotein translocase SecG subunit, putative [marine gamma
          proteobacterium HTCC2148]
 gi|214037182|gb|EEB77850.1| preprotein translocase SecG subunit, putative [marine gamma
          proteobacterium HTCC2148]
          Length = 129

 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRS--TAHSLGRFTAILA 54
          M+  +++VHL+V + ++ +I++Q        ++FG+ ++ T   S  + + L R T    
Sbjct: 1  MEQIILIVHLLVALAIIGLIMLQQGKGADMGASFGAGASQTLFGSDGSGNVLTRATGWFV 60

Query: 55 FFFFATSIALGMISRYTSTRYKD 77
            FFATS  L +I+  +S    D
Sbjct: 61 TLFFATSFGLALIASQSSQPVND 83


>gi|148292186|dbj|BAF62901.1| putative protein-export protein [uncultured bacterium]
          Length = 110

 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 47/98 (47%), Gaps = 6/98 (6%)

Query: 5   LMVVHLIVVVGLVCVILIQS---SDSSAF--GSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
           L+ +HL V V ++ ++L+Q    SD+ A   GSS +    R +A  L R TA LA  FF 
Sbjct: 6   LLGLHLAVTVAVIILVLLQQGRGSDAGAVFGGSSQSVFGSRGSASFLSRLTAALATLFFV 65

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGD 97
            S+ L  +             R+ V+++ D+  +   D
Sbjct: 66  NSLVLAWLYNRDQADLSVTAPRA-VEAVTDEAAEPQSD 102


>gi|253998382|ref|YP_003050445.1| preprotein translocase subunit SecG [Methylovorus sp. SIP3-4]
 gi|253985061|gb|ACT49918.1| preprotein translocase, SecG subunit [Methylovorus sp. SIP3-4]
          Length = 116

 Score = 37.4 bits (85), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 43/76 (56%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          M+  + +VH++  +G++ ++L+Q    +    AFGS  S +   V  +++ + R TA+  
Sbjct: 1  METLVSIVHVLAALGVIGLVLLQHGKGADMGAAFGSGASGSLFGVSGSSNFMSRATAVFV 60

Query: 55 FFFFATSIALGMISRY 70
            FFATS+ L  +S +
Sbjct: 61 AIFFATSLTLAYMSSH 76


>gi|304414226|ref|ZP_07395594.1| Preprotein translocase subunit SecG [Candidatus Regiella
           insecticola LSR1]
 gi|304283440|gb|EFL91836.1| Preprotein translocase subunit SecG [Candidatus Regiella
           insecticola LSR1]
          Length = 138

 Score = 37.4 bits (85), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M + L+V  L++ +GL+ +I++Q    +  G+S      S       + + + R TAILA
Sbjct: 31  MYVTLLVFFLLISIGLIALIVLQQGKGADMGASFGAGASSTLFGSSGSGNFMTRMTAILA 90

Query: 55  FFFFATSIALGMIS--RYTSTRYKDNMHRSLVDS 86
             FF  S+ LG +S  ++  +   +N+ +   D 
Sbjct: 91  TLFFIVSLVLGNMSSKQHRQSSEWENLSQPAKDE 124


>gi|313200457|ref|YP_004039115.1| preprotein translocase subunit SecG [Methylovorus sp. MP688]
 gi|312439773|gb|ADQ83879.1| preprotein translocase, SecG subunit [Methylovorus sp. MP688]
          Length = 116

 Score = 37.4 bits (85), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 43/76 (56%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          M+  + +VH++  +G++ ++L+Q    +    AFGS  S +   V  +++ + R TA+  
Sbjct: 1  METLVSIVHVLAALGVIGLVLLQHGKGADMGAAFGSGASGSLFGVSGSSNFMSRATAVFV 60

Query: 55 FFFFATSIALGMISRY 70
            FFATS+ L  +S +
Sbjct: 61 GIFFATSLTLAYMSSH 76


>gi|212710005|ref|ZP_03318133.1| hypothetical protein PROVALCAL_01056 [Providencia alcalifaciens
          DSM 30120]
 gi|212687414|gb|EEB46942.1| hypothetical protein PROVALCAL_01056 [Providencia alcalifaciens
          DSM 30120]
          Length = 114

 Score = 37.4 bits (85), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 9/81 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M I L+VV L+  +GL+ ++++Q        ++FG+ ++ T   S+     + R T ILA
Sbjct: 1  MYIALLVVFLLAAIGLIGLVMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTGILA 60

Query: 55 FFFFATSIALGMISRYTSTRY 75
            FF  S+ LG     T+ +Y
Sbjct: 61 AVFFVISLILG---NMTANKY 78


>gi|254464934|ref|ZP_05078345.1| preprotein translocase, SecG subunit [Rhodobacterales bacterium
          Y4I]
 gi|206685842|gb|EDZ46324.1| preprotein translocase, SecG subunit [Rhodobacterales bacterium
          Y4I]
          Length = 121

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAH---SLGRFTAILAFFF 57
          M+  ++++HL++ +GL+ V+L+Q S+    G         S      +LG+ T +LA  F
Sbjct: 1  MENVVLIIHLLLALGLIAVVLLQRSEGGGLGMGGGGGGAISGRAAATALGKVTWLLAIAF 60

Query: 58 FATSIALGMISRYTS 72
            TSI L +++   S
Sbjct: 61 ICTSITLTIMAAQKS 75


>gi|90580526|ref|ZP_01236331.1| putative protein export-membrane protein [Vibrio angustum S14]
 gi|90438184|gb|EAS63370.1| putative protein export-membrane protein [Photobacterium angustum
          S14]
          Length = 113

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M   L+V++L+  +G++ ++L+Q    +    +FG+ ++ T   S+     L R T +LA
Sbjct: 1  MYEILLVIYLVAALGVIGLVLVQQGKGADMGASFGAGASGTLFGSSGSGNFLTRMTTVLA 60

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF  S+ LG +S   +T 
Sbjct: 61 AIFFVISLVLGNMSAKQATE 80


>gi|307129382|ref|YP_003881398.1| preprotein translocase membrane subunit [Dickeya dadantii 3937]
 gi|306526911|gb|ADM96841.1| preprotein translocase membrane subunit [Dickeya dadantii 3937]
          Length = 111

 Score = 37.0 bits (84), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+V+ LIV +GLV +I++Q        ++FG+ ++ T   S+     + R TA+ A  FF
Sbjct: 5  LLVIFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALFATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG +S
Sbjct: 65 VLSLILGNMS 74


>gi|110679196|ref|YP_682203.1| preprotein translocase subunit SecG [Roseobacter denitrificans
          OCh 114]
 gi|109455312|gb|ABG31517.1| preprotein translocase, SecG subunit, putative [Roseobacter
          denitrificans OCh 114]
          Length = 121

 Score = 37.0 bits (84), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAH---SLGRFTAILAFFF 57
          M+  ++++HLI+ +GL+ V+L+Q S+    G         +      +LG+ T +LA  F
Sbjct: 1  MENVVLIIHLILALGLIAVVLLQRSEGGGLGMGGGGGGAMTGRAAATALGKVTWLLAIAF 60

Query: 58 FATSIAL 64
            TSI L
Sbjct: 61 ICTSITL 67


>gi|84502702|ref|ZP_01000821.1| Preprotein translocase SecG subunit [Oceanicola batsensis
          HTCC2597]
 gi|84389097|gb|EAQ01895.1| Preprotein translocase SecG subunit [Oceanicola batsensis
          HTCC2597]
          Length = 122

 Score = 37.0 bits (84), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAH---SLGRFTAILAFFF 57
          M+  ++++HL + + L+ V+L+Q S+    G         S      +LG+ T ILA  F
Sbjct: 1  MENVVLIIHLFLALALIGVVLLQKSEGGGLGMGGGGGGAMSGRAAATALGKVTWILAAAF 60

Query: 58 FATSIALGMISRYTST 73
            TSIAL +I+   ST
Sbjct: 61 IGTSIALTIIAADKST 76


>gi|89072572|ref|ZP_01159144.1| putative protein export-membrane protein [Photobacterium sp.
          SKA34]
 gi|89051676|gb|EAR57129.1| putative protein export-membrane protein [Photobacterium sp.
          SKA34]
          Length = 113

 Score = 37.0 bits (84), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M   L+V++L+  +G++ ++L+Q    +    +FG+ ++ T   S+     L R T +LA
Sbjct: 1  MYEILLVIYLVAALGVIGLVLVQQGKGADMGASFGAGASGTLFGSSGSGNFLTRMTTVLA 60

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF  S+ LG +S   +T 
Sbjct: 61 AIFFVISLVLGNMSAKQATE 80


>gi|254511065|ref|ZP_05123132.1| preprotein translocase, SecG subunit [Rhodobacteraceae bacterium
          KLH11]
 gi|221534776|gb|EEE37764.1| preprotein translocase, SecG subunit [Rhodobacteraceae bacterium
          KLH11]
          Length = 122

 Score = 37.0 bits (84), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 3/76 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAH---SLGRFTAILAFFF 57
          M+  ++++HL++ +GL+ V+L+Q S+    G         +      +LG+ T ILA  F
Sbjct: 1  MENVVLIIHLLLALGLIAVVLMQRSEGGGLGMGGGGGGAMTGRAAATALGKLTWILAACF 60

Query: 58 FATSIALGMISRYTST 73
            TS+ L +++   S+
Sbjct: 61 IVTSMTLTILAAQKSS 76


>gi|260556302|ref|ZP_05828521.1| preprotein translocase, SecG subunit [Acinetobacter baumannii
          ATCC 19606]
 gi|260410357|gb|EEX03656.1| preprotein translocase, SecG subunit [Acinetobacter baumannii
          ATCC 19606]
          Length = 109

 Score = 37.0 bits (84), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 24/89 (26%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-------------SSAFGS--SSNFTSVRSTAHS 45
          M  F++VVH+I+ V ++ +IL+Q                ++ FG+  S NF         
Sbjct: 1  MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNF--------- 51

Query: 46 LGRFTAILAFFFFATSIALGMISRYTSTR 74
          L R TAIL   FF TS+ L + ++  +T 
Sbjct: 52 LTRVTAILTALFFVTSLTLAIFAKKQTTE 80


>gi|83310919|ref|YP_421183.1| preprotein translocase subunit SecG [Magnetospirillum magneticum
          AMB-1]
 gi|82945760|dbj|BAE50624.1| Preprotein translocase subunit SecG [Magnetospirillum magneticum
          AMB-1]
          Length = 112

 Score = 37.0 bits (84), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 43/74 (58%), Gaps = 6/74 (8%)

Query: 1  MQIF--LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILA 54
          M +F  ++V+HLI+ V LV VIL+Q S+        GS     + R+  + L R TAI+A
Sbjct: 1  MDVFPIILVIHLILAVALVGVILLQRSEGGALGIGGGSGGGLMTGRAAGNLLTRTTAIVA 60

Query: 55 FFFFATSIALGMIS 68
            FF TS+ L +++
Sbjct: 61 GSFFLTSLVLALLA 74


>gi|260550519|ref|ZP_05824729.1| preprotein translocase subunit SecG [Acinetobacter sp. RUH2624]
 gi|260406434|gb|EEW99916.1| preprotein translocase subunit SecG [Acinetobacter sp. RUH2624]
          Length = 109

 Score = 37.0 bits (84), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 24/89 (26%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-------------SSAFGS--SSNFTSVRSTAHS 45
          M  F++VVH+I+ V ++ +IL+Q                ++ FG+  S NF         
Sbjct: 1  MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNF--------- 51

Query: 46 LGRFTAILAFFFFATSIALGMISRYTSTR 74
          L R TA+L   FF TS+ L + ++  +T 
Sbjct: 52 LTRLTAVLTALFFVTSLTLAVFAKKQTTE 80


>gi|167737851|ref|ZP_02410625.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          14]
          Length = 100

 Score = 37.0 bits (84), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 6/78 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV L+  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTS 72
            FF  ++AL  +  Y S
Sbjct: 64 TIFFVATLALTYLGSYKS 81


>gi|323525435|ref|YP_004227588.1| preprotein translocase subunit SecG [Burkholderia sp. CCGE1001]
 gi|323382437|gb|ADX54528.1| preprotein translocase, SecG subunit [Burkholderia sp. CCGE1001]
          Length = 131

 Score = 37.0 bits (84), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRY 70
            FF T++AL  +  Y
Sbjct: 64 AVFFVTTLALTYLGAY 79


>gi|162286751|ref|YP_001083397.2| preprotein translocase subunit SecG [Acinetobacter baumannii ATCC
          17978]
 gi|169634556|ref|YP_001708292.1| preprotein translocase subunit SecG [Acinetobacter baumannii SDF]
 gi|169797410|ref|YP_001715203.1| preprotein translocase subunit SecG [Acinetobacter baumannii AYE]
 gi|213155776|ref|YP_002317821.1| preprotein translocase iisp family auxillary membrane component
          [Acinetobacter baumannii AB0057]
 gi|215484849|ref|YP_002327086.1| preprotein translocase, SecG subunit [Acinetobacter baumannii
          AB307-0294]
 gi|239500934|ref|ZP_04660244.1| preprotein translocase subunit SecG [Acinetobacter baumannii
          AB900]
 gi|294837296|ref|ZP_06781979.1| preprotein translocase subunit SecG [Acinetobacter sp. 6013113]
 gi|294859186|ref|ZP_06796955.1| preprotein translocase subunit SecG [Acinetobacter sp. 6013150]
 gi|301345149|ref|ZP_07225890.1| preprotein translocase subunit SecG [Acinetobacter baumannii
          AB056]
 gi|301510690|ref|ZP_07235927.1| preprotein translocase subunit SecG [Acinetobacter baumannii
          AB058]
 gi|301594950|ref|ZP_07239958.1| preprotein translocase subunit SecG [Acinetobacter baumannii
          AB059]
 gi|169150337|emb|CAM88234.1| preprotein translocase IISP family, auxillary membrane component
          [Acinetobacter baumannii AYE]
 gi|169153348|emb|CAP02461.1| preprotein translocase IISP family, auxillary membrane component
          [Acinetobacter baumannii]
 gi|193076180|gb|ABO10795.2| preprotein translocase IISP family auxillary membrane component
          [Acinetobacter baumannii ATCC 17978]
 gi|213054936|gb|ACJ39838.1| preprotein translocase iisp family auxillary membrane component
          [Acinetobacter baumannii AB0057]
 gi|213987662|gb|ACJ57961.1| preprotein translocase, SecG subunit [Acinetobacter baumannii
          AB307-0294]
          Length = 109

 Score = 37.0 bits (84), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 24/89 (26%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-------------SSAFGS--SSNFTSVRSTAHS 45
          M  F++VVH+I+ V ++ +IL+Q                ++ FG+  S NF         
Sbjct: 1  MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNF--------- 51

Query: 46 LGRFTAILAFFFFATSIALGMISRYTSTR 74
          L R TAIL   FF TS+ L + ++  +T 
Sbjct: 52 LTRVTAILTALFFVTSLTLAVFAKKQTTE 80


>gi|307730341|ref|YP_003907565.1| preprotein translocase, SecG subunit [Burkholderia sp. CCGE1003]
 gi|307584876|gb|ADN58274.1| preprotein translocase, SecG subunit [Burkholderia sp. CCGE1003]
          Length = 128

 Score = 37.0 bits (84), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRY 70
            FF T++AL  +  Y
Sbjct: 64 AVFFVTTLALTYLGAY 79


>gi|154174058|ref|YP_001409187.1| protein-export membrane protein [Campylobacter curvus 525.92]
 gi|153793041|gb|EAU00799.2| protein-export membrane protein [Campylobacter curvus 525.92]
          Length = 112

 Score = 37.0 bits (84), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 57/124 (45%), Gaps = 16/124 (12%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
           IFL++  ++ VV  + V+L +SS     +  GS+ +    +  A  L +FT ++   F  
Sbjct: 2   IFLILQFVLAVVITISVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFVVGILFIL 61

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
            ++ LG +       Y  +M RSL+DS+            +PK    S  S  SV +  +
Sbjct: 62  NTLTLGYL-------YNKDMKRSLIDSVDTN------SLVAPKPAEPSEPSVPSVPSAPQ 108

Query: 120 SSSR 123
           + ++
Sbjct: 109 TPAK 112


>gi|315127236|ref|YP_004069239.1| preprotein translocase subunit SecG [Pseudoalteromonas sp.
          SM9913]
 gi|315015750|gb|ADT69088.1| preprotein translocase subunit SecG [Pseudoalteromonas sp.
          SM9913]
          Length = 117

 Score = 37.0 bits (84), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 47/90 (52%), Gaps = 8/90 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M   L+VV+LIV + LV ++LIQ        S+FG+ ++ T   S+     + + T +LA
Sbjct: 1  MYEILLVVYLIVALALVGMVLIQQGKGADMGSSFGAGASSTVFGSSGAGNFMTKTTTVLA 60

Query: 55 FFFFATSIALGMIS--RYTSTRYKDNMHRS 82
            FF  SI LG ++  +   T   +N+  +
Sbjct: 61 TIFFVLSIVLGNLTAGQIKKTDEWENLEAA 90


>gi|167569421|ref|ZP_02362295.1| preprotein translocase subunit SecG [Burkholderia oklahomensis
          C6786]
          Length = 124

 Score = 37.0 bits (84), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 6/77 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILAF 55
          ++ ++VV L+  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA 
Sbjct: 5  KVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLAT 64

Query: 56 FFFATSIALGMISRYTS 72
           FF  ++AL  +  Y S
Sbjct: 65 IFFVATLALTYLGSYKS 81


>gi|167562176|ref|ZP_02355092.1| preprotein translocase subunit SecG [Burkholderia oklahomensis
          EO147]
          Length = 124

 Score = 37.0 bits (84), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 6/77 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILAF 55
          ++ ++VV L+  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA 
Sbjct: 5  KVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLAT 64

Query: 56 FFFATSIALGMISRYTS 72
           FF  ++AL  +  Y S
Sbjct: 65 IFFVATLALTYLGSYKS 81


>gi|83593223|ref|YP_426975.1| protein translocase subunit secG [Rhodospirillum rubrum ATCC 11170]
 gi|83576137|gb|ABC22688.1| protein translocase subunit secG [Rhodospirillum rubrum ATCC 11170]
          Length = 146

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 56/120 (46%), Gaps = 26/120 (21%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD--SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
           M   ++V+HL++ + +V +IL+Q S+  +   G    F + R   + L R T ILA  F 
Sbjct: 1   MITVILVIHLLIAIAMVTLILLQRSEGGALGIGGGGGFMTGRQAGNVLTRTTGILAAAFM 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
            TS+ L +++                    ++G D F    S  LDS+   S +S++ G+
Sbjct: 61  TTSMLLALLA--------------------NKGEDGF----SHILDSIDLPSINSLIGGE 96


>gi|299771785|ref|YP_003733811.1| preprotein translocase subunit SecG [Acinetobacter sp. DR1]
 gi|298701873|gb|ADI92438.1| preprotein translocase subunit SecG [Acinetobacter sp. DR1]
          Length = 109

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 20/87 (22%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDS-------------SAFGSSSNFTSVRSTAHSLG 47
          M  F+++VH+I+ V ++ +IL+Q                 + FG+S +       A+ L 
Sbjct: 1  MHSFVLIVHIILAVLMIGLILVQHGKGADAGASFGGGGAATVFGASGS-------ANFLT 53

Query: 48 RFTAILAFFFFATSIALGMISRYTSTR 74
          R TAIL   FF TS+ L + ++  +T 
Sbjct: 54 RLTAILTALFFVTSLTLAVFAKKQTTE 80


>gi|257453565|ref|ZP_05618855.1| preprotein translocase subunit SecG [Enhydrobacter aerosaccus
          SK60]
 gi|257449023|gb|EEV23976.1| preprotein translocase subunit SecG [Enhydrobacter aerosaccus
          SK60]
          Length = 106

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 44/74 (59%), Gaps = 6/74 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQ---SSDSSA-FGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          ++VVH+IV + ++ +IL+Q    +D+ A FG+  + T      +A+ L R TA+L   FF
Sbjct: 5  ILVVHIIVAISMIGLILVQHGKGADAGASFGAGGSATVFGASGSANFLTRLTAVLTAIFF 64

Query: 59 ATSIALGMISRYTS 72
           TS+ L + ++  S
Sbjct: 65 ITSMTLAVFAKQQS 78


>gi|184156667|ref|YP_001845006.1| preprotein translocase subunit SecG [Acinetobacter baumannii
          ACICU]
 gi|294842031|ref|ZP_06786714.1| preprotein translocase subunit SecG [Acinetobacter sp. 6014059]
 gi|183208261|gb|ACC55659.1| Preprotein translocase subunit SecG [Acinetobacter baumannii
          ACICU]
 gi|323516433|gb|ADX90814.1| preprotein translocase subunit SecG [Acinetobacter baumannii
          TCDC-AB0715]
          Length = 109

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 24/89 (26%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-------------SSAFGS--SSNFTSVRSTAHS 45
          M  F++VVH+I+ V ++ +IL+Q                ++ FG+  S NF         
Sbjct: 1  MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNF--------- 51

Query: 46 LGRFTAILAFFFFATSIALGMISRYTSTR 74
          L R TAIL   FF TS+ L + ++  +T 
Sbjct: 52 LTRVTAILTALFFVTSLTLAVFAKKQTTE 80


>gi|88608627|ref|YP_506743.1| preprotein translocase, SecG subunit [Neorickettsia sennetsu str.
          Miyayama]
 gi|88600796|gb|ABD46264.1| preprotein translocase, SecG subunit [Neorickettsia sennetsu str.
          Miyayama]
          Length = 107

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 43/84 (51%), Gaps = 10/84 (11%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS-------VRSTAHSLGRFTAILA 54
           +FL+V+  IV V +V ++L QSS S   G+   FTS        RS +    RFT +L 
Sbjct: 1  MLFLIVLQFIVAVLIVTLVLCQSSGSDVAGT---FTSGRRGLFPARSVSGLFVRFTWVLL 57

Query: 55 FFFFATSIALGMISRYTSTRYKDN 78
            FF  +I LG ++  ++T    N
Sbjct: 58 LVFFLNTILLGRLNFTSNTEVITN 81


>gi|332185339|ref|ZP_08387088.1| preprotein translocase, SecG subunit [Sphingomonas sp. S17]
 gi|332015063|gb|EGI57119.1| preprotein translocase, SecG subunit [Sphingomonas sp. S17]
          Length = 121

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 4  FLMVVHLIVVVGLVCVILIQ---SSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
          FL+V+H I+   LV VIL+Q          GS S   S R  A  L R TA+LA  F   
Sbjct: 4  FLLVIHAIIAATLVTVILMQRSEGGGLGMGGSPSGLMSARGAADFLSRATAVLATAFVGF 63

Query: 61 SIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
          SI L +++   +TR    +  SL  +   Q  
Sbjct: 64 SILLAVLA---ATRSAPTIDTSLARTPATQAP 92


>gi|126725628|ref|ZP_01741470.1| preprotein translocase, SecG subunit [Rhodobacterales bacterium
          HTCC2150]
 gi|126704832|gb|EBA03923.1| preprotein translocase, SecG subunit [Rhodobacterales bacterium
          HTCC2150]
          Length = 120

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 40/73 (54%), Gaps = 5/73 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV-----RSTAHSLGRFTAILAF 55
          M+  ++++HL++ + L+ ++L+Q S+    G             RS   ++G+ T ILA 
Sbjct: 1  MENVVLIIHLLLALSLIGIVLLQRSEGGGLGLGGGGGGGAAKTGRSAGTAMGKLTWILAA 60

Query: 56 FFFATSIALGMIS 68
           F  TSI+L +I+
Sbjct: 61 AFIVTSISLTVIA 73


>gi|330447380|ref|ZP_08311029.1| preprotein translocase, SecG subunit [Photobacterium leiognathi
          subsp. mandapamensis svers.1.1.]
 gi|328491571|dbj|GAA05526.1| preprotein translocase, SecG subunit [Photobacterium leiognathi
          subsp. mandapamensis svers.1.1.]
          Length = 113

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M   L+V++L+  +G++ ++L+Q    +    +FG+ ++ T   S+     L R T +LA
Sbjct: 1  MYEILLVIYLVAALGVIGLVLVQQGKGADMGASFGAGASGTLFGSSGSGNFLTRMTTLLA 60

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF  S+ LG +S   +T 
Sbjct: 61 AIFFVISLVLGNMSAKQATE 80


>gi|322831212|ref|YP_004211239.1| preprotein translocase SecG subunit [Rahnella sp. Y9602]
 gi|321166413|gb|ADW72112.1| preprotein translocase, SecG subunit [Rahnella sp. Y9602]
          Length = 111

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+V+ LIV +GL+ ++++Q        ++FG+ ++ T   S+     + R T +LA  FF
Sbjct: 5  LLVIFLIVAIGLIALVMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTGVLAALFF 64

Query: 59 ATSIALGMIS 68
            S+ LG +S
Sbjct: 65 IISLILGNMS 74


>gi|85712950|ref|ZP_01043990.1| Biopolymer transport protein [Idiomarina baltica OS145]
 gi|85693256|gb|EAQ31214.1| Biopolymer transport protein [Idiomarina baltica OS145]
          Length = 86

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          LMV+ LIV + L+  I+IQ    +    +FGS ++ T   S+     L R TAILA  FF
Sbjct: 5  LMVMFLIVAIVLIGFIMIQQGKGADMGASFGSGASNTVFGSSGSGNFLSRTTAILAVIFF 64

Query: 59 ATSIALGMISRYTSTRYKDNM 79
            ++ LG +S   S   +D++
Sbjct: 65 VLALVLGNLSTSVSDSSEDSL 85


>gi|256004754|ref|ZP_05429730.1| preprotein translocase, SecG subunit [Clostridium thermocellum
          DSM 2360]
 gi|281416857|ref|ZP_06247877.1| preprotein translocase, SecG subunit [Clostridium thermocellum
          JW20]
 gi|255991347|gb|EEU01453.1| preprotein translocase, SecG subunit [Clostridium thermocellum
          DSM 2360]
 gi|281408259|gb|EFB38517.1| preprotein translocase, SecG subunit [Clostridium thermocellum
          JW20]
 gi|316941096|gb|ADU75130.1| preprotein translocase, SecG subunit [Clostridium thermocellum
          DSM 1313]
          Length = 79

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS------SDSSAFGSSSNF--TSVRSTAHSLGRFTAI 52
          MQI + ++HLI  + L+ ++L+QS      S S A G+ + F     R+    LG++TA+
Sbjct: 1  MQIAVTILHLIFSISLIVIVLLQSGRRAGLSGSIAGGAETFFGKNKGRTIDAILGKYTAV 60

Query: 53 LAFFFFATSIALGMI 67
           A  F  TS+ L +I
Sbjct: 61 AAIGFLITSVVLQLI 75


>gi|165976159|ref|YP_001651752.1| preprotein translocase subunit SecG [Actinobacillus
          pleuropneumoniae serovar 3 str. JL03]
 gi|165876260|gb|ABY69308.1| preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 3 str. JL03]
          Length = 108

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 50/82 (60%), Gaps = 9/82 (10%)

Query: 5  LMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFTSVRS--TAHSLGRFTAILAFFFF 58
          L +++L+V V L+  +L+Q    +D+ A FG+ ++ T   S  +A+ L R TA+LA  FF
Sbjct: 5  LPIIYLVVAVALIGFVLMQQGKGADAGASFGAGASGTVFGSAGSANFLSRTTAVLAIIFF 64

Query: 59 ATSIALGMISRYTS---TRYKD 77
            S+ +G ++ + +   ++++D
Sbjct: 65 GISLLIGNLNSHQTAPKSQFED 86


>gi|37528351|ref|NP_931696.1| preprotein translocase subunit SecG [Photorhabdus luminescens
          subsp. laumondii TTO1]
 gi|36787789|emb|CAE16904.1| Protein-export membrane protein SecG (Preprotein translocase band
          1 subunit) (P12) [Photorhabdus luminescens subsp.
          laumondii TTO1]
          Length = 112

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 47/82 (57%), Gaps = 9/82 (10%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV L+V +GL+ ++++Q        ++FG+ ++ T   S+     + R TA+ A  FF
Sbjct: 5  LLVVFLLVAIGLIALVMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALFATLFF 64

Query: 59 ATSIALG-MISRYT--STRYKD 77
            S+ LG M S  T  S+++++
Sbjct: 65 IISLVLGNMTSNQTGASSKWEN 86


>gi|125972668|ref|YP_001036578.1| preprotein translocase, SecG subunit [Clostridium thermocellum
          ATCC 27405]
 gi|125712893|gb|ABN51385.1| preprotein translocase, SecG subunit [Clostridium thermocellum
          ATCC 27405]
          Length = 83

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS------SDSSAFGSSSNF--TSVRSTAHSLGRFTAI 52
          MQI + ++HLI  + L+ ++L+QS      S S A G+ + F     R+    LG++TA+
Sbjct: 5  MQIAVTILHLIFSISLIVIVLLQSGRRAGLSGSIAGGAETFFGKNKGRTIDAILGKYTAV 64

Query: 53 LAFFFFATSIALGMI 67
           A  F  TS+ L +I
Sbjct: 65 AAIGFLITSVVLQLI 79


>gi|126208223|ref|YP_001053448.1| preprotein translocase subunit SecG [Actinobacillus
          pleuropneumoniae L20]
 gi|190150056|ref|YP_001968581.1| protein-export membrane protein [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|303251465|ref|ZP_07337641.1| preprotein translocase subunit SecG [Actinobacillus
          pleuropneumoniae serovar 6 str. Femo]
 gi|303252338|ref|ZP_07338504.1| preprotein translocase subunit SecG [Actinobacillus
          pleuropneumoniae serovar 2 str. 4226]
 gi|307245603|ref|ZP_07527689.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 1 str. 4074]
 gi|307247723|ref|ZP_07529761.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 2 str. S1536]
 gi|307249956|ref|ZP_07531928.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 4 str. M62]
 gi|307252299|ref|ZP_07534196.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 6 str. Femo]
 gi|307254559|ref|ZP_07536393.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307256766|ref|ZP_07538545.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 10 str. D13039]
 gi|307259013|ref|ZP_07540744.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 11 str. 56153]
 gi|307261209|ref|ZP_07542884.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 12 str. 1096]
 gi|307263388|ref|ZP_07545004.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 13 str. N273]
 gi|126097015|gb|ABN73843.1| protein-export membrane protein [Actinobacillus pleuropneumoniae
          serovar 5b str. L20]
 gi|189915187|gb|ACE61439.1| protein-export membrane protein [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|302648797|gb|EFL78987.1| preprotein translocase subunit SecG [Actinobacillus
          pleuropneumoniae serovar 2 str. 4226]
 gi|302649697|gb|EFL79877.1| preprotein translocase subunit SecG [Actinobacillus
          pleuropneumoniae serovar 6 str. Femo]
 gi|306853305|gb|EFM85524.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 1 str. 4074]
 gi|306855753|gb|EFM87918.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 2 str. S1536]
 gi|306858016|gb|EFM90100.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 4 str. M62]
 gi|306860221|gb|EFM92237.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 6 str. Femo]
 gi|306862496|gb|EFM94456.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306864814|gb|EFM96718.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 10 str. D13039]
 gi|306867037|gb|EFM98894.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 11 str. 56153]
 gi|306868940|gb|EFN00742.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 12 str. 1096]
 gi|306871266|gb|EFN02994.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 13 str. N273]
          Length = 108

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 50/82 (60%), Gaps = 9/82 (10%)

Query: 5  LMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFTSVRS--TAHSLGRFTAILAFFFF 58
          L +++L+V V L+  +L+Q    +D+ A FG+ ++ T   S  +A+ L R TA+LA  FF
Sbjct: 5  LTIIYLVVAVALIGFVLMQQGKGADAGASFGAGASGTVFGSAGSANFLSRTTAVLAIIFF 64

Query: 59 ATSIALGMISRYTS---TRYKD 77
            S+ +G ++ + +   ++++D
Sbjct: 65 GISLLIGNLNSHQTAPKSQFED 86


>gi|317493623|ref|ZP_07952044.1| preprotein translocase SecG subunit protein [Enterobacteriaceae
          bacterium 9_2_54FAA]
 gi|316918566|gb|EFV39904.1| preprotein translocase SecG subunit protein [Enterobacteriaceae
          bacterium 9_2_54FAA]
          Length = 111

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          L+V+ L+V +GLV ++++Q    +        G+S+       + + + R TA+LA  FF
Sbjct: 5  LLVIFLLVSIGLVAMVMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRTTAVLATLFF 64

Query: 59 ATSIALGMIS 68
            S+ LG +S
Sbjct: 65 VLSLVLGNLS 74


>gi|152991580|ref|YP_001357302.1| preprotein translocase subunit G [Nitratiruptor sp. SB155-2]
 gi|151423441|dbj|BAF70945.1| preprotein translocase subunit G [Nitratiruptor sp. SB155-2]
          Length = 113

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 44/101 (43%), Gaps = 11/101 (10%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           L ++ +++ + L  VIL+Q S S       GS+ +    +     L R T  LA  F   
Sbjct: 5   LFILQIVLAIILTIVILLQKSSSIGLGAYSGSNESVFGAKGPQGFLARLTFFLATVFVFN 64

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
           +I LG +       Y  N  +S+VD+IK Q         +P
Sbjct: 65  TILLGYL-------YNKNYTKSVVDTIKVQKTVPIPTVPTP 98


>gi|293610132|ref|ZP_06692433.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827364|gb|EFF85728.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325124305|gb|ADY83828.1| preprotein translocase subunit SecG [Acinetobacter calcoaceticus
          PHEA-2]
          Length = 109

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 24/88 (27%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-------------SSAFGS--SSNFTSVRSTAHS 45
          M  F+++VH+I+ V ++ +IL+Q                ++ FG+  S NF         
Sbjct: 1  MHSFVLIVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNF--------- 51

Query: 46 LGRFTAILAFFFFATSIALGMISRYTST 73
          L R TAIL   FF TS+ L + ++  +T
Sbjct: 52 LTRLTAILTALFFVTSLTLAVFAKKQTT 79


>gi|328543805|ref|YP_004303914.1| hypothetical protein SL003B_2187 [Polymorphum gilvum SL003B-26A1]
 gi|326413549|gb|ADZ70612.1| hypothetical protein SL003B_2187 [Polymorphum gilvum SL003B-26A1]
          Length = 128

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 22/28 (78%)

Query: 42 TAHSLGRFTAILAFFFFATSIALGMISR 69
          TA+ L R TA+LA  FFATSIAL +I++
Sbjct: 46 TANVLTRATAVLAVVFFATSIALSLIAK 73


>gi|254455461|ref|ZP_05068890.1| preprotein translocase SecG subunit [Candidatus Pelagibacter sp.
          HTCC7211]
 gi|207082463|gb|EDZ59889.1| preprotein translocase SecG subunit [Candidatus Pelagibacter sp.
          HTCC7211]
          Length = 79

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 8/76 (10%)

Query: 21 LIQSSDSSAFG---SSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKD 77
          ++Q S+  A G   S  NF   RS    + + TAI+A  F   S+AL +ISR   T    
Sbjct: 1  MLQKSEGGALGIGVSQENFMLSRSAGSFMTKATAIVATLFIICSLALTIISRAELTPTS- 59

Query: 78 NMHRSLVDSIKDQGND 93
              S++D+++++  D
Sbjct: 60 ----SVLDTVEEKAED 71


>gi|118589927|ref|ZP_01547331.1| preprotein translocase SecG subunit [Stappia aggregata IAM 12614]
 gi|118437424|gb|EAV44061.1| preprotein translocase SecG subunit [Stappia aggregata IAM 12614]
          Length = 127

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (63%), Gaps = 3/72 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT---SVRSTAHSLGRFTAILAFFF 57
          M+  ++V+HL+VV+ LV V+L+Q S+  A G         S R TA+ L R TA+LA  F
Sbjct: 1  METVVIVIHLMVVLALVLVVLLQRSEGGALGIGGGGGGLMSSRGTANILTRATAVLAVAF 60

Query: 58 FATSIALGMISR 69
          FATS+ L +I++
Sbjct: 61 FATSLTLSLIAK 72


>gi|261212249|ref|ZP_05926535.1| preprotein translocase subunit SecG [Vibrio sp. RC341]
 gi|260838857|gb|EEX65508.1| preprotein translocase subunit SecG [Vibrio sp. RC341]
          Length = 111

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 45/80 (56%), Gaps = 7/80 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFF 58
          L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A  FF
Sbjct: 5  LLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFATVFF 64

Query: 59 ATSIALGMISRY-TSTRYKD 77
            S+ LG +S + T +++ D
Sbjct: 65 VISLVLGNMSTHKTESQWVD 84


>gi|23015301|ref|ZP_00055081.1| COG1314: Preprotein translocase subunit SecG [Magnetospirillum
          magnetotacticum MS-1]
          Length = 112

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 6/74 (8%)

Query: 1  MQIF--LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILA 54
          M +F  ++V+HLI+ V LV VIL+Q S+        GS     + R+  + L R T I+A
Sbjct: 1  MDVFPIILVIHLILAVTLVGVILLQRSEGGALGIGGGSGGGLMTGRAAGNLLTRTTGIVA 60

Query: 55 FFFFATSIALGMIS 68
            FF TS+ L +++
Sbjct: 61 AAFFVTSLGLALLA 74


>gi|161524203|ref|YP_001579215.1| preprotein translocase subunit SecG [Burkholderia multivorans
          ATCC 17616]
 gi|189351040|ref|YP_001946668.1| preprotein translocase subunit SecG [Burkholderia multivorans
          ATCC 17616]
 gi|221199655|ref|ZP_03572699.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD2M]
 gi|221205445|ref|ZP_03578460.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD2]
 gi|221211734|ref|ZP_03584713.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD1]
 gi|160341632|gb|ABX14718.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          ATCC 17616]
 gi|189335062|dbj|BAG44132.1| preprotein translocase SecG subunit [Burkholderia multivorans
          ATCC 17616]
 gi|221169095|gb|EEE01563.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD1]
 gi|221174283|gb|EEE06715.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD2]
 gi|221180940|gb|EEE13343.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD2M]
          Length = 125

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 6/78 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLAT 64

Query: 56 FFFATSIALGMISRYTST 73
           FF  ++AL  I  Y ST
Sbjct: 65 VFFVATLALTYIGSYKST 82


>gi|291613537|ref|YP_003523694.1| preprotein translocase, SecG subunit [Sideroxydans lithotrophicus
          ES-1]
 gi|291583649|gb|ADE11307.1| preprotein translocase, SecG subunit [Sideroxydans lithotrophicus
          ES-1]
          Length = 115

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRST--AHSLGRFTAILA 54
          M+  + V+H++  V L+ ++LIQ    +    AFGS S  +   S+  A+ L R TA+ A
Sbjct: 1  MENIVWVIHVVTAVVLIGLVLIQHGKGADMGAAFGSGSAGSVFGSSGSANFLSRSTAVAA 60

Query: 55 FFFFATSIAL 64
            FF TS+AL
Sbjct: 61 TIFFITSLAL 70


>gi|238028144|ref|YP_002912375.1| preprotein translocase subunit SecG [Burkholderia glumae BGR1]
 gi|237877338|gb|ACR29671.1| Protein-export membrane protein [Burkholderia glumae BGR1]
          Length = 125

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 44/78 (56%), Gaps = 6/78 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV ++  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQILSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTS 72
            FF  ++AL  +  Y S
Sbjct: 64 TVFFVATLALTYLGSYKS 81


>gi|307565930|ref|ZP_07628389.1| preprotein translocase, SecG subunit [Prevotella amnii CRIS 21A-A]
 gi|307345358|gb|EFN90736.1| preprotein translocase, SecG subunit [Prevotella amnii CRIS 21A-A]
          Length = 122

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 55/124 (44%), Gaps = 9/124 (7%)

Query: 3   IFLMVVHLIVVVGL--VCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           ++ + + LIVV+ L  +C++LIQ S     SS F SS+    VR T   + + T   A  
Sbjct: 1   MYTLFIVLIVVIALLMICIVLIQESKGGGLSSNFSSSNAIMGVRKTTDFVEKATWTFAAL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN-DNFGDGSSPKLDSVSAKSSSSVV 115
               SIA   ++   ST        +  D   +  N  NF  G+S +  +   K ++ + 
Sbjct: 61  MVIISIASAYVAPTASTDESVIEKAATSDQPTNPNNLPNF--GASQQKQAAPTKQAAPIA 118

Query: 116 AGKR 119
             K+
Sbjct: 119 PAKK 122


>gi|238793019|ref|ZP_04636648.1| Protein-export membrane protein secG [Yersinia intermedia ATCC
          29909]
 gi|238727619|gb|EEQ19144.1| Protein-export membrane protein secG [Yersinia intermedia ATCC
          29909]
          Length = 111

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 43/82 (52%), Gaps = 9/82 (10%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          L+V  L++ +GLV +I++Q    +        G+S+       + + + R TA+LA  FF
Sbjct: 5  LLVFFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTALLATLFF 64

Query: 59 ATSIALGMISR---YTSTRYKD 77
            S+ LG +S    +T + +++
Sbjct: 65 VISLILGNMSTNQGHTGSEWEN 86


>gi|304391670|ref|ZP_07373612.1| preprotein translocase subunit SecG [Ahrensia sp. R2A130]
 gi|303295899|gb|EFL90257.1| preprotein translocase subunit SecG [Ahrensia sp. R2A130]
          Length = 132

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 52/94 (55%), Gaps = 12/94 (12%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   L+VVH+++V+ L+ ++L+Q S+  A G          F S R  A +L + T I+A
Sbjct: 1  MTTVLIVVHIMLVLALIVLVLLQKSEGGALGIGGGGGGGGGFISARGAADALTKTTTIVA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
            FFATS+ALG+++       +DN    ++  ++
Sbjct: 61 AGFFATSVALGVVAN------RDNRTEDILRQVE 88


>gi|221134252|ref|ZP_03560557.1| hypothetical protein GHTCC_04935 [Glaciecola sp. HTCC2999]
          Length = 136

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS-----SN--FTSVRSTAHSLGRFTAIL 53
          +Q  L+V +LIV + L+ ++LIQ    +  G+S     SN  F S   + + L R TAIL
Sbjct: 2  LQEVLIVAYLIVALLLIGLVLIQQGKGADMGASLGGGGSNTVFGS-SGSGNFLSRSTAIL 60

Query: 54 AFFFFATSIALGMIS 68
          A  FF  S+ LG ++
Sbjct: 61 ATLFFLISLLLGNLT 75


>gi|87200034|ref|YP_497291.1| protein translocase subunit secG [Novosphingobium aromaticivorans
          DSM 12444]
 gi|87135715|gb|ABD26457.1| protein translocase subunit secG [Novosphingobium aromaticivorans
          DSM 12444]
          Length = 131

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
          IFL VV  I+   LV VIL+Q S+       GS + F S R  A  + R T +LA  F  
Sbjct: 5  IFLTVVQAIIAALLVVVILMQKSEGGGLGVGGSPAGFMSARGAADFMTRATTVLASLFVL 64

Query: 60 TSIALGMISR-YTSTRYKDN 78
           SI L  ++   TS R  D 
Sbjct: 65 LSIILAALAVGATSGREIDT 84


>gi|22124599|ref|NP_668022.1| preprotein translocase subunit SecG [Yersinia pestis KIM 10]
 gi|45440438|ref|NP_991977.1| preprotein translocase subunit SecG [Yersinia pestis biovar
          Microtus str. 91001]
 gi|51594829|ref|YP_069020.1| preprotein translocase subunit SecG [Yersinia pseudotuberculosis
          IP 32953]
 gi|108806047|ref|YP_649963.1| preprotein translocase subunit SecG [Yersinia pestis Antiqua]
 gi|108813403|ref|YP_649170.1| preprotein translocase subunit SecG [Yersinia pestis Nepal516]
 gi|145600795|ref|YP_001164871.1| preprotein translocase subunit SecG [Yersinia pestis Pestoides F]
 gi|153948565|ref|YP_001402553.1| preprotein translocase subunit SecG [Yersinia pseudotuberculosis
          IP 31758]
 gi|153997276|ref|ZP_02022376.1| protein-export membrane protein [Yersinia pestis CA88-4125]
 gi|162418621|ref|YP_001608283.1| preprotein translocase subunit SecG [Yersinia pestis Angola]
 gi|165937570|ref|ZP_02226133.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
          Orientalis str. IP275]
 gi|166214015|ref|ZP_02240050.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
          Antiqua str. B42003004]
 gi|167401353|ref|ZP_02306853.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
          Antiqua str. UG05-0454]
 gi|167420700|ref|ZP_02312453.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167423246|ref|ZP_02314999.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|186893838|ref|YP_001870950.1| preprotein translocase subunit SecG [Yersinia pseudotuberculosis
          PB1/+]
 gi|218930513|ref|YP_002348388.1| preprotein translocase subunit SecG [Yersinia pestis CO92]
 gi|229839151|ref|ZP_04459310.1| preprotein translocase membrane subunit [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229896640|ref|ZP_04511807.1| preprotein translocase membrane subunit [Yersinia pestis
          Pestoides A]
 gi|229899715|ref|ZP_04514856.1| preprotein translocase membrane subunit [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229903877|ref|ZP_04518990.1| preprotein translocase membrane subunit [Yersinia pestis
          Nepal516]
 gi|270489133|ref|ZP_06206207.1| preprotein translocase, SecG subunit [Yersinia pestis KIM D27]
 gi|21957402|gb|AAM84273.1|AE013670_10 protein export - membrane protein [Yersinia pestis KIM 10]
 gi|45435295|gb|AAS60854.1| protein-export membrane protein [Yersinia pestis biovar Microtus
          str. 91001]
 gi|51588111|emb|CAH19717.1| protein-export membrane protein segG [Yersinia pseudotuberculosis
          IP 32953]
 gi|108777051|gb|ABG19570.1| protein translocase subunit secG [Yersinia pestis Nepal516]
 gi|108777960|gb|ABG12018.1| protein translocase subunit secG [Yersinia pestis Antiqua]
 gi|115349124|emb|CAL22087.1| protein-export membrane protein [Yersinia pestis CO92]
 gi|145212491|gb|ABP41898.1| protein translocase subunit secG [Yersinia pestis Pestoides F]
 gi|149288913|gb|EDM38993.1| protein-export membrane protein [Yersinia pestis CA88-4125]
 gi|152960060|gb|ABS47521.1| preprotein translocase, SecG subunit [Yersinia pseudotuberculosis
          IP 31758]
 gi|162351436|gb|ABX85384.1| preprotein translocase, SecG subunit [Yersinia pestis Angola]
 gi|165914675|gb|EDR33289.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
          Orientalis str. IP275]
 gi|166204810|gb|EDR49290.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
          Antiqua str. B42003004]
 gi|166961506|gb|EDR57527.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167049378|gb|EDR60786.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
          Antiqua str. UG05-0454]
 gi|167057416|gb|EDR67162.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|186696864|gb|ACC87493.1| preprotein translocase, SecG subunit [Yersinia pseudotuberculosis
          PB1/+]
 gi|229679647|gb|EEO75750.1| preprotein translocase membrane subunit [Yersinia pestis
          Nepal516]
 gi|229687207|gb|EEO79282.1| preprotein translocase membrane subunit [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229695517|gb|EEO85564.1| preprotein translocase membrane subunit [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229700418|gb|EEO88450.1| preprotein translocase membrane subunit [Yersinia pestis
          Pestoides A]
 gi|270337637|gb|EFA48414.1| preprotein translocase, SecG subunit [Yersinia pestis KIM D27]
 gi|320013702|gb|ADV97273.1| preprotein translocase membrane subunit [Yersinia pestis biovar
          Medievalis str. Harbin 35]
          Length = 111

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 8/87 (9%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          L+V  L++ +GLV +I++Q    +        G+S+       + + + R TA+LA  FF
Sbjct: 5  LLVFFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLATLFF 64

Query: 59 ATSIALGMISRYTSTR--YKDNMHRSL 83
            S+ LG +S     +    +N+ + L
Sbjct: 65 VISLILGNMSSNQGQKSSEWENLGQPL 91


>gi|87119794|ref|ZP_01075691.1| hypothetical protein MED121_07635 [Marinomonas sp. MED121]
 gi|86165270|gb|EAQ66538.1| hypothetical protein MED121_07635 [Marinomonas sp. MED121]
          Length = 118

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS---SDSSA---FGSSSNFTSVRSTAHSLGRFTAILA 54
          M+  ++VVH++  + ++ ++L+Q    +D+ A    G+S      +      G+ TA+ A
Sbjct: 2  MEALVLVVHVLAAIAIIGLVLLQQGKGADAGASFGGGASQTVFGSQGGGSFFGKLTALFA 61

Query: 55 FFFFATSIALGMISRYTSTRYKDNM-HRSLVDSIKD 89
            FF TS AL  ++   + +    + +   V+ I+D
Sbjct: 62 LVFFLTSFALAYVASQQAKQVSGQLDYVPAVEEIQD 97


>gi|32265939|ref|NP_859971.1| preprotein translocase subunit SecG [Helicobacter hepaticus ATCC
          51449]
 gi|32261988|gb|AAP77037.1| membrane protein SecG involved in protein secretion [Helicobacter
          hepaticus ATCC 51449]
          Length = 132

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 11/88 (12%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAFG----SSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
          L VV +++ V +  ++L+Q S S   G    S+ +    +  A  L +FT  L   F   
Sbjct: 5  LFVVQIVLAVFITIIVLLQKSSSIGLGAYSGSNESVFGAKGPAGFLAKFTMFLGLLFVLN 64

Query: 61 SIALGMISRYTSTRYKDNMHRSLVDSIK 88
          +IAL     YT   Y     +S++DSI 
Sbjct: 65 TIAL----SYT---YNTQSQKSILDSIP 85


>gi|170025948|ref|YP_001722453.1| preprotein translocase subunit SecG [Yersinia pseudotuberculosis
          YPIII]
 gi|169752482|gb|ACA70000.1| preprotein translocase, SecG subunit [Yersinia pseudotuberculosis
          YPIII]
          Length = 111

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 8/87 (9%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          L+V  L++ +GLV +I++Q    +        G+S+       + + + R TA+LA  FF
Sbjct: 5  LLVFFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLATLFF 64

Query: 59 ATSIALGMISRYTSTR--YKDNMHRSL 83
            S+ LG +S     +    +N+ + L
Sbjct: 65 VISLILGNMSSNQGQKSSEWENLGQPL 91


>gi|330817793|ref|YP_004361498.1| preprotein translocase subunit SecG [Burkholderia gladioli BSR3]
 gi|327370186|gb|AEA61542.1| preprotein translocase subunit SecG [Burkholderia gladioli BSR3]
          Length = 129

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 44/78 (56%), Gaps = 6/78 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV ++  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQILSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTS 72
            FF  ++AL  +  Y S
Sbjct: 64 TIFFIATLALTYLGSYKS 81


>gi|152991634|ref|YP_001357355.1| preprotein translocase subunit G [Sulfurovum sp. NBC37-1]
 gi|151423495|dbj|BAF70998.1| preprotein translocase subunit G [Sulfurovum sp. NBC37-1]
          Length = 115

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 11/92 (11%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAFG----SSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
          L++V +++ + +   IL+Q S S   G    S+ +    +     L + T  LAF F   
Sbjct: 5  LLIVQIVLAIAITIAILLQKSSSIGLGAYSGSNESVFGAKGPTGFLAKLTFSLAFLFIVN 64

Query: 61 SIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
          ++ALG +       Y      S+VD I  + N
Sbjct: 65 TLALGYL-------YTSQNSASVVDEITPKNN 89


>gi|299134973|ref|ZP_07028164.1| preprotein translocase, SecG subunit [Afipia sp. 1NLS2]
 gi|298589950|gb|EFI50154.1| preprotein translocase, SecG subunit [Afipia sp. 1NLS2]
          Length = 117

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 49/90 (54%), Gaps = 10/90 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
          MQ  ++V+HLI+V  L+ V+L+Q S+    G        F S R T + L R TAILA  
Sbjct: 1  MQTVVIVIHLIIVAALIGVVLLQRSEGGGLGIGGGGGGGFMSSRGTTNLLTRTTAILAAG 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDS 86
          FF TS+ L  ++ Y      DN  +SL++ 
Sbjct: 61 FFITSLFLSWLAGY------DNRPKSLINP 84


>gi|224418729|ref|ZP_03656735.1| preprotein translocase subunit SecG [Helicobacter canadensis MIT
           98-5491]
 gi|253826743|ref|ZP_04869628.1| protein-export membrane protein secG [Helicobacter canadensis MIT
           98-5491]
 gi|313142246|ref|ZP_07804439.1| preprotein translocase subunit SecG [Helicobacter canadensis MIT
           98-5491]
 gi|253510149|gb|EES88808.1| protein-export membrane protein secG [Helicobacter canadensis MIT
           98-5491]
 gi|313131277|gb|EFR48894.1| preprotein translocase subunit SecG [Helicobacter canadensis MIT
           98-5491]
          Length = 115

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 45/101 (44%), Gaps = 11/101 (10%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSSAFG----SSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           L+++  ++ V +  ++L+Q S S   G    S+ +    +  A  L + T +L F F   
Sbjct: 5   LLIIQFVLAVIITIIVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKTTFVLGFLFVVN 64

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
           +IALG         Y  +   S++D+++   N      + P
Sbjct: 65  TIALGYF-------YTKDSQSSILDNVEIPANPTPATPAVP 98


>gi|268592828|ref|ZP_06127049.1| homoserine dehydrogenase [Providencia rettgeri DSM 1131]
 gi|291311613|gb|EFE52066.1| homoserine dehydrogenase [Providencia rettgeri DSM 1131]
          Length = 114

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 43/81 (53%), Gaps = 9/81 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M + L+++ L+  +GL+ +I++Q        ++FG+ ++ T   S+     + R T ILA
Sbjct: 1  MYVALLIIFLLAAIGLIGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTGILA 60

Query: 55 FFFFATSIALGMISRYTSTRY 75
            FF  S+ LG     T+ +Y
Sbjct: 61 AVFFIISLILG---NMTANKY 78


>gi|326387874|ref|ZP_08209480.1| protein translocase subunit secG [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326207920|gb|EGD58731.1| protein translocase subunit secG [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 149

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 3   IFLMVVHLIVVVGLVCVILIQ---SSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
           +FL VV  IV + LV VIL+Q          GS S F S R  A  L R T ILA  F  
Sbjct: 16  VFLSVVQAIVALLLVMVILMQKSEGGGLGVGGSPSGFMSARGAADFLTRATTILAAIFVG 75

Query: 60  TSIALGMISRYTSTRYK--DNMHRSL 83
            SI L  ++  T++ ++   +++RSL
Sbjct: 76  LSIVLAALAVGTNSTHQIDTSLNRSL 101


>gi|217970155|ref|YP_002355389.1| preprotein translocase subunit SecG [Thauera sp. MZ1T]
 gi|217507482|gb|ACK54493.1| preprotein translocase, SecG subunit [Thauera sp. MZ1T]
          Length = 116

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 39/67 (58%), Gaps = 6/67 (8%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILAFFF 57
           ++ VH++V +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA  F
Sbjct: 8  LVLTVHVLVGLGVIGLVLVQHGKGADMGAAFGSGASGSLFGASGSANFLSRTTAVLATVF 67

Query: 58 FATSIAL 64
          F TS+ L
Sbjct: 68 FLTSLGL 74


>gi|89095217|ref|ZP_01168140.1| Preprotein translocase SecG subunit [Oceanospirillum sp. MED92]
 gi|89080514|gb|EAR59763.1| Preprotein translocase SecG subunit [Oceanospirillum sp. MED92]
          Length = 130

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 45/83 (54%), Gaps = 6/83 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M+  ++++H+++   ++ +IL+Q    +   ++FG+ ++ T   ST     L R TAI+A
Sbjct: 1  METVVLIIHVLLAAAIIGLILLQQGKGAEAGASFGAGASQTVFGSTGSGNFLSRMTAIVA 60

Query: 55 FFFFATSIALGMISRYTSTRYKD 77
             FATS  L + ++  +    D
Sbjct: 61 AGIFATSFVLAVYAKNKADTVSD 83


>gi|194289158|ref|YP_002005065.1| preprotein translocase subunit SecG [Cupriavidus taiwanensis LMG
          19424]
 gi|193222993|emb|CAQ68998.1| preprotein translocase membrane subunit [Cupriavidus taiwanensis
          LMG 19424]
          Length = 124

 Score = 35.4 bits (80), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 9/79 (11%)

Query: 1  MQIF---LMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTA 51
          M IF   L+V+ ++  +G++ ++LIQ    +    AFGS  S +      +A+ L R TA
Sbjct: 1  MAIFKTLLVVLQVLSALGVIGLVLIQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTA 60

Query: 52 ILAFFFFATSIALGMISRY 70
          +LA  FF  ++AL ++  Y
Sbjct: 61 VLATLFFVCTLALTLLGNY 79


>gi|255319715|ref|ZP_05360923.1| preprotein translocase iisp family, auxillary membrane component
           [Acinetobacter radioresistens SK82]
 gi|262380003|ref|ZP_06073158.1| preprotein translocase, SecG subunit [Acinetobacter radioresistens
           SH164]
 gi|255303244|gb|EET82453.1| preprotein translocase iisp family, auxillary membrane component
           [Acinetobacter radioresistens SK82]
 gi|262298197|gb|EEY86111.1| preprotein translocase, SecG subunit [Acinetobacter radioresistens
           SH164]
          Length = 109

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 53/117 (45%), Gaps = 26/117 (22%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD-------------SSAFGS--SSNFTSVRSTAHS 45
           M  F++V+H+I+ V ++ +IL+Q                ++ FG+  S NF         
Sbjct: 1   MHTFVLVIHIILAVLMIGLILVQHGKGADAGASFGGGGAATVFGASGSGNF--------- 51

Query: 46  LGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
           + R TAIL   FF TS+ L + ++  +T       +S+  S+  Q        ++PK
Sbjct: 52  MTRLTAILTALFFVTSLTLAVFAKKQTTAAYSL--QSVQTSVPAQPVSPETSPTAPK 106


>gi|113867069|ref|YP_725558.1| preprotein translocase subunit SecG [Ralstonia eutropha H16]
 gi|113525845|emb|CAJ92190.1| preprotein translocase subunit SecG [Ralstonia eutropha H16]
          Length = 124

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 9/79 (11%)

Query: 1  MQIF---LMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTA 51
          M IF   L+V+ ++  +G++ ++LIQ    +    AFGS  S +      +A+ L R TA
Sbjct: 1  MAIFKTLLVVLQVLSALGVIGLVLIQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTA 60

Query: 52 ILAFFFFATSIALGMISRY 70
          +LA  FF  ++AL ++  Y
Sbjct: 61 VLATLFFVCTLALTLLGNY 79


>gi|189463557|ref|ZP_03012342.1| hypothetical protein BACCOP_04281 [Bacteroides coprocola DSM
          17136]
 gi|189429660|gb|EDU98644.1| hypothetical protein BACCOP_04281 [Bacteroides coprocola DSM
          17136]
          Length = 128

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 6/76 (7%)

Query: 3  IFLMVVHLIVVVG-LVC-VILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          ++L+ V LIV+   L+C V+LIQ+S     SS+F +S+    VR T   + + T  LA F
Sbjct: 4  LYLLFVGLIVLAAVLMCFVVLIQNSKGGGLSSSFAASNQIMGVRKTTDFIEKLTWGLAIF 63

Query: 57 FFATSIALGMISRYTS 72
              S+A   +   TS
Sbjct: 64 MVVVSVATAYVIPTTS 79


>gi|296160628|ref|ZP_06843443.1| preprotein translocase, SecG subunit [Burkholderia sp. Ch1-1]
 gi|295889154|gb|EFG68957.1| preprotein translocase, SecG subunit [Burkholderia sp. Ch1-1]
          Length = 125

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRY 70
            FF T++ L  +  Y
Sbjct: 64 AVFFVTTLTLTYLGAY 79


>gi|187923339|ref|YP_001894981.1| preprotein translocase subunit SecG [Burkholderia phytofirmans
          PsJN]
 gi|187714533|gb|ACD15757.1| preprotein translocase, SecG subunit [Burkholderia phytofirmans
          PsJN]
          Length = 125

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRY 70
            FF T++ L  +  Y
Sbjct: 64 AVFFVTTLTLTYLGAY 79


>gi|304396344|ref|ZP_07378225.1| preprotein translocase, SecG subunit [Pantoea sp. aB]
 gi|304355853|gb|EFM20219.1| preprotein translocase, SecG subunit [Pantoea sp. aB]
          Length = 112

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV + LV +I++Q        ++FG+ ++ T   S+     + R T ILA  FF
Sbjct: 5  LLVVFLIVAIALVGMIMLQQGKGADMGASFGAGASGTVFGSSGSGNFMTRTTGILAALFF 64

Query: 59 ATSIALGMISRYTSTR 74
            S+ LG ++   +++
Sbjct: 65 IISLVLGNLNSNKASK 80


>gi|71906587|ref|YP_284174.1| preprotein translocase subunit SecG [Dechloromonas aromatica RCB]
 gi|71846208|gb|AAZ45704.1| protein translocase subunit secG [Dechloromonas aromatica RCB]
          Length = 123

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 48/101 (47%), Gaps = 10/101 (9%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILAFFF 57
            ++ VH++V + ++ ++L+Q    +    AFGS  S +      +A+ L R T ILA  F
Sbjct: 7   LVLTVHILVAIVIIGLVLMQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAGVF 66

Query: 58  FATSIALGMI----SRYTSTRYKDNMHRSLVDSIKDQGNDN 94
           F TS+ L  I     + T +  ++ +    V      G ++
Sbjct: 67  FVTSLTLAYIGSNKPKTTGSLMQEPVQSQTVSQPASAGGES 107


>gi|239996534|ref|ZP_04717058.1| protein-export membrane protein secG(General Secretory Pathway)
          [Alteromonas macleodii ATCC 27126]
          Length = 137

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 8/84 (9%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+V +LIV + L+  +LIQ    +    +FGS  + T   S+     + R TAILA  FF
Sbjct: 6  LLVAYLIVALLLIGFVLIQQGKGADMGASFGSGGSNTVFGSSGSGNFMTRTTAILAGLFF 65

Query: 59 ATSIALGMIS--RYTSTRYKDNMH 80
            S++LG ++  R ++    +N+ 
Sbjct: 66 LISLSLGAMTANRESAEDEWNNLE 89


>gi|262274886|ref|ZP_06052697.1| hypothetical protein VHA_001868 [Grimontia hollisae CIP 101886]
 gi|262221449|gb|EEY72763.1| hypothetical protein VHA_001868 [Grimontia hollisae CIP 101886]
          Length = 110

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 42/74 (56%), Gaps = 6/74 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRS--TAHSLGRFTAILA 54
          M   L+V++L+  +G++ ++LIQ        ++FG+ ++ T   S  + + L R TAI A
Sbjct: 1  MYEILLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGSGGSGNFLTRMTAIFA 60

Query: 55 FFFFATSIALGMIS 68
            FF  S+ LG ++
Sbjct: 61 TVFFVLSLVLGNLT 74


>gi|103486659|ref|YP_616220.1| preprotein translocase, SecG subunit [Sphingopyxis alaskensis
          RB2256]
 gi|98976736|gb|ABF52887.1| protein translocase subunit secG [Sphingopyxis alaskensis RB2256]
          Length = 154

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
          FL+VV  +V   ++ VIL+Q S+       GS +   S R  A  + R T +LA  F   
Sbjct: 8  FLLVVQALVAAAMIGVILMQKSEGGGLGVGGSPAGLLSARGAADFMTRATTVLACLFVGL 67

Query: 61 SIAL 64
          SI L
Sbjct: 68 SILL 71


>gi|218961463|ref|YP_001741238.1| protein-export membrane protein secG, essential membrane protein
          [Candidatus Cloacamonas acidaminovorans]
 gi|167730120|emb|CAO81032.1| protein-export membrane protein secG, essential membrane protein
          [Candidatus Cloacamonas acidaminovorans]
          Length = 136

 Score = 35.0 bits (79), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 6  MVVHLIVVVGLVCVILIQSS----DSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATS 61
          +++H+I+ V LV VIL Q+S    DS+  G++ N       +  L ++T ILA  F A+ 
Sbjct: 32 LIIHVIICVALVLVILAQTSKGGLDSNLGGAAMNVFGGSGASKFLKKWTQILAVVFAASC 91

Query: 62 IALGMISR 69
          + L  + +
Sbjct: 92 LFLAFLVK 99


>gi|308189110|ref|YP_003933241.1| Protein-export membrane protein secG [Pantoea vagans C9-1]
 gi|308059620|gb|ADO11792.1| Protein-export membrane protein secG [Pantoea vagans C9-1]
          Length = 112

 Score = 35.0 bits (79), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 6/67 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+VV LIV + LV +I++Q        ++FG+ ++ T   S+     + R T ILA  FF
Sbjct: 5  LLVVFLIVAIALVGMIMLQQGKGADMGASFGAGASGTVFGSSGSGNFMTRTTGILAALFF 64

Query: 59 ATSIALG 65
            S+ LG
Sbjct: 65 IISLVLG 71


>gi|170696400|ref|ZP_02887529.1| preprotein translocase, SecG subunit [Burkholderia graminis
          C4D1M]
 gi|170138728|gb|EDT06927.1| preprotein translocase, SecG subunit [Burkholderia graminis
          C4D1M]
          Length = 128

 Score = 35.0 bits (79), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRY 70
            FF T++ L  +  Y
Sbjct: 64 AVFFVTTLTLTYLGAY 79


>gi|258405668|ref|YP_003198410.1| preprotein translocase, SecG subunit [Desulfohalobium retbaense DSM
           5692]
 gi|257797895|gb|ACV68832.1| preprotein translocase, SecG subunit [Desulfohalobium retbaense DSM
           5692]
          Length = 118

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 50/119 (42%), Gaps = 11/119 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA---FGSSSNFTSVRSTAHS-LGRFTAILAFF 56
           M   ++ VH+IV V LV ++L+QS        FG SS      S A   L + TA  A  
Sbjct: 1   MNALILTVHIIVCVSLVTLVLLQSGKEGMGVIFGGSSGTVFGSSGAGGLLSKLTAGAATI 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
           F  TS+A      Y S + +     S+V    +Q        ++P  +  + +  S  V
Sbjct: 61  FIITSLAF----TYMSAQERQAPRESVV---LEQPAQQQAPATAPGTEKSAGQEGSKAV 112


>gi|261345164|ref|ZP_05972808.1| homoserine dehydrogenase [Providencia rustigianii DSM 4541]
 gi|282566855|gb|EFB72390.1| homoserine dehydrogenase [Providencia rustigianii DSM 4541]
          Length = 114

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 53/100 (53%), Gaps = 11/100 (11%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILA 54
           M I L+++ L+V + L+ ++++Q    +    +FG+ ++ T   S+     + R T ILA
Sbjct: 1   MYIALLIIFLLVAISLIGLVMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTGILA 60

Query: 55  FFFFATSIALGMIS--RY---TSTRYKDNMHRSLVDSIKD 89
             FF  S+ LG ++  +Y   T +++++    + V+   D
Sbjct: 61  AVFFIISLVLGNMTANKYGTGTGSKWENISEPAKVEQPTD 100


>gi|262280756|ref|ZP_06058539.1| preprotein translocase subunit SecG [Acinetobacter calcoaceticus
          RUH2202]
 gi|262257656|gb|EEY76391.1| preprotein translocase subunit SecG [Acinetobacter calcoaceticus
          RUH2202]
          Length = 109

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 21/89 (23%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ-------------SSDSSAFGSSSNFTSVRSTAHSLG 47
          M  F+++VH+I+ V ++ +IL+Q                ++ FG+S +       A+ L 
Sbjct: 1  MHSFVLIVHIILAVLMIGLILVQHGKGADAGASFGGGGAATVFGASGS-------ANFLT 53

Query: 48 RFTAILAFFFFATSIALGMIS-RYTSTRY 75
          R TA+L   FF TS+ L + + + TS  Y
Sbjct: 54 RLTAVLTALFFVTSLTLAVFAKKQTSEAY 82


>gi|83644098|ref|YP_432533.1| preprotein translocase subunit SecG [Hahella chejuensis KCTC
          2396]
 gi|83632141|gb|ABC28108.1| preprotein translocase, SecG subunit [Hahella chejuensis KCTC
          2396]
          Length = 132

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 45/83 (54%), Gaps = 9/83 (10%)

Query: 1  MQIF---LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTA 51
          M++F   +++VH+IV  G++ ++LIQ        ++FG  ++ T   S+     L   T 
Sbjct: 1  MELFETLIVIVHVIVAAGVIGLVLIQQGKGADMGASFGGGASQTVFGSSGSGSFLTNMTT 60

Query: 52 ILAFFFFATSIALGMISRYTSTR 74
           LA  FF +S AL  +++  +++
Sbjct: 61 TLAIVFFLSSFALAYVAKQKASQ 83


>gi|226329686|ref|ZP_03805204.1| hypothetical protein PROPEN_03598 [Proteus penneri ATCC 35198]
 gi|225202872|gb|EEG85226.1| hypothetical protein PROPEN_03598 [Proteus penneri ATCC 35198]
          Length = 133

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 51/91 (56%), Gaps = 7/91 (7%)

Query: 5   LMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRS--TAHSLGRFTAILAFFFF 58
           L+V+ +IV  GLV +IL+Q        ++FG+ ++ T   S  +A+ + R TA+LA  F 
Sbjct: 24  LIVILIIVATGLVGLILLQQGKGADMGASFGAGASGTVFGSSGSANFMTRMTAVLATAFI 83

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKD 89
             ++ LG +S   + R +D+   S+  + ++
Sbjct: 84  VLALILGNLSANKTVR-EDSKWMSIEQTTEE 113


>gi|212694610|ref|ZP_03302738.1| hypothetical protein BACDOR_04138 [Bacteroides dorei DSM 17855]
 gi|237711124|ref|ZP_04541605.1| preprotein translocase subunit SecG [Bacteroides sp. 9_1_42FAA]
 gi|237727490|ref|ZP_04557971.1| preprotein translocase subunit SecG [Bacteroides sp. D4]
 gi|265750711|ref|ZP_06086774.1| preprotein translocase subunit SecG [Bacteroides sp. 3_1_33FAA]
 gi|212663111|gb|EEB23685.1| hypothetical protein BACDOR_04138 [Bacteroides dorei DSM 17855]
 gi|229434346|gb|EEO44423.1| preprotein translocase subunit SecG [Bacteroides dorei 5_1_36/D4]
 gi|229454968|gb|EEO60689.1| preprotein translocase subunit SecG [Bacteroides sp. 9_1_42FAA]
 gi|263237607|gb|EEZ23057.1| preprotein translocase subunit SecG [Bacteroides sp. 3_1_33FAA]
          Length = 120

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 9/81 (11%)

Query: 3  IFLMVVHLIVVVGLV-C-VILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          ++L+++ LIV+  L+ C V+LIQ+S     +S+F SS+    VR T   + + T  LA F
Sbjct: 1  MYLLLIGLIVLAALLMCFVVLIQNSKGGGLASSFASSNQIMGVRKTTDFIEKLTWGLAAF 60

Query: 57 FFATSIALGMISRYTSTRYKD 77
            A S+   + + +  T + D
Sbjct: 61 MVACSV---LTAYFVPTAHTD 78


>gi|192361247|ref|YP_001983129.1| putative preprotein translocase SecG subunit [Cellvibrio
          japonicus Ueda107]
 gi|190687412|gb|ACE85090.1| putative preprotein translocase SecG subunit [Cellvibrio
          japonicus Ueda107]
          Length = 135

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 41/78 (52%), Gaps = 6/78 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLG------RFTAILA 54
          M+ F++V+H +  + ++ ++L+Q    +A G+S    + ++   S G      R T  +A
Sbjct: 1  MEKFILVIHALAALVIIGLVLLQQGKGAAMGASFGAGASQTVFGSEGSGNFFTRATWTIA 60

Query: 55 FFFFATSIALGMISRYTS 72
            FF TS  L +I++  S
Sbjct: 61 ALFFCTSFGLAVIAKNNS 78


>gi|294634512|ref|ZP_06713047.1| homoserine dehydrogenase [Edwardsiella tarda ATCC 23685]
 gi|291092026|gb|EFE24587.1| homoserine dehydrogenase [Edwardsiella tarda ATCC 23685]
          Length = 120

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 47/87 (54%), Gaps = 8/87 (9%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
           L+V+ L++ V L+ +I++Q    +    +FG+ ++ T   S+     + R T ILA  FF
Sbjct: 14  LLVIFLLISVALIALIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRTTGILATLFF 73

Query: 59  ATSIALGMISRYTSTR--YKDNMHRSL 83
             S+ LG +S + + +    DN+ + +
Sbjct: 74  VLSLVLGNLSGHQNKQGSEWDNLGQPV 100


>gi|6967095|emb|CAB72478.1| putative protein [Arabidopsis thaliana]
          Length = 485

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%)

Query: 25 SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLV 84
          +D      SS   +VRS   +     A + FFF A SI L  +    STR K N   SL+
Sbjct: 2  TDKEESNHSSEVGAVRSLQETPTWALATVCFFFIAVSICLERLINLLSTRLKKNRKTSLL 61

Query: 85 DSIK 88
          ++++
Sbjct: 62 EAVE 65


>gi|303241633|ref|ZP_07328132.1| preprotein translocase, SecG subunit [Acetivibrio cellulolyticus
          CD2]
 gi|302590853|gb|EFL60602.1| preprotein translocase, SecG subunit [Acetivibrio cellulolyticus
          CD2]
          Length = 78

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 8/72 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAF-----GSSSNF---TSVRSTAHSLGRFTAI 52
          MQI + ++H++  + L+ ++L+QS   +       G +  F      R+    LG++TA+
Sbjct: 1  MQIAVNILHVLFCISLIVIVLLQSGKQAGLSGAIAGGAETFFGKNKGRTIDALLGKWTAV 60

Query: 53 LAFFFFATSIAL 64
           A  F  TSIAL
Sbjct: 61 AAIGFLITSIAL 72


>gi|218779204|ref|YP_002430522.1| preprotein translocase, SecG subunit [Desulfatibacillum
          alkenivorans AK-01]
 gi|218760588|gb|ACL03054.1| preprotein translocase, SecG subunit [Desulfatibacillum
          alkenivorans AK-01]
          Length = 155

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M I + V+H++V + L+ ++L+Q+       +AFG  S+ T   S+  +  L + T + A
Sbjct: 7  MTILVTVIHIVVCIALILIVLLQTGKGADMGAAFGGGSSQTVFGSSGPAGFLSKGTTVAA 66

Query: 55 FFFFATSIALGMISRYTSTR 74
            F  TS+ L + S     R
Sbjct: 67 VLFMCTSLFLAIPSDSAMER 86


>gi|291278563|ref|YP_003495398.1| preprotein translocase subunit G [Deferribacter desulfuricans
          SSM1]
 gi|290753265|dbj|BAI79642.1| preprotein translocase subunit G [Deferribacter desulfuricans
          SSM1]
          Length = 105

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 5/70 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAFGS-----SSNFTSVRSTAHSLGRFTAILAFFFFA 59
          ++ +H+ V + L+  +L+QS   S  GS     SS+     + A+ + + T IL   FF 
Sbjct: 5  IIAIHVFVSILLILAVLLQSGKESDLGSAFGGGSSDSFGPATPANIMNKITTILVIVFFF 64

Query: 60 TSIALGMISR 69
          TSI L ++S+
Sbjct: 65 TSITLTIMSK 74


>gi|91782611|ref|YP_557817.1| preprotein translocase subunit SecG [Burkholderia xenovorans
          LB400]
 gi|91686565|gb|ABE29765.1| protein translocase subunit secG [Burkholderia xenovorans LB400]
          Length = 128

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRY 70
            FF T++ L  +  Y
Sbjct: 64 AVFFITTLTLTYLGAY 79


>gi|33152359|ref|NP_873712.1| preprotein translocase subunit SecG [Haemophilus ducreyi 35000HP]
 gi|33148582|gb|AAP96101.1| preprotein translocase SecG subunit [Haemophilus ducreyi 35000HP]
          Length = 109

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 60/102 (58%), Gaps = 13/102 (12%)

Query: 5   LMVVHLIVVVGLVCVILIQS---SDSSA-FGSSSNFTSVRS--TAHSLGRFTAILAFFFF 58
           L +++LIV + L+  +L+Q    +D+ A FG+ ++ T   S  +A+ L R TA LA  FF
Sbjct: 5   LTIIYLIVAIILIGFVLMQQGKGADTGASFGAGASGTVFGSAGSANFLSRTTAFLATIFF 64

Query: 59  ATSIALGMISRYTS---TRYKD--NMHRSLVDS--IKDQGND 93
           A S+ +G ++ + +   ++++D   + + +  S  +++Q ND
Sbjct: 65  ALSLLIGNLNSHKTGNVSQFEDLSGIQQKVEQSTKVENQNND 106


>gi|242240752|ref|YP_002988933.1| preprotein translocase, SecG subunit [Dickeya dadantii Ech703]
 gi|242132809|gb|ACS87111.1| preprotein translocase, SecG subunit [Dickeya dadantii Ech703]
          Length = 135

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L+V+ L+V + L+ +I++Q    +    +FG+ ++ T   S+     + R TA+LA  FF
Sbjct: 30 LLVIFLLVAISLIGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFF 89

Query: 59 ATSIALGMIS 68
            S+ LG +S
Sbjct: 90 VISLILGNLS 99


>gi|302390380|ref|YP_003826201.1| protein translocase subunit secG [Thermosediminibacter oceani DSM
          16646]
 gi|302201008|gb|ADL08578.1| protein translocase subunit secG [Thermosediminibacter oceani DSM
          16646]
          Length = 78

 Score = 34.7 bits (78), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 6/75 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAF------GSSSNFTSVRSTAHSLGRFTAILA 54
          + I L VV+++V +GL+  +L+QS  S+        G+ + F   +     L + T I A
Sbjct: 4  LHIVLTVVYILVCIGLIATVLLQSGKSAGLSGTIAGGAETFFGKKKGIDDKLAKITEIFA 63

Query: 55 FFFFATSIALGMISR 69
            F A SI + ++ +
Sbjct: 64 VAFLALSILMMIVLK 78


>gi|52424784|ref|YP_087921.1| preprotein translocase subunit SecG [Mannheimia
          succiniciproducens MBEL55E]
 gi|52306836|gb|AAU37336.1| SecG protein [Mannheimia succiniciproducens MBEL55E]
          Length = 113

 Score = 34.7 bits (78), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 25/96 (26%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDS-------------SAFGSSSNFTSVRSTAHSLGRFTA 51
          L++V+L+V + L+  IL+Q                 + FGS+        +A+ L R TA
Sbjct: 5  LLIVYLLVSIALIGFILVQQGKGADAGASFGGGASGTVFGSAG-------SANFLSRTTA 57

Query: 52 ILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSI 87
          ILA  FF  S+ +G I+      +K+N+ +   D +
Sbjct: 58 ILATIFFVISLVIGNIN-----SHKNNVQQGTFDDL 88


>gi|294789673|ref|ZP_06754906.1| homoserine dehydrogenase [Simonsiella muelleri ATCC 29453]
 gi|294482385|gb|EFG30079.1| homoserine dehydrogenase [Simonsiella muelleri ATCC 29453]
          Length = 194

 Score = 34.7 bits (78), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 10/84 (11%)

Query: 1  MQIFLMVVHLI------VVVGLVCVILIQSSDSSA-FGSSSNFTSV---RSTAHSLGRFT 50
          M+ F  V+ +I       V+GLV +   + +D+ A FG S +   V      A+ L R T
Sbjct: 1  MEAFKTVIWIINIFASLAVIGLVLIQHGKGADAGANFGGSGSAQGVFGSGGNANFLTRIT 60

Query: 51 AILAFFFFATSIALGMISRYTSTR 74
           I A  FFA+ +ALG I   ++ +
Sbjct: 61 GIAATIFFASCLALGYIHTKSNNK 84


>gi|254500240|ref|ZP_05112391.1| preprotein translocase SecG subunit, putative [Labrenzia
          alexandrii DFL-11]
 gi|222436311|gb|EEE42990.1| preprotein translocase SecG subunit, putative [Labrenzia
          alexandrii DFL-11]
          Length = 120

 Score = 34.7 bits (78), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 22/31 (70%)

Query: 38 SVRSTAHSLGRFTAILAFFFFATSIALGMIS 68
          S R TA+ L R TAILA  FFATS+ L +I+
Sbjct: 34 SSRGTANVLTRATAILAVAFFATSLTLSLIA 64


>gi|163733287|ref|ZP_02140730.1| preprotein translocase, SecG subunit, putative [Roseobacter
          litoralis Och 149]
 gi|161393075|gb|EDQ17401.1| preprotein translocase, SecG subunit, putative [Roseobacter
          litoralis Och 149]
          Length = 121

 Score = 34.7 bits (78), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 3/67 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAH---SLGRFTAILAFFF 57
          M+  ++++HLI+ +GL+ V+L+Q S+    G         +      +LG+ T  LA  F
Sbjct: 1  MENVVLIIHLILALGLIAVVLLQRSEGGGLGMGGGGGGAMTGRAAATALGKVTWALAIAF 60

Query: 58 FATSIAL 64
            TS+ L
Sbjct: 61 ICTSMTL 67


>gi|270158115|ref|ZP_06186772.1| preprotein translocase SecG subunit [Legionella longbeachae
          D-4968]
 gi|289163620|ref|YP_003453758.1| Protein-export membrane protein secG (Preprotein translocase
          subunit) [Legionella longbeachae NSW150]
 gi|269990140|gb|EEZ96394.1| preprotein translocase SecG subunit [Legionella longbeachae
          D-4968]
 gi|288856793|emb|CBJ10604.1| Protein-export membrane protein secG (Preprotein translocase
          subunit) [Legionella longbeachae NSW150]
          Length = 109

 Score = 34.7 bits (78), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 10/86 (11%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFT--SVRSTAHSLGRFTAILAF 55
          Q+ LM+ H+IV V L+ ++LIQ        +AFGS ++ T    + T   L + T  LA 
Sbjct: 3  QLILMI-HVIVAVVLIGLVLIQHGKGADVGAAFGSGASNTLFGSQGTGGFLFKLTGGLAL 61

Query: 56 FFFATSIALGMISRYTSTRYKDNMHR 81
           FF TS+   ++S   S +Y+    +
Sbjct: 62 TFFVTSL---LLSYLVSIQYQKTEQQ 84


>gi|206560704|ref|YP_002231469.1| preprotein translocase subunit SecG [Burkholderia cenocepacia
          J2315]
 gi|198036746|emb|CAR52646.1| protein-export membrane protein SecG [Burkholderia cenocepacia
          J2315]
          Length = 125

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 6/78 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +    AFGS  S +      +A+ L R T ILA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAT 64

Query: 56 FFFATSIALGMISRYTST 73
           FF  ++AL  +  Y ST
Sbjct: 65 IFFVATLALTYLGSYKST 82


>gi|107023189|ref|YP_621516.1| preprotein translocase subunit SecG [Burkholderia cenocepacia AU
          1054]
 gi|116690271|ref|YP_835894.1| preprotein translocase subunit SecG [Burkholderia cenocepacia
          HI2424]
 gi|105893378|gb|ABF76543.1| protein translocase subunit secG [Burkholderia cenocepacia AU
          1054]
 gi|116648360|gb|ABK09001.1| protein translocase subunit secG [Burkholderia cenocepacia
          HI2424]
          Length = 125

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 6/78 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +    AFGS  S +      +A+ L R T ILA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAT 64

Query: 56 FFFATSIALGMISRYTST 73
           FF  ++AL  +  Y ST
Sbjct: 65 IFFVATLALTYLGSYKST 82


>gi|78067047|ref|YP_369816.1| preprotein translocase subunit SecG [Burkholderia sp. 383]
 gi|77967792|gb|ABB09172.1| protein translocase subunit secG [Burkholderia sp. 383]
          Length = 125

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 6/78 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +    AFGS  S +      +A+ L R T ILA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAT 64

Query: 56 FFFATSIALGMISRYTST 73
           FF  ++AL  +  Y ST
Sbjct: 65 IFFVATLALTYLGSYKST 82


>gi|170733610|ref|YP_001765557.1| preprotein translocase subunit SecG [Burkholderia cenocepacia
          MC0-3]
 gi|169816852|gb|ACA91435.1| preprotein translocase, SecG subunit [Burkholderia cenocepacia
          MC0-3]
          Length = 120

 Score = 34.7 bits (78), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 6/78 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +    AFGS  S +      +A+ L R T ILA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAT 64

Query: 56 FFFATSIALGMISRYTST 73
           FF  ++AL  +  Y ST
Sbjct: 65 IFFVATLALTYLGSYKST 82


>gi|254247656|ref|ZP_04940977.1| Preprotein translocase subunit SecG [Burkholderia cenocepacia
          PC184]
 gi|124872432|gb|EAY64148.1| Preprotein translocase subunit SecG [Burkholderia cenocepacia
          PC184]
          Length = 128

 Score = 34.7 bits (78), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 6/78 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +    AFGS  S +      +A+ L R T ILA 
Sbjct: 8  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAT 67

Query: 56 FFFATSIALGMISRYTST 73
           FF  ++AL  +  Y ST
Sbjct: 68 IFFVATLALTYLGSYKST 85


>gi|325524620|gb|EGD02634.1| preprotein translocase subunit SecG [Burkholderia sp. TJI49]
          Length = 117

 Score = 34.3 bits (77), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 6/78 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLAT 64

Query: 56 FFFATSIALGMISRYTST 73
           FF  ++AL  +  Y ST
Sbjct: 65 IFFVATLALTYLGSYKST 82


>gi|312796903|ref|YP_004029825.1| protein translocase subunit secG [Burkholderia rhizoxinica HKI
          454]
 gi|312168678|emb|CBW75681.1| Protein translocase subunit secG [Burkholderia rhizoxinica HKI
          454]
          Length = 133

 Score = 34.3 bits (77), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 43/76 (56%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV ++  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA+LA
Sbjct: 7  LKTLMIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGASGSANFLSRTTAVLA 66

Query: 55 FFFFATSIALGMISRY 70
            FF +++AL  +  Y
Sbjct: 67 TVFFVSTLALTALGSY 82


>gi|78223156|ref|YP_384903.1| preprotein translocase subunit SecG [Geobacter metallireducens
          GS-15]
 gi|78194411|gb|ABB32178.1| protein translocase subunit secG [Geobacter metallireducens
          GS-15]
          Length = 131

 Score = 34.3 bits (77), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 8/80 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS-------AFGSSSNFTSVRSTAHSLGRFTAIL 53
          M I L ++H++V + L+ ++L+QS   +       A GS S F +   T   L + T   
Sbjct: 1  MTILLTILHILVCIALIAIVLLQSGKGAEMGASFGAGGSQSVFGAGGGTTF-LSKLTTGA 59

Query: 54 AFFFFATSIALGMISRYTST 73
          A  F  TS+ L  +S  + T
Sbjct: 60 AIIFMLTSLTLAYLSGQSET 79


>gi|325117660|emb|CBZ53212.1| conserved hypothetical protein [Neospora caninum Liverpool]
          Length = 5690

 Score = 34.3 bits (77), Expect = 5.4,   Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 49/114 (42%), Gaps = 9/114 (7%)

Query: 16   LVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIAL----GMISRYT 71
            +VC   + S+  S F S     S  S +H++   +++  F     S+AL    G  SR  
Sbjct: 3342 VVCSPAVASAPPSPFASFGRRVSSPSPSHAI---SSVALFEALPPSVALAPRRGDASRGD 3398

Query: 72   S--TRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSSR 123
            S  TR+ D M  S+     D G  + GDG +P++   +    S   A  +   R
Sbjct: 3399 SEQTRHADAMRESVGTCAADTGRPDDGDGRAPQMKGDTQTEDSPDRATSQKGGR 3452


>gi|94309871|ref|YP_583081.1| preprotein translocase subunit SecG [Cupriavidus metallidurans
          CH34]
 gi|93353723|gb|ABF07812.1| preprotein translocase membrane subunit [Cupriavidus
          metallidurans CH34]
          Length = 122

 Score = 34.3 bits (77), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 9/79 (11%)

Query: 1  MQIF---LMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTA 51
          M IF   L++V ++  +G++ ++L+Q    +    AFGS  S +      +A+ L R TA
Sbjct: 1  MAIFKTLLVIVQVLSALGVIGLVLLQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTA 60

Query: 52 ILAFFFFATSIALGMISRY 70
          +LA  FF  ++ L ++  Y
Sbjct: 61 VLAALFFCCTLGLTLLGNY 79


>gi|237751370|ref|ZP_04581850.1| export protein secG [Helicobacter bilis ATCC 43879]
 gi|229372736|gb|EEO23127.1| export protein secG [Helicobacter bilis ATCC 43879]
          Length = 142

 Score = 34.3 bits (77), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 4/78 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG----SSSNFTSVRSTAHSLGRFTAILAFF 56
          M   L+V  +I+ + +V  +L+Q S S   G    S+ +    +  A+ + + T  L   
Sbjct: 1  MTSVLIVFQVILTIAIVIAVLLQKSSSIGLGAYSGSNESLFGAKGPANFMAKITMFLGLL 60

Query: 57 FFATSIALGMISRYTSTR 74
          F   +IALG +    S+R
Sbjct: 61 FIINTIALGYLYNTKSSR 78


>gi|170033256|ref|XP_001844494.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167873901|gb|EDS37284.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 5041

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 35/74 (47%), Gaps = 2/74 (2%)

Query: 53  LAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND-NFGDGSSPKLDSVSAKSS 111
           L+  F +     G  SRY + RY DN  RS   S    GN  +     SP+ D  S  +S
Sbjct: 745 LSVSFGSPRFEAGTGSRYANNRYVDNPGRSRATSFSRPGNPLSLSGAVSPRHDP-SPVAS 803

Query: 112 SSVVAGKRSSSRTK 125
           S   AG  SSSR++
Sbjct: 804 SRGGAGGNSSSRSR 817


>gi|150005145|ref|YP_001299889.1| preprotein translocase subunit SecG [Bacteroides vulgatus ATCC
          8482]
 gi|254883280|ref|ZP_05255990.1| preprotein translocase subunit SecG [Bacteroides sp. 4_3_47FAA]
 gi|294778956|ref|ZP_06744372.1| preprotein translocase, SecG subunit [Bacteroides vulgatus PC510]
 gi|319642655|ref|ZP_07997301.1| hypothetical protein HMPREF9011_02901 [Bacteroides sp. 3_1_40A]
 gi|149933569|gb|ABR40267.1| putative protein-export membrane protein [Bacteroides vulgatus
          ATCC 8482]
 gi|254836073|gb|EET16382.1| preprotein translocase subunit SecG [Bacteroides sp. 4_3_47FAA]
 gi|294447265|gb|EFG15849.1| preprotein translocase, SecG subunit [Bacteroides vulgatus PC510]
 gi|317385743|gb|EFV66676.1| hypothetical protein HMPREF9011_02901 [Bacteroides sp. 3_1_40A]
          Length = 121

 Score = 34.3 bits (77), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 6/66 (9%)

Query: 3  IFLMVVHLIVVVGLV-C-VILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          ++L+++ LIV+  L+ C V+LIQ+S     +S+F SS+    VR T   + + T  LA F
Sbjct: 1  MYLLLIGLIVLAALLMCFVVLIQNSKGGGLASSFASSNQIMGVRKTTDFIEKLTWGLAAF 60

Query: 57 FFATSI 62
            A S+
Sbjct: 61 MVACSV 66


>gi|94968929|ref|YP_590977.1| protein translocase subunit secG [Candidatus Koribacter
          versatilis Ellin345]
 gi|94550979|gb|ABF40903.1| protein translocase subunit secG [Candidatus Koribacter
          versatilis Ellin345]
          Length = 99

 Score = 34.3 bits (77), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 7/78 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDS----SAFGSSSNFTS--VRSTAHSLGRFTAILA 54
          M   +  +H+ V   L+ V+L+QS  S    +AFG S + T+   R TA++L + T   A
Sbjct: 1  MIYLITTIHIAVCFFLIVVVLLQSGKSADLAAAFGGSGSQTAFGPRGTANALSKATTWSA 60

Query: 55 FFFFATSIALG-MISRYT 71
            F  TSI L  M +R+T
Sbjct: 61 VIFMLTSIILSVMAARHT 78


>gi|88860508|ref|ZP_01135146.1| protein-export membrane protein secG (General Secretory Pathway)
          [Pseudoalteromonas tunicata D2]
 gi|88817706|gb|EAR27523.1| protein-export membrane protein secG (General Secretory Pathway)
          [Pseudoalteromonas tunicata D2]
          Length = 118

 Score = 34.3 bits (77), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 6/71 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHS--LGRFTAILA 54
          M   L++V+LIV + L+ ++LIQ        S+FG+ ++ T   S+     + + T  LA
Sbjct: 1  MYEILLIVYLIVALALIGMVLIQQGKGADMGSSFGAGASATVFGSSGAGNFMTKTTTTLA 60

Query: 55 FFFFATSIALG 65
            FF  SI LG
Sbjct: 61 AVFFVLSIVLG 71


>gi|322419406|ref|YP_004198629.1| preprotein translocase subunit SecG [Geobacter sp. M18]
 gi|320125793|gb|ADW13353.1| preprotein translocase, SecG subunit [Geobacter sp. M18]
          Length = 131

 Score = 34.3 bits (77), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 6/74 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLG------RFTAILA 54
          M I L+ +H+IV + L+ V+L+QS   +  G+S   +  +S   + G      + T   A
Sbjct: 1  MTILLVTLHVIVCLALIVVVLLQSGKGAEMGASFGASGSQSVFGAGGGNTFMSKLTTYAA 60

Query: 55 FFFFATSIALGMIS 68
            F  TS++L  +S
Sbjct: 61 IIFMLTSLSLAFVS 74


>gi|224438527|ref|ZP_03659447.1| preprotein translocase subunit SecG [Helicobacter cinaedi CCUG
          18818]
 gi|313144954|ref|ZP_07807147.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
 gi|313129985|gb|EFR47602.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
          Length = 131

 Score = 34.3 bits (77), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 11/92 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG----SSSNFTSVRSTAHSLGRFTAILAFF 56
          M   L VV +++ + +  ++L+Q S S   G    S+ +    +  A  L +FT  L   
Sbjct: 1  MTTTLFVVQIVLAIFITIMVLLQKSSSIGLGAYSGSNESVFGAKGPAGFLAKFTMFLGLL 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
          F   +IAL       S  Y     +S++DS+ 
Sbjct: 61 FVLNTIAL-------SYSYNKQTEKSILDSLP 85


>gi|238757573|ref|ZP_04618758.1| Protein-export membrane protein secG [Yersinia aldovae ATCC
          35236]
 gi|238704335|gb|EEP96867.1| Protein-export membrane protein secG [Yersinia aldovae ATCC
          35236]
          Length = 105

 Score = 34.3 bits (77), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 43/83 (51%), Gaps = 8/83 (9%)

Query: 7  VVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
          ++ L++ +GLV +I++Q    +        G+S+       + + + R TA+LA  FF  
Sbjct: 1  MIFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLATLFFVI 60

Query: 61 SIALGMISRYTSTRYKDNMHRSL 83
          S+ LG +S  T+  +K +   +L
Sbjct: 61 SLILGNMS--TNQGHKGSEWENL 81


>gi|323144912|ref|ZP_08079475.1| preprotein translocase, SecG subunit [Succinatimonas hippei YIT
          12066]
 gi|322415310|gb|EFY06081.1| preprotein translocase, SecG subunit [Succinatimonas hippei YIT
          12066]
          Length = 117

 Score = 34.3 bits (77), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (53%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS-----SN--FTSVRSTAHSLGRFTAIL 53
          M   ++VV L+V V +V +IL+Q    +  G+S     SN  F +V S  + L R T +L
Sbjct: 1  MYEIVIVVFLLVAVAMVALILVQQGKGAGMGASFGAGASNTVFGAVGS-GNFLTRSTWLL 59

Query: 54 AFFFFATSIALGMISR 69
          A  FFA  + +G + +
Sbjct: 60 AIVFFAICLFIGWLQK 75


>gi|85374120|ref|YP_458182.1| hypothetical protein ELI_06465 [Erythrobacter litoralis HTCC2594]
 gi|84787203|gb|ABC63385.1| hypothetical protein ELI_06465 [Erythrobacter litoralis HTCC2594]
          Length = 122

 Score = 34.3 bits (77), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 47/111 (42%), Gaps = 5/111 (4%)

Query: 3   IFLMVVHLIVVVGLVCVILIQ---SSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
           +FL VV  IV   LV V+L+Q          GS S   S R  A  L R T  LA  F  
Sbjct: 5   LFLTVVQAIVAAALVGVVLMQRSEGGGLGIGGSPSGMMSARGAADFLTRTTKWLAVAFVG 64

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
            SIAL  ++    T   D +  +L  ++    +D     + P  D+ S  S
Sbjct: 65  LSIALAAVA--VETTGGDAIESTLDRNVTSTESDPLAAPAVPGDDAPSTPS 113


>gi|18407955|ref|NP_566879.1| MLO3 (MILDEW RESISTANCE LOCUS O 3); calmodulin binding
          [Arabidopsis thaliana]
 gi|33112392|sp|Q94KB9|MLO3_ARATH RecName: Full=MLO-like protein 3; Short=AtMlo3
 gi|14091576|gb|AAK53796.1|AF369564_1 membrane protein Mlo3 [Arabidopsis thaliana]
          Length = 508

 Score = 34.3 bits (77), Expect = 6.5,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 31/64 (48%)

Query: 25 SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLV 84
          +D      SS   +VRS   +     A + FFF A SI L  +    STR K N   SL+
Sbjct: 2  TDKEESNHSSEVGAVRSLQETPTWALATVCFFFIAVSICLERLINLLSTRLKKNRKTSLL 61

Query: 85 DSIK 88
          ++++
Sbjct: 62 EAVE 65


>gi|92117283|ref|YP_577012.1| preprotein translocase subunit SecG [Nitrobacter hamburgensis X14]
 gi|91800177|gb|ABE62552.1| protein translocase subunit secG [Nitrobacter hamburgensis X14]
          Length = 130

 Score = 34.3 bits (77), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 43/88 (48%), Gaps = 9/88 (10%)

Query: 16  LVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTST 73
           L  ++L+Q S+    G      F S R TA+ L R TA LA  FFATS+ L  ++ Y   
Sbjct: 16  LTVIVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTAFLAAGFFATSLFLSWLAGY--- 72

Query: 74  RYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
              D+   S++D      +   G G++P
Sbjct: 73  ---DHKPGSILDGTPASQSQPAG-GATP 96


>gi|224538719|ref|ZP_03679258.1| hypothetical protein BACCELL_03613 [Bacteroides cellulosilyticus
          DSM 14838]
 gi|224519661|gb|EEF88766.1| hypothetical protein BACCELL_03613 [Bacteroides cellulosilyticus
          DSM 14838]
          Length = 125

 Score = 33.9 bits (76), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 4/81 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M +FL+++ ++  + +  ++LIQ+S     +S F SS+    VR T   L + T  LA F
Sbjct: 1  MYLFLVILMVVASLLMCFIVLIQNSKGGGLASGFSSSNQIMGVRKTTDFLEKGTWFLAGF 60

Query: 57 FFATSIALGMISRYTSTRYKD 77
              SIA   +   +S++  D
Sbjct: 61 MVVMSIATAYVVPTSSSKGGD 81


>gi|330994541|ref|ZP_08318465.1| preprotein translocase subunit SecG [Gluconacetobacter sp.
          SXCC-1]
 gi|329758395|gb|EGG74915.1| preprotein translocase subunit SecG [Gluconacetobacter sp.
          SXCC-1]
          Length = 101

 Score = 33.9 bits (76), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 5/74 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS-----SNFTSVRSTAHSLGRFTAILAF 55
          M   L+++HL V + L+  ILIQ S+    G        +F S R TA  L R TA+L  
Sbjct: 1  MITVLLLLHLFVTIALIGTILIQRSEGGGLGIGGSQGMGSFMSGRGTATLLTRSTAVLGT 60

Query: 56 FFFATSIALGMISR 69
           F   S+ L +++R
Sbjct: 61 VFMVLSLTLAVMNR 74


>gi|171316302|ref|ZP_02905523.1| preprotein translocase, SecG subunit [Burkholderia ambifaria
          MEX-5]
 gi|171098528|gb|EDT43329.1| preprotein translocase, SecG subunit [Burkholderia ambifaria
          MEX-5]
          Length = 125

 Score = 33.9 bits (76), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 6/78 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +    AFGS  S +      +A+ L R T +LA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGVLAT 64

Query: 56 FFFATSIALGMISRYTST 73
           FF  ++AL  +  Y ST
Sbjct: 65 IFFVATLALTYLGSYKST 82


>gi|115352339|ref|YP_774178.1| preprotein translocase subunit SecG [Burkholderia ambifaria AMMD]
 gi|170698108|ref|ZP_02889188.1| preprotein translocase, SecG subunit [Burkholderia ambifaria
          IOP40-10]
 gi|172061210|ref|YP_001808862.1| preprotein translocase subunit SecG [Burkholderia ambifaria
          MC40-6]
 gi|115282327|gb|ABI87844.1| protein translocase subunit secG [Burkholderia ambifaria AMMD]
 gi|170136966|gb|EDT05214.1| preprotein translocase, SecG subunit [Burkholderia ambifaria
          IOP40-10]
 gi|171993727|gb|ACB64646.1| preprotein translocase, SecG subunit [Burkholderia ambifaria
          MC40-6]
          Length = 125

 Score = 33.9 bits (76), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 6/78 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGS--SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +    AFGS  S +      +A+ L R T +LA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGVLAT 64

Query: 56 FFFATSIALGMISRYTST 73
           FF  ++AL  +  Y ST
Sbjct: 65 IFFVATLALTYLGSYKST 82


>gi|283955345|ref|ZP_06372844.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
          jejuni 414]
 gi|283793105|gb|EFC31875.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
          jejuni 414]
          Length = 122

 Score = 33.9 bits (76), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 11/96 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG----SSSNFTSVRSTAHSLGRFTAILAFF 56
          M   L+++   +VV +   +L+Q S S   G    S+ +    +  A  L +FT ++   
Sbjct: 1  MITLLIILQFAIVVVICIAVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFVMGIL 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
            A +I LG +       Y      SL + IK + N
Sbjct: 61 LIANTIGLGYL-------YNKASKDSLAEKIKVENN 89


>gi|94987573|ref|YP_595506.1| preprotein translocase subunit SecG [Lawsonia intracellularis
          PHE/MN1-00]
 gi|94731822|emb|CAJ55185.1| Preprotein translocase subunit SecG [Lawsonia intracellularis
          PHE/MN1-00]
          Length = 112

 Score = 33.9 bits (76), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 18/83 (21%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS-----------SDSSAFGSSSNFTSVRSTAHSLGRF 49
          M   ++ +HLIV + LV ++L+QS            ++S FGSS            L + 
Sbjct: 1  MNTLILSLHLIVCILLVIIVLLQSGKEGMGVIFGGGNTSVFGSS-------GAGGLLTKL 53

Query: 50 TAILAFFFFATSIALGMISRYTS 72
          TA LA  F  TS++  +I+   S
Sbjct: 54 TAFLAIIFIITSLSYNIITNTNS 76


>gi|83858358|ref|ZP_00951880.1| hypothetical protein OA2633_02626 [Oceanicaulis alexandrii
          HTCC2633]
 gi|83853181|gb|EAP91033.1| hypothetical protein OA2633_02626 [Oceanicaulis alexandrii
          HTCC2633]
          Length = 138

 Score = 33.9 bits (76), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 4/77 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M   L+++H+++   L  VIL+Q S+        G      S R  A+ L R T IL   
Sbjct: 1  MTAVLLIIHVLIAAALTGVILMQRSEGGALGIGGGGPGGMMSGRGAANLLTRVTMILGAL 60

Query: 57 FFATSIALGMISRYTST 73
          F   SI L +IS  T++
Sbjct: 61 FIGNSILLAIISGVTTS 77


>gi|163737682|ref|ZP_02145099.1| adenylosuccinate synthetase [Phaeobacter gallaeciensis BS107]
 gi|163740734|ref|ZP_02148127.1| preprotein translocase, SecG subunit [Phaeobacter gallaeciensis
          2.10]
 gi|161385725|gb|EDQ10101.1| preprotein translocase, SecG subunit [Phaeobacter gallaeciensis
          2.10]
 gi|161389208|gb|EDQ13560.1| adenylosuccinate synthetase [Phaeobacter gallaeciensis BS107]
          Length = 120

 Score = 33.9 bits (76), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 3/75 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAH---SLGRFTAILAFFF 57
          M+  ++++HL++ +GL+ V+L+Q S+    G         S      ++ + T ILA  F
Sbjct: 1  MENVVLIIHLLLALGLIAVVLLQRSEGGGLGMGGGGGGAMSGRAAATAMSKLTWILAVAF 60

Query: 58 FATSIALGMISRYTS 72
            TSI L +++   S
Sbjct: 61 IGTSITLTILAAQKS 75


>gi|153875561|ref|ZP_02003309.1| preprotein translocase, SecG subunit [Beggiatoa sp. PS]
 gi|152067976|gb|EDN66692.1| preprotein translocase, SecG subunit [Beggiatoa sp. PS]
          Length = 135

 Score = 33.9 bits (76), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 6/66 (9%)

Query: 5  LMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSNFTSVRSTAHS--LGRFTAILAFFFF 58
          L++ H+I+ + L+ +ILIQ    +   +AFGS ++ T   S      L R T +LA  FF
Sbjct: 6  LVIFHVILSLALIGLILIQHGKGADAGAAFGSGASATVFGSQGSGSFLTRTTGVLATLFF 65

Query: 59 ATSIAL 64
           TS+ L
Sbjct: 66 VTSLTL 71


>gi|313683629|ref|YP_004061367.1| preprotein translocase, secg subunit [Sulfuricurvum kujiense DSM
           16994]
 gi|313156489|gb|ADR35167.1| preprotein translocase, SecG subunit [Sulfuricurvum kujiense DSM
           16994]
          Length = 105

 Score = 33.9 bits (76), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 50/107 (46%), Gaps = 16/107 (14%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           L++V +++VV +   +L+Q S S       GS+ +    +     L + T  L F F   
Sbjct: 5   LLIVQIVLVVMITIAVLLQKSSSIGLGAYSGSNESVFGAKGPGSFLAKVTFFLGFVFIVN 64

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
           ++ALG         Y    + S+VD++ ++      D ++P ++ V+
Sbjct: 65  TVALGYF-------YAQQKNESVVDAMVEK-----TDVAAPTINIVN 99


>gi|148361103|ref|YP_001252310.1| preprotein translocase subunit SecG [Legionella pneumophila str.
          Corby]
 gi|296108433|ref|YP_003620134.1| preprotein translocase SecG subunit [Legionella pneumophila
          2300/99 Alcoy]
 gi|148282876|gb|ABQ56964.1| preprotein translocase, SecG subunit [Legionella pneumophila str.
          Corby]
 gi|295650335|gb|ADG26182.1| preprotein translocase SecG subunit [Legionella pneumophila
          2300/99 Alcoy]
          Length = 107

 Score = 33.9 bits (76), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 45/82 (54%), Gaps = 10/82 (12%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFT--SVRSTAHSLGRFTAILAF 55
          Q+ LM+ H+++ V L+ ++LIQ        +AFGS ++ T    + T   L + T  LA 
Sbjct: 3  QLILMI-HVLIAVILIGLVLIQHGKGADIGAAFGSGASNTLFGSQGTGGFLFKLTGGLAM 61

Query: 56 FFFATSIALGMISRYTSTRYKD 77
           FF TS+   M+S   ST+++ 
Sbjct: 62 TFFITSL---MLSYMVSTQHQK 80


>gi|302391121|ref|YP_003826941.1| protein translocase subunit secG [Acetohalobium arabaticum DSM
          5501]
 gi|302203198|gb|ADL11876.1| protein translocase subunit secG [Acetohalobium arabaticum DSM
          5501]
          Length = 99

 Score = 33.9 bits (76), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAF------GSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          L V+HLI+ + L+  +L+QS  S+        G+SS F   R     + + T + A  F 
Sbjct: 31 LKVIHLIISLALIAGVLLQSGKSAGLSGAIDGGASSFFDQGRQAEEKIKKLTTVAAILFM 90

Query: 59 ATSIAL 64
           +S+ L
Sbjct: 91 ISSLVL 96


>gi|53805148|ref|YP_113188.1| preprotein translocase subunit SecG [Methylococcus capsulatus str.
           Bath]
 gi|53758909|gb|AAU93200.1| preprotein translocase, SecG subunit [Methylococcus capsulatus str.
           Bath]
          Length = 117

 Score = 33.9 bits (76), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 52/118 (44%), Gaps = 15/118 (12%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV------RSTAHSLGRFTAILAFFFF 58
           L V H+++ + +V ++L+Q    +  G+     S       R  A  L R TAILA  FF
Sbjct: 5   LTVFHVLLALSIVGLVLLQQGRGADAGAGFGGGSSGSLFGARGAASFLSRTTAILATLFF 64

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
            TS+ L  +S +   +  D M    V +++    D       P +    AKS S V A
Sbjct: 65  GTSLTLAYLSGHVDNKRLDIMD---VPAVQQSQPDM------PAVAPEPAKSGSDVPA 113


>gi|124516458|gb|EAY57966.1| preprotein translocase, SecG subunit [Leptospirillum rubarum]
          Length = 101

 Score = 33.9 bits (76), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
          M   + VVH++  V +V  +L+QS   +  G     SS +    R  +  L + T +LA 
Sbjct: 1  MTTLITVVHVLTCVLIVVAVLLQSGKGAETGVMIGGSSQSLFGARGASSFLSKVTVVLAT 60

Query: 56 FFFATSIALGMI 67
           F  TS++L +I
Sbjct: 61 LFMVTSLSLSLI 72


>gi|302879350|ref|YP_003847914.1| preprotein translocase, SecG subunit [Gallionella
          capsiferriformans ES-2]
 gi|302582139|gb|ADL56150.1| preprotein translocase, SecG subunit [Gallionella
          capsiferriformans ES-2]
          Length = 108

 Score = 33.9 bits (76), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 9/95 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRS--TAHSLGRFTAILA 54
          M+  + V HL+  + L  ++L+Q    +    AFG+ S  +   S  +A+ L R TAI A
Sbjct: 1  METIVWVFHLVTAIALCGLVLVQHGKGADMGAAFGTGSAGSLFGSGGSANFLSRSTAIAA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKD 89
            FF TS+ L  +  +  T+    M R  VD +K 
Sbjct: 61 AIFFVTSLTLTYLYSH-PTQQTGVMDR--VDVVKP 92


>gi|88797620|ref|ZP_01113209.1| preprotein translocase, SecG subunit [Reinekea sp. MED297]
 gi|88779792|gb|EAR10978.1| preprotein translocase, SecG subunit [Reinekea sp. MED297]
          Length = 115

 Score = 33.9 bits (76), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 41/72 (56%), Gaps = 6/72 (8%)

Query: 4  FLMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSNFTSVRSTAHS--LGRFTAILAFFF 57
           ++++H+ + +G+V  +L+Q    +   ++FG  ++ T   S+     L R TAIL   F
Sbjct: 6  LILLIHVALAIGVVVFVLLQRGKGAEAGASFGGGASQTVFGSSGSGNFLTRTTAILVAGF 65

Query: 58 FATSIALGMISR 69
          F TS+AL  +++
Sbjct: 66 FLTSMALAYVAK 77


>gi|254787188|ref|YP_003074617.1| preprotein translocase, SecG subunit [Teredinibacter turnerae
          T7901]
 gi|237685748|gb|ACR13012.1| preprotein translocase, SecG subunit [Teredinibacter turnerae
          T7901]
          Length = 148

 Score = 33.5 bits (75), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 42/80 (52%), Gaps = 6/80 (7%)

Query: 16 LVCVILIQSSDSSAFGSSSNFTSVRSTAHSLG------RFTAILAFFFFATSIALGMISR 69
          ++ +IL+Q    +  G+S    + ++   S+G      R TAI A  FF TS +L ++++
Sbjct: 16 IIGLILMQQGKGAEMGASFGAGASQTLFGSVGSGNFFSRLTAIAATIFFVTSFSLAVVAK 75

Query: 70 YTSTRYKDNMHRSLVDSIKD 89
          + S    D++    ++ ++D
Sbjct: 76 HQSNVGDDDLALPELEQLED 95


>gi|92115192|ref|YP_575120.1| protein translocase subunit secG [Chromohalobacter salexigens DSM
          3043]
 gi|91798282|gb|ABE60421.1| protein translocase subunit secG [Chromohalobacter salexigens DSM
          3043]
          Length = 119

 Score = 33.5 bits (75), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 28/101 (27%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSS-------------DSSAFGS--SSNFTSVRSTAHS 45
          M I +++VH+ + + LV ++L+Q                 + FGS  S NF         
Sbjct: 1  MYIGVLLVHVAIAIALVVLVLLQQGKGAEAGAAFGGGASQTVFGSQGSGNF--------- 51

Query: 46 LGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDS 86
          L + T +LA  FFATS+ L     Y  ++  D     + D+
Sbjct: 52 LAKLTGVLAAVFFATSLGLA----YFVSQAGDAPQEGIPDA 88


>gi|206603299|gb|EDZ39779.1| preprotein translocase, SecG subunit [Leptospirillum sp. Group II
          '5-way CG']
          Length = 101

 Score = 33.5 bits (75), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
          M   + VVH++  V +V  +L+QS   +  G     SS +    R  +  L + T +LA 
Sbjct: 1  MTTLITVVHVLTCVLIVVAVLLQSGKGAETGVMIGGSSQSLFGARGASSFLSKVTVVLAT 60

Query: 56 FFFATSIALGMI 67
           F  TS++L +I
Sbjct: 61 LFMVTSLSLSLI 72


>gi|126664886|ref|ZP_01735870.1| preprotein translocase, SecG subunit [Marinobacter sp. ELB17]
 gi|126631212|gb|EBA01826.1| preprotein translocase, SecG subunit [Marinobacter sp. ELB17]
          Length = 117

 Score = 33.5 bits (75), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 20/82 (24%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS-------------SDSSAFGSSSNFTSVRSTAHSLG 47
          M+  ++V+H+++ V LV ++LIQ              +  + FGS       + +   L 
Sbjct: 4  METLIVVLHVVIAVALVGLVLIQQGKGADAGAAFGGGASQTVFGS-------QGSGSFLT 56

Query: 48 RFTAILAFFFFATSIALGMISR 69
          RFT  LA  FF TS +L + ++
Sbjct: 57 RFTTFLAIAFFVTSFSLAIFAK 78


>gi|297815688|ref|XP_002875727.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297321565|gb|EFH51986.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 504

 Score = 33.5 bits (75), Expect = 9.9,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 38 SVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKD 89
          +VRS   +     A + FFF A SI L  +    STR K+N  +SL++++++
Sbjct: 15 AVRSLQETPTWALATVCFFFIAVSIFLERLINLLSTRLKNNRKKSLLEAVEN 66


Searching..................................................done


Results from round 2




>gi|254780196|ref|YP_003064609.1| hypothetical protein CLIBASIA_00405 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039873|gb|ACT56669.1| hypothetical protein CLIBASIA_00405 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 125

 Score =  144 bits (364), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 125/125 (100%), Positives = 125/125 (100%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT
Sbjct: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120
           SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS
Sbjct: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120

Query: 121 SSRTK 125
           SSRTK
Sbjct: 121 SSRTK 125


>gi|163868050|ref|YP_001609254.1| preprotein translocase subunit SecG [Bartonella tribocorum CIP
           105476]
 gi|161017701|emb|CAK01259.1| preprotein translocase SecG subunit [Bartonella tribocorum CIP
           105476]
          Length = 150

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 44/127 (34%), Positives = 65/127 (51%), Gaps = 5/127 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS--SNFTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV VILIQ S+    G S  S     R + + L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVITLVGVILIQPSEGGGLGVSNSSGLMKTRGSRNPLTRLTAILACCFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
             SIAL ++   +++ + D + R  V+S ++  N N    S P  D  S  S    + G 
Sbjct: 61  VVSIALTVVGSISNSGF-DILKRIPVNSEQNSTNKN--SESVPSSDGESQPSILEQLGGT 117

Query: 119 RSSSRTK 125
               + +
Sbjct: 118 SDFQQER 124


>gi|240850255|ref|YP_002971648.1| preprotein translocase SecG subunit [Bartonella grahamii as4aup]
 gi|240267378|gb|ACS50966.1| preprotein translocase SecG subunit [Bartonella grahamii as4aup]
          Length = 150

 Score =  129 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/127 (35%), Positives = 64/127 (50%), Gaps = 5/127 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS--SNFTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV VILIQ S+    G S  S     R + + L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVITLVGVILIQPSEGGGLGVSNSSGLMKTRGSRNPLTRLTAILACCFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
             SI L ++    S    D + R  V+S ++  N   G  S P  D  S+ S    + G 
Sbjct: 61  VVSIGLTVVGNI-SNSSSDILKRIPVNSEQNSTNK--GSESVPSSDGESSPSILEQLGGN 117

Query: 119 RSSSRTK 125
            +S + +
Sbjct: 118 SNSPQEQ 124


>gi|319408343|emb|CBI81996.1| Protein-export membrane protein [Bartonella schoenbuchensis R1]
          Length = 151

 Score =  122 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 3/127 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+H ++V+ L+ V+LIQ S+    G+SS   F S R T + L R T ILA  FF
Sbjct: 1   MQTVLIVIHFLIVITLIGVVLIQPSEGGGLGTSSGSGFMSARGTKNMLTRLTTILAICFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
             SI L ++    S    D ++R  ++S ++  N N  +   P  +  S  S    + G 
Sbjct: 61  TMSIVLVVVGNI-SNSDSDILNRIPINSEQNPVNKNTTEEGKPSSNQSSKPSILEQLGGA 119

Query: 119 RSSSRTK 125
            + S+ +
Sbjct: 120 STPSQKQ 126


>gi|319407093|emb|CBI80730.1| Preprotein translocase, SecG subunit [Bartonella sp. 1-1C]
          Length = 146

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 67/126 (53%), Gaps = 3/126 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF-TSVRSTAHSLGRFTAILAFFFFA 59
           MQ  L+V+H +VV+ L+ V+L+Q S+   FG   +   S R T ++L R T ILA  FF 
Sbjct: 1   MQTVLIVIHFLVVIALIGVVLLQPSEGGGFGGGGSSFMSARGTKNALTRLTTILAACFFM 60

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
            SI L ++    S    D ++R  V++ ++   +N   GS+P ++  +  S    + G  
Sbjct: 61  ISIGLIVVGNL-SNSGSDILNRIPVNAGQNSTKEN-ASGSTPSVEGEAQPSIIDQLGGGP 118

Query: 120 SSSRTK 125
            SS+ +
Sbjct: 119 ESSQQQ 124


>gi|319404081|emb|CBI77669.1| Preprotein translocase, SecG subunit [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 146

 Score =  115 bits (287), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 3/126 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS-SNFTSVRSTAHSLGRFTAILAFFFFA 59
           MQ  L+V+H +VV+ L+ V+L+Q S+    G   S+F S R    +L R T ILA  FF 
Sbjct: 1   MQTVLIVIHFLVVIALIGVVLLQPSEGGGLGGGGSSFMSTRGAKSALTRLTTILAACFFM 60

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           TSI L +I    S    D ++R  V+S ++   +N   GS+P ++  +  S    +    
Sbjct: 61  TSIGLIVIGNL-SNSSSDILNRIPVNSGQNSTKENE-SGSAPSVEGEAQPSIIDQLGSGP 118

Query: 120 SSSRTK 125
           +SS+ +
Sbjct: 119 ASSQQQ 124


>gi|319898757|ref|YP_004158850.1| Preprotein translocase, SecG subunit [Bartonella clarridgeiae 73]
 gi|319402721|emb|CBI76268.1| Preprotein translocase, SecG subunit [Bartonella clarridgeiae 73]
          Length = 149

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 46/125 (36%), Positives = 65/125 (52%), Gaps = 2/125 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           MQ  L+V+H +VV+ LV V+L+Q S+   FG  S+F S R T  +L R T ILA  FFA 
Sbjct: 1   MQTVLIVIHFLVVIALVGVVLLQPSEGGGFGGGSSFMSTRGTKSALTRLTTILAICFFAI 60

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120
           SI L ++    S    D ++R  V S K+   +N    S P   S    S    + G  +
Sbjct: 61  SIGLIVVGNL-SNSGSDILNRIPVSSGKNSTKEN-ASESMPLSGSEDQPSIIDQLGGVPA 118

Query: 121 SSRTK 125
           SS+ +
Sbjct: 119 SSQQQ 123


>gi|49475362|ref|YP_033403.1| preprotein translocase subunit SecG [Bartonella henselae str.
           Houston-1]
 gi|49238168|emb|CAF27377.1| Protein-export membrane protein [Bartonella henselae str.
           Houston-1]
          Length = 152

 Score =  111 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/127 (33%), Positives = 61/127 (48%), Gaps = 4/127 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+H +VV+ LV VILIQ S+    G SS       R + ++L R TAILA  FF
Sbjct: 1   MQTVLIVIHFLVVITLVGVILIQHSEGGGLGVSSGSGLMKTRGSKNALSRLTAILACCFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           A SI L ++    S    D + R  V S ++  N    +  +P   S +  S    + G 
Sbjct: 61  AVSIGLTVVGSI-SNSSSDILKRIPVHSEQNSTNKGTSE-VAPSSKSEAEPSILEELGGG 118

Query: 119 RSSSRTK 125
               + +
Sbjct: 119 SVPPQEQ 125


>gi|319405523|emb|CBI79142.1| Preprotein translocase, SecG subunit [Bartonella sp. AR 15-3]
          Length = 145

 Score =  110 bits (274), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 42/125 (33%), Positives = 67/125 (53%), Gaps = 2/125 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           MQ  L+V+H +VV+ LV V+L+Q S+   FG SS F + R T  +L R T +LA  FFA 
Sbjct: 1   MQTVLIVIHFLVVIALVGVVLLQPSEGGGFGGSSGFINTRGTKSALTRLTTLLAICFFAI 60

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120
           SI L +I    S    D ++R  ++S ++   +N  + S+P +   +  S    +     
Sbjct: 61  SIGLIVIGNL-SNSGSDILNRIPINSEQNSIKENTSE-STPSVGDEAQPSIIDQLGSIPG 118

Query: 121 SSRTK 125
           SS+ +
Sbjct: 119 SSQQQ 123


>gi|49474121|ref|YP_032163.1| preprotein translocase subunit SecG [Bartonella quintana str.
           Toulouse]
 gi|49239625|emb|CAF25984.1| Protein-export membrane protein [Bartonella quintana str. Toulouse]
          Length = 151

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 39/127 (30%), Positives = 61/127 (48%), Gaps = 4/127 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+H +VV+ LV +ILIQ S+    G SS       R + ++L R TAILA  FF
Sbjct: 1   MQTVLIVIHFLVVIALVGIILIQPSEGGGLGVSSGSGLMRTRGSKNALSRLTAILACCFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
             SI L ++    S    D + R  ++S ++  N +    + P  +     S    + G 
Sbjct: 61  TVSIGLTVVGSI-SNSSSDILKRIPINSEQNSTNKD-ASEAVPSSNGRPHPSILEQLGGV 118

Query: 119 RSSSRTK 125
              S+ +
Sbjct: 119 SVPSQEQ 125


>gi|110633987|ref|YP_674195.1| preprotein translocase subunit SecG [Mesorhizobium sp. BNC1]
 gi|110284971|gb|ABG63030.1| protein translocase subunit secG [Chelativorans sp. BNC1]
          Length = 162

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 63/130 (48%), Gaps = 9/130 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           M   ++V+HL++V+ LV V+L+Q S+    G      F + R  A+ L R TAILA  FF
Sbjct: 1   MHQVILVIHLLIVIALVGVVLMQRSEGGGLGIGGGSGFMTARGAANVLTRTTAILAAAFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN-----DNFGDGSS-PKLDSVSAKSSS 112
            TS+AL + +RY   R  D   R   D  + QG      D  G G++ P      A +S 
Sbjct: 61  ITSLALSLHARY-GERPTDIFDRLPQDQTQPQGAGGGILDQLGGGTTAPAPAEEQAPASE 119

Query: 113 SVVAGKRSSS 122
           +  A     S
Sbjct: 120 TAPAPSEPQS 129


>gi|315122623|ref|YP_004063112.1| hypothetical protein CKC_04375 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496025|gb|ADR52624.1| hypothetical protein CKC_04375 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 126

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 66/109 (60%), Positives = 86/109 (78%), Gaps = 1/109 (0%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           MQIFLM  HLI+V+GLVC ILIQSSDSSAFG+SS+FTSVRS A+SL RFT+ILAF FF+T
Sbjct: 1   MQIFLMTAHLIIVIGLVCTILIQSSDSSAFGTSSSFTSVRSIAYSLARFTSILAFLFFST 60

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
           SIALG+ SRY S + K+++ +SL  +  ++ N N G+ S+P +DS   +
Sbjct: 61  SIALGITSRYHSIKTKEDLRQSLASATNNKINYNSGN-SNPNIDSSVPE 108


>gi|325293009|ref|YP_004278873.1| Protein-export membrane protein secG [Agrobacterium sp. H13-3]
 gi|325060862|gb|ADY64553.1| Protein-export membrane protein secG [Agrobacterium sp. H13-3]
          Length = 157

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/119 (35%), Positives = 62/119 (52%), Gaps = 4/119 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R T ILA  FF
Sbjct: 6   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTGILAALFF 65

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG-NDNFGDGSSPKLDSVSAKSSSSVVA 116
            TS+ LG+++RY S R  D ++R      +  G  D  G   +P   + +     +   
Sbjct: 66  VTSLGLGLLTRYES-RPTDILNRIPATQGQGNGILDTLGPAQTPATPAPAENGVPTNSG 123


>gi|218662639|ref|ZP_03518569.1| preprotein translocase subunit SecG [Rhizobium etli IE4771]
          Length = 176

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 45/116 (38%), Positives = 62/116 (53%), Gaps = 4/116 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG-NDNFGDGSSPKLDSVSAKSSSS 113
            TS+ LG+++RY   R  D + R    S +  G  D+ G   +P          SS
Sbjct: 61  LTSLGLGILTRYEG-RPGDILDRIPATSGQGNGILDSLGGAQAPANQPAGNGVPSS 115


>gi|218462580|ref|ZP_03502671.1| preprotein translocase subunit SecG [Rhizobium etli Kim 5]
          Length = 171

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 45/116 (38%), Positives = 62/116 (53%), Gaps = 4/116 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG-NDNFGDGSSPKLDSVSAKSSSS 113
            TS+ LG+++RY   R  D + R    S +  G  D+ G   +P          SS
Sbjct: 61  LTSLGLGILTRYEG-RPGDILDRIPATSGQGNGILDSLGGAQAPANQPAGNGVPSS 115


>gi|116252258|ref|YP_768096.1| preprotein translocase subunit SecG [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115256906|emb|CAK08000.1| putative secG protein [Rhizobium leguminosarum bv. viciae 3841]
          Length = 173

 Score = 96.4 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 44/116 (37%), Positives = 61/116 (52%), Gaps = 4/116 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG-NDNFGDGSSPKLDSVSAKSSSS 113
            TS+ LG+++RY   R  D + R      +  G  D+ G   +P          SS
Sbjct: 61  LTSLGLGILTRYEG-RPSDILDRIPATGGQGNGILDSLGGAQAPATPPAGNGVPSS 115


>gi|190891863|ref|YP_001978405.1| probable protein-export translocase protein [Rhizobium etli CIAT
           652]
 gi|190697142|gb|ACE91227.1| probable protein-export translocase protein [Rhizobium etli CIAT
           652]
          Length = 174

 Score = 95.6 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 41/112 (36%), Positives = 61/112 (54%), Gaps = 3/112 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
            TS+ LG+++RY   R  D ++R    S +  G  +   G +    +    +
Sbjct: 61  LTSLGLGILTRYEG-RPSDILNRIPATSGQGNGILDSLGGGAQAPANQPVGN 111


>gi|254701879|ref|ZP_05163707.1| preprotein translocase subunit SecG [Brucella suis bv. 5 str. 513]
 gi|261752442|ref|ZP_05996151.1| preprotein translocase subunit SecG [Brucella suis bv. 5 str. 513]
 gi|261742195|gb|EEY30121.1| preprotein translocase subunit SecG [Brucella suis bv. 5 str. 513]
          Length = 148

 Score = 95.2 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 64/124 (51%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R              G  S+P   S +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPA---------TTGSQSAPAGGSTNGGGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|209549427|ref|YP_002281344.1| preprotein translocase subunit SecG [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535183|gb|ACI55118.1| preprotein translocase, SecG subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 179

 Score = 94.1 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 42/112 (37%), Positives = 60/112 (53%), Gaps = 3/112 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
            TS+ LG+++RY   R  D + R      +  G  +   G +    S  A +
Sbjct: 61  ITSLGLGILTRYEG-RPSDILDRIPATGGQGNGILDSLGGGAQAPASQPAGN 111


>gi|254706679|ref|ZP_05168507.1| preprotein translocase subunit SecG [Brucella pinnipedialis
           M163/99/10]
 gi|261314140|ref|ZP_05953337.1| preprotein translocase subunit SecG [Brucella pinnipedialis
           M163/99/10]
 gi|261303166|gb|EEY06663.1| preprotein translocase subunit SecG [Brucella pinnipedialis
           M163/99/10]
          Length = 148

 Score = 94.1 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 64/124 (51%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R              G  S+P   S +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPA---------TTGSQSAPAGGSTNGGGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|86357801|ref|YP_469693.1| preprotein translocase subunit SecG [Rhizobium etli CFN 42]
 gi|86281903|gb|ABC90966.1| protein-export translocase protein [Rhizobium etli CFN 42]
          Length = 162

 Score = 94.1 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 43/112 (38%), Positives = 62/112 (55%), Gaps = 3/112 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
            TS+ LG+++RY   R  D ++R    S +  G  +   G +    S  A +
Sbjct: 61  LTSLGLGILTRYEG-RPSDILNRIPATSGQGNGILDSLGGGAQAPASQPAGN 111


>gi|254719200|ref|ZP_05181011.1| preprotein translocase subunit SecG [Brucella sp. 83/13]
 gi|265984196|ref|ZP_06096931.1| preprotein translocase subunit SecG [Brucella sp. 83/13]
 gi|264662788|gb|EEZ33049.1| preprotein translocase subunit SecG [Brucella sp. 83/13]
          Length = 136

 Score = 94.1 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 64/124 (51%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R              G  S+P   S +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPA---------TTGSQSAPAGGSTNGSGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|306841862|ref|ZP_07474543.1| preprotein translocase, SecG subunit [Brucella sp. BO2]
 gi|306288055|gb|EFM59455.1| preprotein translocase, SecG subunit [Brucella sp. BO2]
          Length = 148

 Score = 93.7 bits (231), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 64/124 (51%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R              G  S+P   S +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPA---------TTGSQSAPAGGSTNGGGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|306844001|ref|ZP_07476596.1| preprotein translocase, SecG subunit [Brucella sp. BO1]
 gi|306275756|gb|EFM57480.1| preprotein translocase, SecG subunit [Brucella sp. BO1]
          Length = 150

 Score = 93.7 bits (231), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 64/124 (51%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R              G  S+P   S +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPA---------TTGSQSAPAGGSTNGGGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|161619089|ref|YP_001592976.1| preprotein translocase subunit SecG [Brucella canis ATCC 23365]
 gi|161335900|gb|ABX62205.1| preprotein translocase, SecG subunit [Brucella canis ATCC 23365]
          Length = 148

 Score = 93.3 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/124 (34%), Positives = 63/124 (50%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R              G  S+P     +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPA---------TTGSQSAPAGGRTNGGGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|241204752|ref|YP_002975848.1| preprotein translocase subunit SecG [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858642|gb|ACS56309.1| preprotein translocase, SecG subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 177

 Score = 92.9 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/117 (36%), Positives = 60/117 (51%), Gaps = 5/117 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG--NDNFGDGSSPKLDSVSAKSSSS 113
            TS+ LG+++RY   R  D + R      +  G  +   G   +P          SS
Sbjct: 61  LTSLGLGILTRYEG-RPSDILDRIPATGGQGNGILDSLGGGAQAPATQPAGNGVPSS 116


>gi|159184841|ref|NP_354613.2| preprotein translocase subunit SecG [Agrobacterium tumefaciens
          str. C58]
 gi|159140125|gb|AAK87398.2| protein-export membrane protein SECG [Agrobacterium tumefaciens
          str. C58]
          Length = 157

 Score = 92.9 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 39/93 (41%), Positives = 55/93 (59%), Gaps = 3/93 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R T ILA  FF
Sbjct: 1  MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTGILAALFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG 91
           TS+ LG+++RY S R  D ++R      +  G
Sbjct: 61 LTSLGLGLMTRYES-RPTDILNRIPATQGQGNG 92


>gi|294852477|ref|ZP_06793150.1| preprotein translocase [Brucella sp. NVSL 07-0026]
 gi|294821066|gb|EFG38065.1| preprotein translocase [Brucella sp. NVSL 07-0026]
          Length = 148

 Score = 92.5 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 64/124 (51%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R              G  S+P   S +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPA---------TTGSQSAPAGGSTNGGGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|62290050|ref|YP_221843.1| preprotein translocase subunit SecG [Brucella abortus bv. 1 str.
           9-941]
 gi|82699977|ref|YP_414551.1| preprotein translocase subunit SecG [Brucella melitensis biovar
           Abortus 2308]
 gi|148559914|ref|YP_001259058.1| preprotein translocase subunit SecG [Brucella ovis ATCC 25840]
 gi|161511144|ref|NP_539764.2| preprotein translocase subunit SecG [Brucella melitensis bv. 1 str.
           16M]
 gi|163843402|ref|YP_001627806.1| preprotein translocase subunit SecG [Brucella suis ATCC 23445]
 gi|189024290|ref|YP_001935058.1| Preprotein translocase SecG subunit [Brucella abortus S19]
 gi|225627606|ref|ZP_03785643.1| preprotein translocase, SecG subunit [Brucella ceti str. Cudo]
 gi|225852636|ref|YP_002732869.1| preprotein translocase subunit SecG [Brucella melitensis ATCC
           23457]
 gi|237815559|ref|ZP_04594556.1| preprotein translocase, SecG subunit [Brucella abortus str. 2308 A]
 gi|254689362|ref|ZP_05152616.1| preprotein translocase subunit SecG [Brucella abortus bv. 6 str.
           870]
 gi|254693846|ref|ZP_05155674.1| preprotein translocase subunit SecG [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697495|ref|ZP_05159323.1| preprotein translocase subunit SecG [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254704425|ref|ZP_05166253.1| preprotein translocase subunit SecG [Brucella suis bv. 3 str. 686]
 gi|254710213|ref|ZP_05172024.1| preprotein translocase subunit SecG [Brucella pinnipedialis B2/94]
 gi|254714210|ref|ZP_05176021.1| preprotein translocase subunit SecG [Brucella ceti M644/93/1]
 gi|254717646|ref|ZP_05179457.1| preprotein translocase subunit SecG [Brucella ceti M13/05/1]
 gi|254730392|ref|ZP_05188970.1| preprotein translocase subunit SecG [Brucella abortus bv. 4 str.
           292]
 gi|256031707|ref|ZP_05445321.1| preprotein translocase subunit SecG [Brucella pinnipedialis
           M292/94/1]
 gi|256044793|ref|ZP_05447697.1| preprotein translocase subunit SecG [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256061220|ref|ZP_05451371.1| preprotein translocase subunit SecG [Brucella neotomae 5K33]
 gi|256113699|ref|ZP_05454503.1| preprotein translocase subunit SecG [Brucella melitensis bv. 3 str.
           Ether]
 gi|256159866|ref|ZP_05457595.1| preprotein translocase subunit SecG [Brucella ceti M490/95/1]
 gi|256255108|ref|ZP_05460644.1| preprotein translocase subunit SecG [Brucella ceti B1/94]
 gi|256257608|ref|ZP_05463144.1| preprotein translocase subunit SecG [Brucella abortus bv. 9 str.
           C68]
 gi|256263871|ref|ZP_05466403.1| preprotein translocase SecG subunit [Brucella melitensis bv. 2 str.
           63/9]
 gi|256369563|ref|YP_003107073.1| protein-export membrane protein [Brucella microti CCM 4915]
 gi|260168839|ref|ZP_05755650.1| preprotein translocase subunit SecG [Brucella sp. F5/99]
 gi|260546602|ref|ZP_05822341.1| preprotein translocase SecG subunit [Brucella abortus NCTC 8038]
 gi|260565604|ref|ZP_05836088.1| preprotein translocase SecG subunit [Brucella melitensis bv. 1 str.
           16M]
 gi|260566328|ref|ZP_05836798.1| preprotein translocase SecG subunit [Brucella suis bv. 4 str. 40]
 gi|260754879|ref|ZP_05867227.1| preprotein translocase subunit SecG [Brucella abortus bv. 6 str.
           870]
 gi|260758096|ref|ZP_05870444.1| preprotein translocase subunit SecG [Brucella abortus bv. 4 str.
           292]
 gi|260761920|ref|ZP_05874263.1| preprotein translocase subunit SecG [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883891|ref|ZP_05895505.1| preprotein translocase subunit SecG [Brucella abortus bv. 9 str.
           C68]
 gi|261214131|ref|ZP_05928412.1| preprotein translocase subunit SecG [Brucella abortus bv. 3 str.
           Tulya]
 gi|261219485|ref|ZP_05933766.1| preprotein translocase subunit SecG [Brucella ceti M13/05/1]
 gi|261222303|ref|ZP_05936584.1| preprotein translocase subunit SecG [Brucella ceti B1/94]
 gi|261317771|ref|ZP_05956968.1| preprotein translocase subunit SecG [Brucella pinnipedialis B2/94]
 gi|261321980|ref|ZP_05961177.1| preprotein translocase subunit SecG [Brucella ceti M644/93/1]
 gi|261325227|ref|ZP_05964424.1| preprotein translocase subunit SecG [Brucella neotomae 5K33]
 gi|261755102|ref|ZP_05998811.1| preprotein translocase subunit SecG [Brucella suis bv. 3 str. 686]
 gi|261758327|ref|ZP_06002036.1| preprotein translocase SecG subunit [Brucella sp. F5/99]
 gi|265988802|ref|ZP_06101359.1| preprotein translocase subunit SecG [Brucella pinnipedialis
           M292/94/1]
 gi|265991217|ref|ZP_06103774.1| preprotein translocase subunit SecG [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995053|ref|ZP_06107610.1| preprotein translocase subunit SecG [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998267|ref|ZP_06110824.1| preprotein translocase subunit SecG [Brucella ceti M490/95/1]
 gi|297248450|ref|ZP_06932168.1| protein-export membrane protein [Brucella abortus bv. 5 str. B3196]
 gi|62196182|gb|AAX74482.1| preprotein translocase, SecG subunit, hypothetical [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616078|emb|CAJ11116.1| Preprotein translocase SecG subunit [Brucella melitensis biovar
           Abortus 2308]
 gi|148371171|gb|ABQ61150.1| protein-export membrane protein [Brucella ovis ATCC 25840]
 gi|163674125|gb|ABY38236.1| preprotein translocase, SecG subunit [Brucella suis ATCC 23445]
 gi|189019862|gb|ACD72584.1| Preprotein translocase SecG subunit [Brucella abortus S19]
 gi|225617611|gb|EEH14656.1| preprotein translocase, SecG subunit [Brucella ceti str. Cudo]
 gi|225641001|gb|ACO00915.1| preprotein translocase, SecG subunit [Brucella melitensis ATCC
           23457]
 gi|237788857|gb|EEP63068.1| preprotein translocase, SecG subunit [Brucella abortus str. 2308 A]
 gi|255999725|gb|ACU48124.1| protein-export membrane protein [Brucella microti CCM 4915]
 gi|260095652|gb|EEW79529.1| preprotein translocase SecG subunit [Brucella abortus NCTC 8038]
 gi|260151672|gb|EEW86766.1| preprotein translocase SecG subunit [Brucella melitensis bv. 1 str.
           16M]
 gi|260155846|gb|EEW90926.1| preprotein translocase SecG subunit [Brucella suis bv. 4 str. 40]
 gi|260668414|gb|EEX55354.1| preprotein translocase subunit SecG [Brucella abortus bv. 4 str.
           292]
 gi|260672352|gb|EEX59173.1| preprotein translocase subunit SecG [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674987|gb|EEX61808.1| preprotein translocase subunit SecG [Brucella abortus bv. 6 str.
           870]
 gi|260873419|gb|EEX80488.1| preprotein translocase subunit SecG [Brucella abortus bv. 9 str.
           C68]
 gi|260915738|gb|EEX82599.1| preprotein translocase subunit SecG [Brucella abortus bv. 3 str.
           Tulya]
 gi|260920887|gb|EEX87540.1| preprotein translocase subunit SecG [Brucella ceti B1/94]
 gi|260924574|gb|EEX91142.1| preprotein translocase subunit SecG [Brucella ceti M13/05/1]
 gi|261294670|gb|EEX98166.1| preprotein translocase subunit SecG [Brucella ceti M644/93/1]
 gi|261296994|gb|EEY00491.1| preprotein translocase subunit SecG [Brucella pinnipedialis B2/94]
 gi|261301207|gb|EEY04704.1| preprotein translocase subunit SecG [Brucella neotomae 5K33]
 gi|261738311|gb|EEY26307.1| preprotein translocase SecG subunit [Brucella sp. F5/99]
 gi|261744855|gb|EEY32781.1| preprotein translocase subunit SecG [Brucella suis bv. 3 str. 686]
 gi|262552735|gb|EEZ08725.1| preprotein translocase subunit SecG [Brucella ceti M490/95/1]
 gi|262766166|gb|EEZ11955.1| preprotein translocase subunit SecG [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002001|gb|EEZ14576.1| preprotein translocase subunit SecG [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094002|gb|EEZ17936.1| preprotein translocase SecG subunit [Brucella melitensis bv. 2 str.
           63/9]
 gi|264660999|gb|EEZ31260.1| preprotein translocase subunit SecG [Brucella pinnipedialis
           M292/94/1]
 gi|297175619|gb|EFH34966.1| protein-export membrane protein [Brucella abortus bv. 5 str. B3196]
 gi|326409155|gb|ADZ66220.1| Preprotein translocase SecG subunit [Brucella melitensis M28]
 gi|326538865|gb|ADZ87080.1| preprotein translocase, SecG subunit [Brucella melitensis M5-90]
          Length = 148

 Score = 92.5 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 64/124 (51%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R              G  S+P   S +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPA---------TTGSQSAPAGGSTNGGGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|121602235|ref|YP_988844.1| preprotein translocase subunit SecG [Bartonella bacilliformis
           KC583]
 gi|120614412|gb|ABM45013.1| preprotein translocase, SecG subunit [Bartonella bacilliformis
           KC583]
          Length = 149

 Score = 91.8 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 45/127 (35%), Positives = 68/127 (53%), Gaps = 4/127 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+H ++V+ LV V+LIQ S+    G      F S R T ++L R TAILA  FF
Sbjct: 1   MQTVLIVIHFLIVIVLVGVVLIQPSEGGGLGVGGGSGFMSTRGTRNTLTRLTAILAICFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
            TSIAL ++    S    D ++R  V+S ++  N N  +G  P   + +  S    + G 
Sbjct: 61  VTSIALIVVGSI-SNSNLDILNRIPVNSEQNSINKNASEG-VPSPGNGTQPSILEQLGGA 118

Query: 119 RSSSRTK 125
            +SS+ +
Sbjct: 119 STSSQEQ 125


>gi|153009382|ref|YP_001370597.1| preprotein translocase subunit SecG [Ochrobactrum anthropi ATCC
           49188]
 gi|151561270|gb|ABS14768.1| preprotein translocase, SecG subunit [Ochrobactrum anthropi ATCC
           49188]
          Length = 153

 Score = 91.4 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 14/124 (11%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  ++V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVIIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   +  D ++R                GS       +     + + G+
Sbjct: 61  ATSLILGIMARY-GEKPTDILNRIP-----------AATGSQSAPAGGNGGGILNQLGGE 108

Query: 119 RSSS 122
            S  
Sbjct: 109 SSRP 112


>gi|23502015|ref|NP_698142.1| preprotein translocase subunit SecG [Brucella suis 1330]
 gi|23347967|gb|AAN30057.1| preprotein translocase, SecG subunit, putative [Brucella suis 1330]
          Length = 148

 Score = 91.0 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 43/124 (34%), Positives = 63/124 (50%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R   ++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGATNALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R              G  S+P   S +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPA---------TTGSQSAPAGGSTNGGGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|239832025|ref|ZP_04680354.1| preprotein translocase, SecG subunit [Ochrobactrum intermedium LMG
           3301]
 gi|239824292|gb|EEQ95860.1| preprotein translocase, SecG subunit [Ochrobactrum intermedium LMG
           3301]
          Length = 153

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 40/124 (32%), Positives = 61/124 (49%), Gaps = 14/124 (11%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   +  D ++R                GS       +     + + G+
Sbjct: 61  ATSLILGIMARY-GEKPTDILNRIP-----------AATGSQTTPAGGNGGGILNQLGGE 108

Query: 119 RSSS 122
            S  
Sbjct: 109 SSRP 112


>gi|146341033|ref|YP_001206081.1| preprotein translocase subunit SecG [Bradyrhizobium sp. ORS278]
 gi|146193839|emb|CAL77856.1| putative Protein-export membrane protein, secG-like [Bradyrhizobium
           sp. ORS278]
          Length = 127

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V  L+  +L+Q S+    G      F S R TA+ L R TA+LA  FF
Sbjct: 1   MQTVLIVIHLMIVAVLIGAVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTAVLAVGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
            TS+ L  ++ Y   R   ++  ++    +  G      GS   LD +   
Sbjct: 61  VTSLLLTWLAGY--DRKPSSILGNMPGQTQSGGATPVAPGSGGVLDQLKKA 109


>gi|240141512|ref|YP_002965992.1| putative secG: preprotein translocase [Methylobacterium extorquens
           AM1]
 gi|240011489|gb|ACS42715.1| putative secG: preprotein translocase [Methylobacterium extorquens
           AM1]
          Length = 155

 Score = 89.1 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/126 (28%), Positives = 54/126 (42%), Gaps = 6/126 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           MQ  L+VVHLI+V+ L+ V+L+Q S+             S F + R  A++L R TAILA
Sbjct: 1   MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGGGGGGGVSGFMTGRGQANALTRATAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TSIAL +++  T+                 Q +      +        + S    
Sbjct: 61  ALFFTTSIALAILAHRTAAPRSILDEAGTPQGQTQQTDKPVNADNLLDTLRSGSPSQGGQ 120

Query: 115 VAGKRS 120
            A   +
Sbjct: 121 PASVPT 126


>gi|115524601|ref|YP_781512.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
           BisA53]
 gi|115518548|gb|ABJ06532.1| protein translocase subunit secG [Rhodopseudomonas palustris
           BisA53]
          Length = 130

 Score = 88.7 bits (218), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/131 (24%), Positives = 54/131 (41%), Gaps = 7/131 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
           MQ  ++V+HL++V  L+ ++L+Q S+  A G          F S R TA+ L R T  LA
Sbjct: 1   MQTVIIVIHLMIVATLIALVLLQKSEGGALGVGGGGGGGGGFMSSRGTANLLTRSTGFLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ L  ++ Y   +    + +      +              LDS+  +     
Sbjct: 61  AGFFVTSLTLSWLASYD-RKPASVIDQFPASQTQPGTPTPPVSEGGGLLDSLKQQDQQQS 119

Query: 115 VAGKRSSSRTK 125
                   R++
Sbjct: 120 QPAVPQPPRSQ 130


>gi|163854058|ref|YP_001642101.1| preprotein translocase, SecG subunit [Methylobacterium extorquens
           PA1]
 gi|218533001|ref|YP_002423817.1| preprotein translocase, SecG subunit [Methylobacterium
           chloromethanicum CM4]
 gi|254564026|ref|YP_003071121.1| secG: preprotein translocase [Methylobacterium extorquens DM4]
 gi|163665663|gb|ABY33030.1| preprotein translocase, SecG subunit [Methylobacterium extorquens
           PA1]
 gi|218525304|gb|ACK85889.1| preprotein translocase, SecG subunit [Methylobacterium
           chloromethanicum CM4]
 gi|254271304|emb|CAX27316.1| putative secG: preprotein translocase [Methylobacterium extorquens
           DM4]
          Length = 155

 Score = 88.3 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 54/126 (42%), Gaps = 6/126 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           MQ  L+VVHLI+V+ L+ V+L+Q S+             S F + R  A++L R TAILA
Sbjct: 1   MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGGGGGGGVSGFMTGRGQANALTRATAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TSIAL +++  ++                 Q +      +        + S    
Sbjct: 61  ALFFTTSIALAILAHRSAAPRSILDEAGTPQGQTQQTDKPVNADNLLDTLRSGSPSQGGQ 120

Query: 115 VAGKRS 120
            A   +
Sbjct: 121 PASVPT 126


>gi|323138444|ref|ZP_08073513.1| preprotein translocase, SecG subunit [Methylocystis sp. ATCC 49242]
 gi|322396240|gb|EFX98772.1| preprotein translocase, SecG subunit [Methylocystis sp. ATCC 49242]
          Length = 255

 Score = 88.3 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 57/131 (43%), Gaps = 7/131 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-FTSVRSTAHSLGRFTAILAFFFFA 59
           MQ  ++ +HL+VV  LV ++L Q S+  A G   +   + R  A++L R T ILA  FF 
Sbjct: 1   MQQVIIAIHLMVVTALVILVLYQKSEGGALGMGGSGVFTGRGQANALTRATGILATIFFI 60

Query: 60  TSIALGMISRYT--STRYKDNMHRSLVDSIKDQGNDNFGDGSSP----KLDSVSAKSSSS 113
           TSIAL ++  +   +    D       DSIK +       G+ P     +      S   
Sbjct: 61  TSIALTVLPAWERRAAGGDDWTKAIDQDSIKFKELKPEDKGAKPGEAAPVPEAGKDSIFE 120

Query: 114 VVAGKRSSSRT 124
            +   +   + 
Sbjct: 121 QLQRAQQKRQQ 131


>gi|316933954|ref|YP_004108936.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
           DX-1]
 gi|315601668|gb|ADU44203.1| preprotein translocase, SecG subunit [Rhodopseudomonas palustris
           DX-1]
          Length = 135

 Score = 87.5 bits (215), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 52/119 (43%), Gaps = 14/119 (11%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           MQ  ++V+HL++V+GL+ V+L+Q S+    G        F S R TA+ L R TAILA  
Sbjct: 1   MQTVIIVIHLMLVLGLIGVVLLQKSEGGGLGVGGGGGGGFMSSRGTANLLTRTTAILAVG 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
           FF TS+ L  ++ Y + +    +  + +                P             +
Sbjct: 61  FFITSLLLTWLASY-NRKPTTILPTAPIQQQVP---------GQPAPPVSQGGGLLDTL 109


>gi|218513883|ref|ZP_03510723.1| preprotein translocase subunit SecG [Rhizobium etli 8C-3]
          Length = 99

 Score = 87.5 bits (215), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 38/98 (38%), Positives = 57/98 (58%), Gaps = 3/98 (3%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFFATSI 62
           ++V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF TS+
Sbjct: 1   MIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFFLTSL 60

Query: 63  ALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
            LG+++RY   R  D ++R    S +  G  +   G +
Sbjct: 61  GLGILTRYEG-RPSDILNRIPATSGQGNGILDSLGGGA 97


>gi|148255834|ref|YP_001240419.1| preprotein translocase subunit SecG [Bradyrhizobium sp. BTAi1]
 gi|146408007|gb|ABQ36513.1| protein translocase subunit secG [Bradyrhizobium sp. BTAi1]
          Length = 127

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 31/111 (27%), Positives = 48/111 (43%), Gaps = 4/111 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ   +V+HL++V  L+  +L+Q S+    G      F S R TA+ L R TA+LA  FF
Sbjct: 1   MQTVFIVIHLMIVAVLIGAVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTAVLAVGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
            TS+ L  ++ Y         +  +    +  G           LD +   
Sbjct: 61  VTSLLLTWLAGYDRKPTSILGN--VPGQTQSGGATPVAPTGGGVLDQLKKA 109


>gi|170749511|ref|YP_001755771.1| preprotein translocase, SecG subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656033|gb|ACB25088.1| preprotein translocase, SecG subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 140

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 50/103 (48%), Gaps = 6/103 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHSLGRFTAILA 54
           MQ  L+VVHLI+V+ L+ V+L+Q S+          G    F + R  A++L R TAILA
Sbjct: 1   MQTVLIVVHLIIVLALIGVVLLQRSEGGLGLGGGGGGGVGGFMTGRGQANALTRATAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGD 97
             FF TS+ L ++S  ++         +   S +        D
Sbjct: 61  ALFFTTSMVLAILSHRSAAPKSILDTGAPQTSGQPAKQPTGAD 103


>gi|163760081|ref|ZP_02167164.1| protein-export membrane protein [Hoeflea phototrophica DFL-43]
 gi|162282480|gb|EDQ32768.1| protein-export membrane protein [Hoeflea phototrophica DFL-43]
          Length = 129

 Score = 86.0 bits (211), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 63/124 (50%), Gaps = 3/124 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV ++L+Q S+    G      F S R  A++L R T ILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGIVLVQRSEGGGLGIGGGSGFMSARGAANALTRTTGILAAAFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
            TS+ALG+++RY      D + +  V +           G +P   + +  ++  + A  
Sbjct: 61  VTSLALGILARY-GDSPTDIIDQISVPTQGTGSGVLDQLGGAPTPAAPAQGAAGDIPAAP 119

Query: 119 RSSS 122
            + S
Sbjct: 120 AAPS 123


>gi|27379917|ref|NP_771446.1| preprotein translocase subunit SecG [Bradyrhizobium japonicum USDA
           110]
 gi|27353070|dbj|BAC50071.1| protein-export membrane protein [Bradyrhizobium japonicum USDA 110]
          Length = 129

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/126 (26%), Positives = 53/126 (42%), Gaps = 4/126 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  ++V+HL++V  ++  +L+Q S+    G      F S R TA+ L R TAILA  FF
Sbjct: 1   MQTVVIVIHLMIVAVMIGAVLLQKSEGGGLGMGGGAGFMSSRGTANLLSRTTAILAAGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
            TS+ L   + Y   R   ++        +  G       +S  +     K+     A  
Sbjct: 61  VTSLFLSWYAGY--NRAPSSIIGQPASQGQPAGGSPIAPPTSGGILDSLKKADEQQQAPA 118

Query: 119 RSSSRT 124
             S   
Sbjct: 119 APSGPQ 124


>gi|192291604|ref|YP_001992209.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
          TIE-1]
 gi|192285353|gb|ACF01734.1| preprotein translocase, SecG subunit [Rhodopseudomonas palustris
          TIE-1]
          Length = 134

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 47/91 (51%), Gaps = 2/91 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  ++V+HL+ V+GL+ V+L+Q S+    G      F S R TA+ L R TAILA  FF
Sbjct: 1  MQTVIIVIHLMFVLGLIGVVLLQKSEGGGLGVGGGGGFMSSRGTANLLTRTTAILAAGFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKD 89
          ATS+ L  ++ Y           + V     
Sbjct: 61 ATSLLLTWLASYDRKPATILPTAAPVQQQAP 91


>gi|39935952|ref|NP_948228.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
          CGA009]
 gi|39649806|emb|CAE28328.1| possible secG: preprotein translocase [Rhodopseudomonas palustris
          CGA009]
          Length = 134

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 47/91 (51%), Gaps = 2/91 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  ++V+HL+ V+GL+ V+L+Q S+    G      F S R TA+ L R TAILA  FF
Sbjct: 1  MQTVIIVIHLMFVLGLIGVVLLQKSEGGGLGVGGGGGFMSSRGTANLLTRTTAILAAGFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKD 89
          ATS+ L  ++ Y           + V     
Sbjct: 61 ATSLLLTWLASYDRKPATILPTAAPVQQQVP 91


>gi|91977295|ref|YP_569954.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
           BisB5]
 gi|91683751|gb|ABE40053.1| protein translocase subunit secG [Rhodopseudomonas palustris BisB5]
          Length = 128

 Score = 84.8 bits (208), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 53/126 (42%), Gaps = 6/126 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           MQ  ++V+HL++V+GL+  +L+Q S+    G        F S R TA+ L R TAILA  
Sbjct: 1   MQTVIIVIHLMLVLGLIGSVLLQKSEGGGLGVGGGGGGGFMSSRGTANLLTRTTAILAAG 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           FF TS+ L  ++ Y   R    +  S+                   LD++          
Sbjct: 61  FFVTSLLLSWLATY--NRKPTMLPTSVPTQQSPATPVPPVSQGGGLLDTLKQTDQQQNQQ 118

Query: 117 GKRSSS 122
               S 
Sbjct: 119 PAAPSP 124


>gi|254448886|ref|ZP_05062342.1| preprotein translocase, SecG subunit [gamma proteobacterium
           HTCC5015]
 gi|198261576|gb|EDY85865.1| preprotein translocase, SecG subunit [gamma proteobacterium
           HTCC5015]
          Length = 124

 Score = 83.7 bits (205), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 60/121 (49%), Gaps = 9/121 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M+  L+VVH+++ +GL+ +ILIQ    +    AFGS ++ T          + + T  +A
Sbjct: 1   METALLVVHVLLSIGLIALILIQHGKGADAGAAFGSGASGTVFGASGAGSFMTKLTTWIA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FFATS+AL   +  TS+     + R++    ++Q  +   + S+  +    A S S V
Sbjct: 61  VSFFATSLALAYTAANTSSEPTSVIERTMQ---QEQSGEEAAEQSTGDVPVAPASSDSDV 117

Query: 115 V 115
            
Sbjct: 118 P 118


>gi|90423972|ref|YP_532342.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
           BisB18]
 gi|90105986|gb|ABD88023.1| protein translocase subunit secG [Rhodopseudomonas palustris
           BisB18]
          Length = 128

 Score = 83.7 bits (205), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 32/131 (24%), Positives = 51/131 (38%), Gaps = 9/131 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
           MQ  ++V+HL++V  L+  +L+Q S+  A G          F S R TA+ L R TA+LA
Sbjct: 1   MQTVIIVLHLMIVATLIATVLLQKSEGGALGMGGGGGGGGGFMSSRGTANLLTRTTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ L  I+ Y           +         +     G          +  +  
Sbjct: 61  VGFFITSLLLSWIASYDRKPTTVIDTPATQSQPAPPVSQ---GGGVLDTLKQQDQRDNQQ 117

Query: 115 VAGKRSSSRTK 125
                   R++
Sbjct: 118 APSAPQPPRSQ 128


>gi|188584387|ref|YP_001927832.1| preprotein translocase, SecG subunit [Methylobacterium populi
           BJ001]
 gi|179347885|gb|ACB83297.1| preprotein translocase, SecG subunit [Methylobacterium populi
           BJ001]
          Length = 156

 Score = 83.7 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 7/127 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           MQ  L+VVHLI+V+ L+ V+L+Q S+               F + R  A++L R TAILA
Sbjct: 1   MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGGGGSGGVSGFMTGRGQANALTRATAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TSIAL +++ + S   +  +  +     + Q        +             + 
Sbjct: 61  ALFFTTSIALAILA-HRSAAPRSILDEAGTPQGQTQTQKPVNADNLLDTLRSGGAGQGAP 119

Query: 115 VAGKRSS 121
             G+ +S
Sbjct: 120 SGGQPAS 126


>gi|86749908|ref|YP_486404.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
           HaA2]
 gi|86572936|gb|ABD07493.1| protein translocase subunit secG [Rhodopseudomonas palustris HaA2]
          Length = 130

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/113 (28%), Positives = 48/113 (42%), Gaps = 4/113 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           MQ  ++V+HL++V+GL+  +L+Q S+    G        F S R TA+ L R TA LA  
Sbjct: 1   MQTVIIVIHLMLVLGLIATVLLQKSEGGGLGVGGGGGGGFMSSRGTANLLTRTTAFLAVG 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
           FF TS+ L  ++ Y           +                    LDS+   
Sbjct: 61  FFITSLLLSWLATYNRKPTTILPTAAPTTQQAPGVPAPPVSQGGGLLDSLKQA 113


>gi|220925412|ref|YP_002500714.1| preprotein translocase subunit SecG [Methylobacterium nodulans
          ORS 2060]
 gi|219950019|gb|ACL60411.1| preprotein translocase, SecG subunit [Methylobacterium nodulans
          ORS 2060]
          Length = 135

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 47/81 (58%), Gaps = 5/81 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS-----SSNFTSVRSTAHSLGRFTAILAF 55
          MQ  L+VVHLI+V+ L+ V+L+Q S+           +  F + R  A++L R TAILA 
Sbjct: 1  MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGGGSSGTQGFLTGRGQANALTRATAILAA 60

Query: 56 FFFATSIALGMISRYTSTRYK 76
           FFATS+ L ++S  TS    
Sbjct: 61 LFFATSMVLAILSHRTSAPRS 81


>gi|154248119|ref|YP_001419077.1| preprotein translocase, SecG subunit [Xanthobacter autotrophicus
           Py2]
 gi|154162204|gb|ABS69420.1| preprotein translocase, SecG subunit [Xanthobacter autotrophicus
           Py2]
          Length = 133

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 55/128 (42%), Gaps = 7/128 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-------FTSVRSTAHSLGRFTAIL 53
           MQ  L+V+HL+VV+ L+ V+LIQ S+    G           F + R +A+ L R TA+L
Sbjct: 1   MQTVLIVIHLMVVLALIGVVLIQRSEGGGLGIGGGGGGGAGGFFTARGSANLLTRATAVL 60

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
           A  FF TS+AL +++ +           +       Q      D   P+  +    + ++
Sbjct: 61  ALIFFITSLALTIVAGWGRAPRSILQPATQSGPQVPQSGGTILDQIRPQGGAADQGAPAT 120

Query: 114 VVAGKRSS 121
                   
Sbjct: 121 PAVPSGPQ 128


>gi|59711090|ref|YP_203866.1| preprotein translocase subunit SecG [Vibrio fischeri ES114]
 gi|197334714|ref|YP_002155238.1| translocase [Vibrio fischeri MJ11]
 gi|59479191|gb|AAW84978.1| preprotein translocase membrane subunit [Vibrio fischeri ES114]
 gi|197316204|gb|ACH65651.1| translocase [Vibrio fischeri MJ11]
          Length = 110

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 52/99 (52%), Gaps = 6/99 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
          M   L+V++LI  VG++ ++L+Q    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1  MHTILLVIYLIAAVGVIGLVLVQHGKGADMGASFGAGASNTVFGSSGSGNFLTRMTAICA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
            FF  S+ALG +S + S  +   + +   + + D  +D
Sbjct: 61 TVFFVISLALGNMSTHKSEGFDLKLDQQATEQVTDNASD 99


>gi|209694187|ref|YP_002262115.1| preprotein translocase subunit SecG [Aliivibrio salmonicida
           LFI1238]
 gi|208008138|emb|CAQ78280.1| protein-export membrane protein SecG (preprotein translocase band
           subunit) [Aliivibrio salmonicida LFI1238]
          Length = 110

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 54/106 (50%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++LI  VG++ ++L+Q    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1   MHTILLVIYLIAAVGVIGLVLVQHGKGADMGASFGAGASNTVFGSGGSGNFLTRMTAICA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ALG +S + S  +   + +   + + D  +D     +S
Sbjct: 61  TVFFIISLALGNMSTHKSEGFDLKLDQQATEQVTDNVSDVPATENS 106


>gi|298291795|ref|YP_003693734.1| preprotein translocase, SecG subunit [Starkeya novella DSM 506]
 gi|296928306|gb|ADH89115.1| preprotein translocase, SecG subunit [Starkeya novella DSM 506]
          Length = 129

 Score = 81.7 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/89 (35%), Positives = 48/89 (53%), Gaps = 5/89 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
          MQ  ++V+HL+VV+ L+ V+LIQ S+    G         F S R TA+ L R TAILA 
Sbjct: 1  MQTVIIVIHLMVVLALIGVVLIQRSEGGGLGIGGGGGGGGFFSARGTANVLTRATAILAA 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLV 84
           FF TS++L +++ +           + V
Sbjct: 61 LFFITSLSLTILAGWGRGPTTIFTPATTV 89


>gi|170743496|ref|YP_001772151.1| preprotein translocase, SecG subunit [Methylobacterium sp. 4-46]
 gi|168197770|gb|ACA19717.1| preprotein translocase, SecG subunit [Methylobacterium sp. 4-46]
          Length = 142

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 5/81 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS-----SSNFTSVRSTAHSLGRFTAILAF 55
          MQ  L+VVHLI+V+ L+ V+L+Q S+           +  F + R  A++L R TAILA 
Sbjct: 1  MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGGGGSGTQGFLTGRGQANALTRATAILAA 60

Query: 56 FFFATSIALGMISRYTSTRYK 76
           FF TS+ L ++S  T+    
Sbjct: 61 LFFTTSMVLAILSHRTAAPRS 81


>gi|158424692|ref|YP_001525984.1| preprotein translocase SecG subunit [Azorhizobium caulinodans ORS
           571]
 gi|158331581|dbj|BAF89066.1| preprotein translocase SecG subunit [Azorhizobium caulinodans ORS
           571]
          Length = 138

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 49/106 (46%), Gaps = 5/106 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
           MQ  L+V+HL+VV+ L+ V+LIQ S+    G         F + R TA+ L R TA+LA 
Sbjct: 1   MQTVLIVIHLLVVLALIGVVLIQRSEGGGLGIGGGGGGGGFFTARGTANVLTRATAVLAA 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
            FF TS+ L +++ +           S           +  D   P
Sbjct: 61  LFFITSLGLTILAGWGRAPTSILGPSSGQSGPSVPTGGSILDQIRP 106


>gi|46204719|ref|ZP_00209534.1| COG1314: Preprotein translocase subunit SecG [Magnetospirillum
          magnetotacticum MS-1]
          Length = 98

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 38/103 (36%), Positives = 54/103 (52%), Gaps = 12/103 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHSLGRFTAILA 54
          MQ  L+VVHLI+V+ L+ V+L+Q S+          G  S F + R  A++L R TAILA
Sbjct: 1  MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGVGVGGGVSGFMTGRGQANALTRSTAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGD 97
            FF TSI L ++S      ++    RS++D    QG      
Sbjct: 61 ALFFTTSITLAIMS------HRSAAPRSILDGTGQQGQTQATS 97


>gi|296532894|ref|ZP_06895559.1| preprotein translocase subunit SecG [Roseomonas cervicalis ATCC
          49957]
 gi|296266776|gb|EFH12736.1| preprotein translocase subunit SecG [Roseomonas cervicalis ATCC
          49957]
          Length = 89

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 43/81 (53%), Gaps = 5/81 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS-----SNFTSVRSTAHSLGRFTAILAF 55
          M   L+V+HL V + L+ V+L+Q S+    G        +F + R TA+ L R TAILA 
Sbjct: 1  MMTVLLVLHLFVTLALIGVVLLQRSEGGGLGIGSSQGMGSFMTGRGTANLLTRTTAILAT 60

Query: 56 FFFATSIALGMISRYTSTRYK 76
           F   ++A+ M+ R  + R  
Sbjct: 61 LFMGLALAMAMLGRGQAQRGS 81


>gi|237805249|ref|ZP_04591953.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331026357|gb|EGI06412.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 142

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/131 (23%), Positives = 59/131 (45%), Gaps = 12/131 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRS--TAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +    +FG+ ++ T      TA  L +FTAILA
Sbjct: 18  LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTATFLSKFTAILA 77

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ LG  ++  + +               Q        ++  +  + A+  + V
Sbjct: 78  ACFFITSLGLGYFAKEKAHQLTQAGLPDPAVLEVKQ------KPAADDVPVLEAQKPAVV 131

Query: 115 VAGKRSSSRTK 125
            A    +S  K
Sbjct: 132 PAEVPPASEQK 142


>gi|71083625|ref|YP_266344.1| preprotein translocase subunit SecG [Candidatus Pelagibacter
          ubique HTCC1062]
 gi|91761954|ref|ZP_01263919.1| Preprotein translocase SecG subunit [Candidatus Pelagibacter
          ubique HTCC1002]
 gi|71062738|gb|AAZ21741.1| Preprotein translocase SecG subunit [Candidatus Pelagibacter
          ubique HTCC1062]
 gi|91717756|gb|EAS84406.1| Preprotein translocase SecG subunit [Candidatus Pelagibacter
          ubique HTCC1002]
          Length = 99

 Score = 78.7 bits (192), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 46/83 (55%), Gaps = 3/83 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS---SNFTSVRSTAHSLGRFTAILAFFF 57
          M+  L+VV+L++   LV +IL+Q S+  A G      NF   RS  + +G+ TA++A  F
Sbjct: 1  MENILLVVNLVLATILVLLILVQKSEGGALGIGVSQDNFMLSRSAGNFMGKATAVVATLF 60

Query: 58 FATSIALGMISRYTSTRYKDNMH 80
             S+AL +ISR   T  +  + 
Sbjct: 61 IICSLALTIISRGELTPTESVLD 83


>gi|16125963|ref|NP_420527.1| hypothetical protein CC_1719 [Caulobacter crescentus CB15]
 gi|13423135|gb|AAK23695.1| hypothetical protein CC_1719 [Caulobacter crescentus CB15]
          Length = 211

 Score = 78.7 bits (192), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/124 (20%), Positives = 50/124 (40%), Gaps = 5/124 (4%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSS---SNFTSVRSTAHSLGRFTAILAFFFFAT 60
            L+ ++++V +GL+ V+L+Q S+  A G         + R     L R T IL   F   
Sbjct: 61  VLLAINIVVCLGLIGVVLLQRSEGGALGMGGNSGGLMTARGAGDLLTRITWILFSIFLTI 120

Query: 61  SIALGMISRY--TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           S+ L +++     S    D++      ++++        GS   L S +          +
Sbjct: 121 SLVLTILTGRLDKSGSVADSIKGLDAKTLQNVPAPTPAPGSLNSLPSSAQPGGIQAPTPQ 180

Query: 119 RSSS 122
            ++ 
Sbjct: 181 INTP 184


>gi|237798560|ref|ZP_04587021.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|237803809|ref|ZP_04591394.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331021413|gb|EGI01470.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331025789|gb|EGI05845.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 126

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/131 (23%), Positives = 59/131 (45%), Gaps = 12/131 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRS--TAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +    +FG+ ++ T      TA  L +FTAILA
Sbjct: 2   LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTATFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ LG  ++  + +               Q        ++  +  + A+  + V
Sbjct: 62  ACFFITSLGLGYFAKEKAHQLTQAGLPDPAVLEVKQ------KPAADDVPVLEAQKPAVV 115

Query: 115 VAGKRSSSRTK 125
            A    +S  K
Sbjct: 116 PAEVPPASEQK 126


>gi|15599941|ref|NP_253435.1| preprotein translocase subunit SecG [Pseudomonas aeruginosa PAO1]
 gi|152989544|ref|YP_001350789.1| preprotein translocase subunit SecG [Pseudomonas aeruginosa PA7]
 gi|218893842|ref|YP_002442711.1| preprotein translocase subunit SecG [Pseudomonas aeruginosa LESB58]
 gi|254238517|ref|ZP_04931840.1| secretion protein SecG [Pseudomonas aeruginosa C3719]
 gi|254244351|ref|ZP_04937673.1| secretion protein SecG [Pseudomonas aeruginosa 2192]
 gi|296391574|ref|ZP_06881049.1| preprotein translocase subunit SecG [Pseudomonas aeruginosa PAb1]
 gi|313109728|ref|ZP_07795668.1| secretion protein SecG [Pseudomonas aeruginosa 39016]
 gi|13959569|sp|Q9HV52|SECG_PSEAE RecName: Full=Protein-export membrane protein secG
 gi|9951009|gb|AAG08133.1|AE004888_8 secretion protein SecG [Pseudomonas aeruginosa PAO1]
 gi|126170448|gb|EAZ55959.1| secretion protein SecG [Pseudomonas aeruginosa C3719]
 gi|126197729|gb|EAZ61792.1| secretion protein SecG [Pseudomonas aeruginosa 2192]
 gi|150964702|gb|ABR86727.1| protein-export membrane protein SecG [Pseudomonas aeruginosa PA7]
 gi|218774070|emb|CAW29886.1| secretion protein SecG [Pseudomonas aeruginosa LESB58]
 gi|310882170|gb|EFQ40764.1| secretion protein SecG [Pseudomonas aeruginosa 39016]
          Length = 129

 Score = 77.9 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 31/131 (23%), Positives = 58/131 (44%), Gaps = 10/131 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           ++  ++VVHL++ +GLV +IL+Q    +    +FG+ ++ T      +A  L R T ILA
Sbjct: 2   LEKVVIVVHLLMALGLVGLILVQHGKGADAGASFGAGASATVFGSQGSATFLSRITGILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ L   ++  S   +           + Q      D     +  +  +S  + 
Sbjct: 62  AVFFLTSLGLAYFAKEKSDALQHIGLPDPAVLEQKQEKAPAAD----DVPVLQEQSKPAE 117

Query: 115 VAGKRSSSRTK 125
            AG   ++  +
Sbjct: 118 SAGDVPAAPEQ 128


>gi|28871627|ref|NP_794246.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213966650|ref|ZP_03394801.1| preprotein translocase, SecG subunit [Pseudomonas syringae pv.
           tomato T1]
 gi|301383160|ref|ZP_07231578.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           tomato Max13]
 gi|302063405|ref|ZP_07254946.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           tomato K40]
 gi|302133778|ref|ZP_07259768.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28854879|gb|AAO57941.1| preprotein translocase, SecG subunit [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213928500|gb|EEB62044.1| preprotein translocase, SecG subunit [Pseudomonas syringae pv.
           tomato T1]
 gi|331016645|gb|EGH96701.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 126

 Score = 77.9 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 55/131 (41%), Gaps = 12/131 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAH--SLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +    +FG+ ++ T          L +FTAILA
Sbjct: 2   LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ LG  ++  + +               Q        ++  +  +  +  + V
Sbjct: 62  ACFFITSLGLGYFAKEKAQQLTQVGLPDPAVLEVKQ------KPAAGDVPVLEEQKPAVV 115

Query: 115 VAGKRSSSRTK 125
            A    +   K
Sbjct: 116 PADAPQAPEKK 126


>gi|116052894|ref|YP_793211.1| preprotein translocase subunit SecG [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115588115|gb|ABJ14130.1| secretion protein SecG [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 129

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 31/131 (23%), Positives = 58/131 (44%), Gaps = 10/131 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           ++  ++VVHL++ +GLV +IL+Q    +    +FG+ ++ T      +A  L R T ILA
Sbjct: 2   LEKVVIVVHLLMALGLVGLILVQHGKGADAGASFGAGASATVFGSQGSATFLSRITGILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ L   ++  S   +           + Q      D     +  +  +S  + 
Sbjct: 62  AVFFLTSLGLAYFAKEKSDALQHIGLPDPAVLEQKQEKAPAAD----DVPVLQEQSRPAE 117

Query: 115 VAGKRSSSRTK 125
            AG   ++  +
Sbjct: 118 SAGDVPAAPEQ 128


>gi|114707417|ref|ZP_01440313.1| protein-export membrane protein [Fulvimarina pelagi HTCC2506]
 gi|114536976|gb|EAU40104.1| protein-export membrane protein [Fulvimarina pelagi HTCC2506]
          Length = 258

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 61/125 (48%), Gaps = 4/125 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFF 57
           M+  L+V+HL++V+ LV V+L+Q S+  A G         S R  A++L + T ILA  F
Sbjct: 1   METILIVIHLMIVIALVVVVLLQRSEGGALGIGGGGGGMMSARGAANALTKTTGILAAGF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           F TS++LG+++RY S +  D + +   +  +     +  D            S ++    
Sbjct: 61  FITSLSLGILARYGS-QPTDILDQLPSNQGQSTDGGSLLDQLGGLPSEDEGASGAATGDA 119

Query: 118 KRSSS 122
             ++ 
Sbjct: 120 GTAAP 124


>gi|74420895|gb|ABA05094.1| protein translocase subunit secG [Nitrobacter winogradskyi Nb-255]
          Length = 138

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 44/93 (47%), Gaps = 3/93 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  ++V+HLI+V  L  V+L+Q S+    G      F S R TA+ L R T+ LA  FF
Sbjct: 15  MQTAVIVIHLIIVATLTVVVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTSFLAAGFF 74

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG 91
            TS+ L  ++     +    +  +     +   
Sbjct: 75  VTSLLLSWLAGVE-QKPGSILDTAPASQSQPAT 106


>gi|298488453|ref|ZP_07006484.1| preprotein translocase subunit [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298157078|gb|EFH98167.1| preprotein translocase subunit [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 142

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 55/131 (41%), Gaps = 12/131 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAH--SLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +    +FG+ ++ T          L +FTAILA
Sbjct: 18  LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 77

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ LG  ++  + +               Q        ++  +  +  +  + V
Sbjct: 78  ACFFITSLGLGYFAKEKAQQLTQVGLPDPAALEVKQ------KPAADDVPVLEGQKPAVV 131

Query: 115 VAGKRSSSRTK 125
            A    +   K
Sbjct: 132 PADVPQAPEKK 142


>gi|62129435|gb|AAX67138.1| preprotein translocase IISP family, auxillary membrane component
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
          Length = 175

 Score = 76.7 bits (187), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 28/118 (23%), Positives = 52/118 (44%), Gaps = 15/118 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +    +FG+ ++ T      + + + R TA+LA
Sbjct: 66  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 125

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             FF  S+ LG I+   + +  +          ++       + + P   +  A    
Sbjct: 126 TLFFIISLVLGNINSNKTNKGSE---------WENLSAPAKTEQTQPAAPAQPASDIP 174


>gi|66047410|ref|YP_237251.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           syringae B728a]
 gi|289676021|ref|ZP_06496911.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           syringae FF5]
 gi|302185429|ref|ZP_07262102.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           syringae 642]
 gi|3024606|sp|P95577|SECG_PSEU2 RecName: Full=Protein-export membrane protein secG
 gi|1835602|gb|AAC45132.1| SecG [Pseudomonas syringae pv. syringae]
 gi|63258117|gb|AAY39213.1| Preprotein translocase SecG subunit [Pseudomonas syringae pv.
           syringae B728a]
 gi|330888661|gb|EGH21322.1| preprotein translocase subunit SecG [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330895308|gb|EGH27646.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330937943|gb|EGH41730.1| preprotein translocase subunit SecG [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330950308|gb|EGH50568.1| preprotein translocase subunit SecG [Pseudomonas syringae Cit 7]
 gi|330969648|gb|EGH69714.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           aceris str. M302273PT]
 gi|330981087|gb|EGH79190.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 126

 Score = 76.7 bits (187), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 56/131 (42%), Gaps = 12/131 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAH--SLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +    +FG+ ++ T          L +FTAILA
Sbjct: 2   LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ LG  ++  + +               Q        ++  +  +  +  ++V
Sbjct: 62  ACFFITSLGLGYFAKEKAQQLTQVGLPDPAVLEVKQ------KPAADDVPVLEGQKPAAV 115

Query: 115 VAGKRSSSRTK 125
            A    +   K
Sbjct: 116 PADVPQAPEKK 126


>gi|330877236|gb|EGH11385.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 126

 Score = 76.7 bits (187), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 55/131 (41%), Gaps = 12/131 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAH--SLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +    +FG+ ++ T          L +FTAILA
Sbjct: 2   LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ LG  ++  + +               Q        ++  +  +  +  + V
Sbjct: 62  ACFFITSLGLGYFAKEKAQQLTQVGLPDPAVLEVKQ------KPAASDVPVLEEQKPAVV 115

Query: 115 VAGKRSSSRTK 125
            A    +   K
Sbjct: 116 PADAPQAPEKK 126


>gi|289624599|ref|ZP_06457553.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289646958|ref|ZP_06478301.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330868243|gb|EGH02952.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 126

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 55/131 (41%), Gaps = 12/131 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAH--SLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +    +FG+ ++ T          L +FTAILA
Sbjct: 2   LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ LG  ++  + +               Q        ++  +  +  +  + V
Sbjct: 62  ACFFITSLGLGYFAKEKAQQLTQVGLPDPAALEVKQ------KPAADDVPVLEGQKPAVV 115

Query: 115 VAGKRSSSRTK 125
            A    +   K
Sbjct: 116 PADVPQAPEKK 126


>gi|71734190|ref|YP_276314.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257482264|ref|ZP_05636305.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|71554743|gb|AAZ33954.1| preprotein translocase, SecG subunit [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320330000|gb|EFW85987.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330875223|gb|EGH09372.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330987052|gb|EGH85155.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011496|gb|EGH91552.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 126

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 55/131 (41%), Gaps = 12/131 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAH--SLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +    +FG+ ++ T          L +FTAILA
Sbjct: 2   LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ LG  ++  + +               Q        ++  +  +  +  + V
Sbjct: 62  ACFFITSLGLGYFAKEKAQQLTQVGLPDPAVLEVKQ------KPAADDVPVLEGQKPAVV 115

Query: 115 VAGKRSSSRTK 125
            A    +   K
Sbjct: 116 PADVPQAPEKK 126


>gi|182678433|ref|YP_001832579.1| preprotein translocase, SecG subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634316|gb|ACB95090.1| preprotein translocase, SecG subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 139

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 50/139 (35%), Gaps = 20/139 (14%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS--TAHSLGRFTAILAFFFF 58
           MQ  L+V+HLIVV+ LV  +L+Q S+  A G       +     A+ L R TAILA  FF
Sbjct: 1   MQTVLIVIHLIVVIALVITVLLQRSEGGALGVGGGGGFMTGRGQANVLTRATAILAALFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS------------------S 100
            TS+AL +++                     QG                          +
Sbjct: 61  TTSLALTILANLHRAPKSIFEGTVPATQAPVQGKAPEQSQGNLLDQLRQMEDRRQPSAPA 120

Query: 101 PKLDSVSAKSSSSVVAGKR 119
           P      +  + S     R
Sbjct: 121 PLTPPEPSPVTPSAPTPGR 139


>gi|330963972|gb|EGH64232.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 126

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 55/131 (41%), Gaps = 12/131 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAH--SLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +    +FG+ ++ T          L +FTAILA
Sbjct: 2   LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ LG  ++  + +               Q        ++  +  +  +  + V
Sbjct: 62  ACFFITSLGLGYFAKEKAQQLTQVGLPDPAVLEVKQ------KRAASDVPVLEEQKPAVV 115

Query: 115 VAGKRSSSRTK 125
            A    +   K
Sbjct: 116 PADAPQAPEKK 126


>gi|161616299|ref|YP_001590264.1| hypothetical protein SPAB_04107 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161365663|gb|ABX69431.1| hypothetical protein SPAB_04107 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|267995488|gb|ACY90373.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
          Length = 175

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 51/118 (43%), Gaps = 15/118 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +    +FG+ ++ T      + + + R TA+LA
Sbjct: 66  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 125

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             FF  S+ LG I+   + +  +          ++       + + P   +       
Sbjct: 126 TLFFIISLVLGNINSNKTNKGSE---------WENLSAPAKTEQTQPAAPAQPTSDIP 174


>gi|330958052|gb|EGH58312.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 126

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 57/131 (43%), Gaps = 12/131 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAH--SLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +    +FG+ ++ T          L +FTAILA
Sbjct: 2   LETVVIVFHLMGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ LG  ++  + +               Q        ++  +  + A+  + V
Sbjct: 62  ACFFITSLGLGYFAKEKAQQLTQVGLPDPAVLEVKQ------KPAADDVPVLEAQKPAVV 115

Query: 115 VAGKRSSSRTK 125
            A    +S  K
Sbjct: 116 PADVPPASGQK 126


>gi|319427308|gb|ADV55382.1| preprotein translocase, SecG subunit [Shewanella putrefaciens 200]
          Length = 111

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 55/121 (45%), Gaps = 17/121 (14%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+V +GL+ ++LIQ    +        G+S        + + L R TAILA
Sbjct: 1   MYEVLLVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ +G +S   +            DS K+ G+D   +  +  +   + KS + +
Sbjct: 61  IAFFTLSLIIGNLSANHAKN---------EDSWKNLGSD--TEQVTQPVQDETEKSETKI 109

Query: 115 V 115
            
Sbjct: 110 P 110


>gi|320322531|gb|EFW78624.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 126

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 55/131 (41%), Gaps = 12/131 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAH--SLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +    +FG+ ++ T          L +FTAI+A
Sbjct: 2   LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAIIA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ LG  ++  + +               Q        ++  +  +  +  + V
Sbjct: 62  ACFFITSLGLGYFAKEKAQQLTQVGLPDPAVLEVKQ------KPAADDVPVLEGQKPAVV 115

Query: 115 VAGKRSSSRTK 125
            A    +   K
Sbjct: 116 PADVPQAPEKK 126


>gi|300113264|ref|YP_003759839.1| preprotein translocase subunit SecG [Nitrosococcus watsonii
          C-113]
 gi|299539201|gb|ADJ27518.1| preprotein translocase, SecG subunit [Nitrosococcus watsonii
          C-113]
          Length = 153

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 6/82 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
          M   L+V H++V + LV ++LIQ    +    AFGS ++ T    R +   L R +AILA
Sbjct: 1  MHSVLLVFHIVVAIALVGLVLIQHGKGADAGAAFGSGASATVFGARGSGSFLTRASAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYK 76
            FF TS++L   S        
Sbjct: 61 AAFFITSLSLAYFSVRKPQETS 82


>gi|222148650|ref|YP_002549607.1| protein-export membrane protein SECG [Agrobacterium vitis S4]
 gi|221735636|gb|ACM36599.1| protein-export membrane protein SECG [Agrobacterium vitis S4]
          Length = 128

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 55/94 (58%), Gaps = 3/94 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HLI+V+ LV V+LIQ S+    G      F S R  A++L R TAILA  FF
Sbjct: 1  MQTVLIVIHLIIVISLVGVVLIQRSEGGGLGIGGGSGFMSARGAANALTRTTAILATLFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
           TS+ LG++SR+ + +  D ++R         GN
Sbjct: 61 ITSLGLGILSRFEA-KPTDILNRIPAGQQAPSGN 93


>gi|222086038|ref|YP_002544570.1| protein-export translocase protein [Agrobacterium radiobacter K84]
 gi|221723486|gb|ACM26642.1| protein-export translocase protein [Agrobacterium radiobacter K84]
          Length = 168

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 40/129 (31%), Positives = 67/129 (51%), Gaps = 6/129 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V++L++VV L+ V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLLVIYLMIVVALIGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILAALFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG---NDNFGDGSSPKLDSVSAKSSSSVV 115
           A ++ + ++SR+   R  D ++R    S +  G   +     G++P        ++S V 
Sbjct: 61  ALALGMNVLSRFEG-RPTDILNRIPSTSGQGNGILDSLGGQKGAAPAGSQTQPANNSGVP 119

Query: 116 AGKRSSSRT 124
                + ++
Sbjct: 120 NSGAIAPQS 128


>gi|119774095|ref|YP_926835.1| preprotein translocase subunit SecG [Shewanella amazonensis SB2B]
 gi|119766595|gb|ABL99165.1| protein translocase subunit secG [Shewanella amazonensis SB2B]
          Length = 108

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 46/108 (42%), Gaps = 6/108 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+V +GL+ ++LIQ    +        G+S        + + L R TAILA
Sbjct: 1   MYEVLIVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF  S+ +G +S     +     +     + ++       +   P 
Sbjct: 61  VAFFTLSLIIGNLSANHIKQEDKWNNIGSEPTAEEVQQTEKSETKIPD 108


>gi|292493669|ref|YP_003529108.1| preprotein translocase subunit SecG [Nitrosococcus halophilus Nc4]
 gi|291582264|gb|ADE16721.1| preprotein translocase, SecG subunit [Nitrosococcus halophilus Nc4]
          Length = 151

 Score = 74.0 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 38/140 (27%), Positives = 60/140 (42%), Gaps = 18/140 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
           M   L+V H++V + LV ++LIQ    +    AFGS ++ T    R +A+ L R +AILA
Sbjct: 1   MHSVLLVFHILVAIALVSLVLIQHGKGADAGAAFGSGASATVFGARGSANFLTRASAILA 60

Query: 55  FFFFATSIALGMIS---RYTSTRYKDNMHRSLVDS--------IKDQGNDNFGDGSSPKL 103
             FF TS++L   S     TS+  +    + + D           +   D   +G+    
Sbjct: 61  AVFFITSLSLAYFSVREPQTSSVTQAAEPKIVADEDMVIPPLPKDETTKDKLSEGAQQLG 120

Query: 104 D-SVSAKSSSSVVAGKRSSS 122
                +  SS V A      
Sbjct: 121 AGQEESPKSSEVPAASSDVP 140


>gi|237706074|ref|ZP_04536555.1| LOW QUALITY PROTEIN: preprotein translocase IISP family
           [Escherichia sp. 3_2_53FAA]
 gi|254038340|ref|ZP_04872398.1| LOW QUALITY PROTEIN: preprotein translocase IISP family
           [Escherichia sp. 1_1_43]
 gi|226839964|gb|EEH71985.1| LOW QUALITY PROTEIN: preprotein translocase IISP family
           [Escherichia sp. 1_1_43]
 gi|226899114|gb|EEH85373.1| LOW QUALITY PROTEIN: preprotein translocase IISP family
           [Escherichia sp. 3_2_53FAA]
          Length = 141

 Score = 74.0 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 52/119 (43%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +    +FG+ ++ T      + + + R TA+LA
Sbjct: 32  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 91

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + +  +          ++       + + P   +       +
Sbjct: 92  TLFFIISLVLGNINSNKTNKGSE---------WENLSAPAKTEQTQPAAPAKPTSDIPN 141


>gi|94501387|ref|ZP_01307907.1| preprotein translocase, SecG subunit [Oceanobacter sp. RED65]
 gi|94426500|gb|EAT11488.1| preprotein translocase, SecG subunit [Oceanobacter sp. RED65]
          Length = 120

 Score = 74.0 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 59/121 (48%), Gaps = 8/121 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M+  +++ H+IV + ++ ++LIQ    +    +FG  ++ T      + + L R T++LA
Sbjct: 1   MESIILIFHIIVAIAIIGLVLIQQGKGAEAGASFGGGASQTVFGSAGSGNFLTRSTSVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FFATS AL  +++  +    D    S+      Q  D   +   P ++  + ++ + +
Sbjct: 61  VVFFATSFALAYVAKQKADGLVDAGLPSV--QEVQQIEDAVQESEVPVVEESAPETDAPI 118

Query: 115 V 115
           V
Sbjct: 119 V 119


>gi|162139843|ref|YP_318446.2| preprotein translocase subunit SecG [Nitrobacter winogradskyi
          Nb-255]
          Length = 124

 Score = 74.0 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 44/93 (47%), Gaps = 3/93 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  ++V+HLI+V  L  V+L+Q S+    G      F S R TA+ L R T+ LA  FF
Sbjct: 1  MQTAVIVIHLIIVATLTVVVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTSFLAAGFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG 91
           TS+ L  ++     +    +  +     +   
Sbjct: 61 VTSLLLSWLAGVE-QKPGSILDTAPASQSQPAT 92


>gi|237730092|ref|ZP_04560573.1| preprotein translocase IISP family [Citrobacter sp. 30_2]
 gi|226908698|gb|EEH94616.1| preprotein translocase IISP family [Citrobacter sp. 30_2]
          Length = 155

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 46/118 (38%), Gaps = 15/118 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S        + + + R TA+L 
Sbjct: 46  MHEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAVLG 105

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             FF  S+ LG ++   + +  +          ++       + + P   +       
Sbjct: 106 TLFFIISLVLGNMNSNKTNKGSE---------WENLSAPAKTEQTQPAAPAQPTSDIP 154


>gi|153001792|ref|YP_001367473.1| preprotein translocase subunit SecG [Shewanella baltica OS185]
 gi|151366410|gb|ABS09410.1| preprotein translocase, SecG subunit [Shewanella baltica OS185]
          Length = 111

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 56/121 (46%), Gaps = 17/121 (14%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+V +GL+ ++LIQ    +        G+S        + + L R TAILA
Sbjct: 1   MYEVLVVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ +G +S   +            DS K+ G+D   +  +  ++  + KS + +
Sbjct: 61  IAFFTLSLLIGNLSANHAKN---------EDSWKNLGSD--TEQVTQPVEQGTEKSETKI 109

Query: 115 V 115
            
Sbjct: 110 P 110


>gi|153844466|ref|ZP_01993661.1| translocase [Vibrio parahaemolyticus AQ3810]
 gi|149745223|gb|EDM56474.1| translocase [Vibrio parahaemolyticus AQ3810]
          Length = 115

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 56/114 (49%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA
Sbjct: 4   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +      +  +L   + +Q  D   +  +P  D +  
Sbjct: 64  TVFFVVSLLLGRMSTHKTE--SQWVDPTLGQPVVEQVKDAASEVPAPTGDEIPQ 115


>gi|120597897|ref|YP_962471.1| preprotein translocase subunit SecG [Shewanella sp. W3-18-1]
 gi|146293931|ref|YP_001184355.1| preprotein translocase subunit SecG [Shewanella putrefaciens CN-32]
 gi|120557990|gb|ABM23917.1| protein translocase subunit secG [Shewanella sp. W3-18-1]
 gi|145565621|gb|ABP76556.1| protein translocase subunit secG [Shewanella putrefaciens CN-32]
          Length = 111

 Score = 73.6 bits (179), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 9/105 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+V +GL+ ++LIQ    +        G+S        + + L R TAILA
Sbjct: 1   MYEVLLVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
             FF  S+ +G +S   +       +   + S  +Q      DG+
Sbjct: 61  IAFFTLSLIIGNLSANHAKNEDSWKN---LGSDTEQVTQPVQDGT 102


>gi|126175442|ref|YP_001051591.1| preprotein translocase subunit SecG [Shewanella baltica OS155]
 gi|217972312|ref|YP_002357063.1| preprotein translocase subunit SecG [Shewanella baltica OS223]
 gi|304410268|ref|ZP_07391887.1| preprotein translocase, SecG subunit [Shewanella baltica OS183]
 gi|307302021|ref|ZP_07581779.1| preprotein translocase, SecG subunit [Shewanella baltica BA175]
 gi|125998647|gb|ABN62722.1| protein translocase subunit secG [Shewanella baltica OS155]
 gi|217497447|gb|ACK45640.1| preprotein translocase, SecG subunit [Shewanella baltica OS223]
 gi|304351677|gb|EFM16076.1| preprotein translocase, SecG subunit [Shewanella baltica OS183]
 gi|306914059|gb|EFN44480.1| preprotein translocase, SecG subunit [Shewanella baltica BA175]
          Length = 111

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 56/121 (46%), Gaps = 17/121 (14%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+V +GL+ ++LIQ    +        G+S        + + L R TAILA
Sbjct: 1   MYEVLVVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ +G +S   +            DS K+ G+D   +  +  ++  + KS + +
Sbjct: 61  IAFFTLSLLIGNLSANHAKN---------EDSWKNLGSD--TEQVTQPVEQGTQKSETKI 109

Query: 115 V 115
            
Sbjct: 110 P 110


>gi|114799731|ref|YP_760497.1| preprotein translocase, SecG subunit [Hyphomonas neptunium ATCC
           15444]
 gi|114739905|gb|ABI78030.1| preprotein translocase, SecG subunit [Hyphomonas neptunium ATCC
           15444]
          Length = 151

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 11/120 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS----SNFTSVRSTAHSLGRFTAILAFF 56
           MQ  ++V+H++  + ++ ++L+Q S+    G      ++  S R  A +L R T I    
Sbjct: 1   MQNVILVIHILACLAMIGLVLVQKSEGGGLGIGGGAGNSLMSGRGAAGALVRTTMIFGAI 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFG-----DGSSPKLDSVSAKSS 111
           FFATS+ L  I+   S          ++D    Q     G     D S+P L+  S  S 
Sbjct: 61  FFATSLILTSIANRQSDNRTGI--ERILDESNPQTAPQDGPVDLFDPSAPLLEETSPASP 118


>gi|162147715|ref|YP_001602176.1| protein translocase subunit secG [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|209542339|ref|YP_002274568.1| preprotein translocase subunit SecG [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|161786292|emb|CAP55874.1| protein translocase subunit secG [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|209530016|gb|ACI49953.1| preprotein translocase, SecG subunit [Gluconacetobacter
          diazotrophicus PAl 5]
          Length = 111

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS-----SNFTSVRSTAHSLGRFTAILAF 55
          M   L+ +HL V + L+  +LIQ S+    G        +F S R TA+ L R T++LA 
Sbjct: 1  MITVLLFLHLFVTLALIGTVLIQRSEGGGLGIGSSQGMGSFMSGRGTANLLTRTTSVLAG 60

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           F   S+ L +++R  ST    ++
Sbjct: 61 IFMILSLTLAVMNRGASTGSGHDI 84


>gi|288958210|ref|YP_003448551.1| SecG protein [Azospirillum sp. B510]
 gi|288910518|dbj|BAI72007.1| SecG protein [Azospirillum sp. B510]
          Length = 107

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 44/82 (53%), Gaps = 4/82 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT----SVRSTAHSLGRFTAILAFF 56
          M+  ++V+HL++ VGLV VILIQ S+    G          S R TA+ L R T ILA  
Sbjct: 1  MESVILVIHLLIAVGLVGVILIQRSEGGGLGIGGGTMGGMMSTRGTANLLTRTTGILAGC 60

Query: 57 FFATSIALGMISRYTSTRYKDN 78
          FFATSI L +++   S      
Sbjct: 61 FFATSIVLAILAGGHSRPASII 82


>gi|146283633|ref|YP_001173786.1| preprotein translocase subunit SecG [Pseudomonas stutzeri A1501]
 gi|145571838|gb|ABP80944.1| preprotein translocase, SecG subunit [Pseudomonas stutzeri A1501]
          Length = 141

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 53/131 (40%), Gaps = 11/131 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           +Q  ++VVHL+V +G+V ++L+Q    +    +FGS ++ T      +A  L RFTAILA
Sbjct: 16  LQTVVIVVHLLVALGVVALVLLQQGKGADAGASFGSGASATVFGSQGSATFLSRFTAILA 75

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ L   ++  + +                        +   +  +  +  +  
Sbjct: 76  GVFFLTSLGLAFFAKQQADQLSQAGLPDPAVLEVPASK-----PAVEDVPVLEQRKPADT 130

Query: 115 VAGKRSSSRTK 125
                     +
Sbjct: 131 AGDLPEVEEGQ 141


>gi|327482028|gb|AEA85338.1| preprotein translocase subunit SecG [Pseudomonas stutzeri DSM 4166]
          Length = 127

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 53/131 (40%), Gaps = 11/131 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           +Q  ++VVHL+V +G+V ++L+Q    +    +FGS ++ T      +A  L RFTAILA
Sbjct: 2   LQTVVIVVHLLVALGVVALVLLQQGKGADAGASFGSGASATVFGSQGSATFLSRFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ L   ++  + +                        +   +  +  +  +  
Sbjct: 62  GVFFLTSLGLAFFAKQQADQLSQAGLPDPAVLEVPASK-----PAVEDVPVLEQRKPADT 116

Query: 115 VAGKRSSSRTK 125
                     +
Sbjct: 117 AGDLPEVEEGQ 127


>gi|163802300|ref|ZP_02196194.1| translocase [Vibrio sp. AND4]
 gi|159173829|gb|EDP58643.1| translocase [Vibrio sp. AND4]
          Length = 112

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 56/114 (49%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA
Sbjct: 1   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +      +  +L   + +Q  D   +  +P  D +  
Sbjct: 61  TVFFIISLLLGRMSTHKAE--SQWVDPTLGQPVVEQIKDAASEVPAPTGDEIPQ 112


>gi|269961977|ref|ZP_06176332.1| translocase [Vibrio harveyi 1DA3]
 gi|269833300|gb|EEZ87404.1| translocase [Vibrio harveyi 1DA3]
          Length = 112

 Score = 73.3 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 56/114 (49%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA
Sbjct: 1   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +      +  +L   + +Q  D   +  +P  D +  
Sbjct: 61  TVFFIISLLLGRMSTHKTE--SQWVDPTLGQPVVEQVKDAASEVPAPAGDEIPQ 112


>gi|160876526|ref|YP_001555842.1| preprotein translocase subunit SecG [Shewanella baltica OS195]
 gi|160862048|gb|ABX50582.1| preprotein translocase, SecG subunit [Shewanella baltica OS195]
 gi|315268720|gb|ADT95573.1| preprotein translocase, SecG subunit [Shewanella baltica OS678]
          Length = 111

 Score = 72.9 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 55/121 (45%), Gaps = 17/121 (14%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+V +GL+ ++LIQ    +        G+S        + + L R TAILA
Sbjct: 1   MYEVLVVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ +G +S   +            DS  + G+D   +  +  ++  + KS + +
Sbjct: 61  IAFFTLSLLIGNLSANHAKN---------EDSWNNLGSD--TEQVTQPVEQGTQKSETKI 109

Query: 115 V 115
            
Sbjct: 110 P 110


>gi|262393379|ref|YP_003285233.1| preprotein translocase subunit SecG [Vibrio sp. Ex25]
 gi|262336973|gb|ACY50768.1| preprotein translocase subunit SecG [Vibrio sp. Ex25]
          Length = 112

 Score = 72.9 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 55/114 (48%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA
Sbjct: 1   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S +        +  +L   + +Q  D   +  +P  D +  
Sbjct: 61  TVFFIVSLLLGRMSTHKIE--SQWVDPTLGQPVVEQVKDAASEVPAPAGDEIPQ 112


>gi|156975666|ref|YP_001446573.1| preprotein translocase subunit SecG [Vibrio harveyi ATCC BAA-1116]
 gi|156527260|gb|ABU72346.1| hypothetical protein VIBHAR_03401 [Vibrio harveyi ATCC BAA-1116]
          Length = 112

 Score = 72.9 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 56/114 (49%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA
Sbjct: 1   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +      +  +L   + +Q  D   +  +P  D +  
Sbjct: 61  TVFFIVSLLLGRMSTHKTE--SQWVDPTLGQPVVEQVKDAVSEVPAPTGDEIPQ 112


>gi|91229507|ref|ZP_01262931.1| translocase [Vibrio alginolyticus 12G01]
 gi|269968322|ref|ZP_06182344.1| translocase [Vibrio alginolyticus 40B]
 gi|91187393|gb|EAS73748.1| translocase [Vibrio alginolyticus 12G01]
 gi|269827073|gb|EEZ81385.1| translocase [Vibrio alginolyticus 40B]
          Length = 112

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 56/114 (49%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA
Sbjct: 1   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +      +  +L   + +Q  D   +  +P  D +  
Sbjct: 61  TVFFIVSLLLGRMSTHQTE--SQWVDPTLGQPVVEQVKDAASEVPAPAGDEIPQ 112


>gi|260771817|ref|ZP_05880735.1| preprotein translocase subunit SecG [Vibrio metschnikovii CIP
           69.14]
 gi|260613109|gb|EEX38310.1| preprotein translocase subunit SecG [Vibrio metschnikovii CIP
           69.14]
          Length = 114

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 57/113 (50%), Gaps = 9/113 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
           M   L+V++L+  VG++ ++LIQ    +    +FG+ ++ T      + + L R TA+ A
Sbjct: 4   MFTVLLVIYLLAAVGIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAVFA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             FF  S+ LG +S + +     +    L   + +Q +++  D  +PK D + 
Sbjct: 64  TAFFVISLVLGNMSTHKTESQWVD---PLQGHVVEQADNSVSDIPAPKGDEIP 113


>gi|28899233|ref|NP_798838.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260879072|ref|ZP_05891427.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           AN-5034]
 gi|260897743|ref|ZP_05906239.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           Peru-466]
 gi|260900799|ref|ZP_05909194.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           AQ4037]
 gi|28807457|dbj|BAC60722.1| preprotein translocase, SecG subunit [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308088981|gb|EFO38676.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           Peru-466]
 gi|308089558|gb|EFO39253.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           AN-5034]
 gi|308108181|gb|EFO45721.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           AQ4037]
          Length = 112

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 56/114 (49%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA
Sbjct: 1   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +      +  +L   + +Q  D   +  +P  D +  
Sbjct: 61  TVFFVVSLLLGRMSTHKTE--SQWVDPTLGQPVVEQVKDAASEVPAPTGDEIPQ 112


>gi|127513758|ref|YP_001094955.1| preprotein translocase subunit SecG [Shewanella loihica PV-4]
 gi|126639053|gb|ABO24696.1| protein translocase subunit secG [Shewanella loihica PV-4]
          Length = 114

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 6/83 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   LMV++L+V +GL+ +ILIQ    +        G+S+       + + L R TAILA
Sbjct: 1  MYEVLMVIYLLVALGLIGLILIQQGKGADMGASFGAGASATLFGSSGSGNFLTRSTAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKD 77
            FFA S+ +G +S   +   + 
Sbjct: 61 IAFFALSLTIGNLSANHAKTEES 83


>gi|242240752|ref|YP_002988933.1| preprotein translocase, SecG subunit [Dickeya dadantii Ech703]
 gi|242132809|gb|ACS87111.1| preprotein translocase, SecG subunit [Dickeya dadantii Ech703]
          Length = 135

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 51/118 (43%), Gaps = 15/118 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V+ L+V + L+ +I++Q    +    +FG+ ++ T      + + + R TA+LA
Sbjct: 26  MYEALLVIFLLVAISLIGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 85

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             FF  S+ LG +S   S +  +          ++       +   P+  +  +    
Sbjct: 86  TLFFVISLILGNLSSGHSKKSSE---------WENLSQPAKVEQVVPEKPATPSSDIP 134


>gi|90022361|ref|YP_528188.1| protein translocase subunit secG [Saccharophagus degradans 2-40]
 gi|89951961|gb|ABD81976.1| protein translocase subunit secG [Saccharophagus degradans 2-40]
          Length = 129

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 51/121 (42%), Gaps = 8/121 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M+  + +VHL+V + ++ +IL+Q    +        G+S        + +   R TA+L 
Sbjct: 1   MENIIFIVHLLVALAIIGLILMQQGKGAEMGASFGAGASQTLFGSGGSGNFFSRMTALLV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS--PKLDSVSAKSSS 112
             FF TS AL +I++  +   +D       +       +     +S  P +D  +   SS
Sbjct: 61  AVFFITSFALAIIAKKQADITEDVSFSISEEVELPSLEETAPIDASDVPSVDIEAEADSS 120

Query: 113 S 113
            
Sbjct: 121 E 121


>gi|328474231|gb|EGF45036.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus 10329]
          Length = 112

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 56/114 (49%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA
Sbjct: 1   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +      +  +L   + +Q  D   +  +P  D +  
Sbjct: 61  TVFFVVSLLLGRMSTHKTE--SQWVDPTLGQPVVEQVKDAASEIPAPTGDEIPQ 112


>gi|114562165|ref|YP_749678.1| preprotein translocase subunit SecG [Shewanella frigidimarina
          NCIMB 400]
 gi|114333458|gb|ABI70840.1| protein translocase subunit secG [Shewanella frigidimarina NCIMB
          400]
          Length = 111

 Score = 72.5 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 6/83 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+VV+L+V +GL+ +ILIQ    +        G+S        + + L R TA+LA
Sbjct: 1  MYEVLIVVYLVVALGLIGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAVLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKD 77
            FFA S+ +G +S   + + + 
Sbjct: 61 IGFFALSLVIGNLSANHTEQNEQ 83


>gi|159045283|ref|YP_001534077.1| preprotein translocase subunit SecG [Dinoroseobacter shibae DFL 12]
 gi|157913043|gb|ABV94476.1| putative preprotein translocase [Dinoroseobacter shibae DFL 12]
          Length = 122

 Score = 72.1 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 8/120 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M+  +++VHL++ + L+ V+L+Q S+        G      + RS A +LG+ T ILA  
Sbjct: 1   MENVILIVHLLLALALIGVVLLQRSEGGGLGMGGGGGGGAMTGRSAATALGKMTWILAVA 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           F  TSI L +++   S      + R     +      N      P    +   +++   A
Sbjct: 61  FIGTSITLTILAAANSNN-ASVLDRLTDQPVPPPVESN---EQLPPASDLLPPAATDQPA 116


>gi|329893947|ref|ZP_08269982.1| Preprotein translocase subunit SecG (TC 3.A.5.1.1) [gamma
           proteobacterium IMCC3088]
 gi|328923402|gb|EGG30719.1| Preprotein translocase subunit SecG (TC 3.A.5.1.1) [gamma
           proteobacterium IMCC3088]
          Length = 124

 Score = 72.1 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 54/114 (47%), Gaps = 10/114 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVR------STAHSLGRFTAILA 54
           M+  ++VVHL+V + ++ +I+IQ    +  G+S    + +       + ++L + T+ L 
Sbjct: 1   MEQIILVVHLLVALAIIGLIMIQQGKGADMGASFGAGASQTLLGSAGSGNALTKATSWLV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN----DNFGDGSSPKLD 104
             FFATS AL +++   +   +D      V+      +    D+  +  SP  D
Sbjct: 61  AAFFATSFALAVVANEKTAPVEDLGIEIPVEVEAPASDLPVVDDEPEAMSPTSD 114


>gi|157376524|ref|YP_001475124.1| preprotein translocase subunit SecG [Shewanella sediminis HAW-EB3]
 gi|157318898|gb|ABV37996.1| preprotein translocase, SecG subunit [Shewanella sediminis HAW-EB3]
          Length = 115

 Score = 72.1 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 55/123 (44%), Gaps = 17/123 (13%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   LMVV+L+V +GLV +ILIQ    +        G+S+         + L R TA+LA
Sbjct: 1   MYEVLMVVYLVVAIGLVGLILIQQGKGADMGASFGAGASATLFGSSGAGNFLTRSTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND--NFGDGSSPKLDSVSAKSSS 112
             FFA S+ +G +S   +            D+ KD  +D     +  + ++   S KS  
Sbjct: 61  IGFFALSLTIGNLSANHTKS---------EDAWKDLSSDAAQVTEQVTEQVKQESEKSEE 111

Query: 113 SVV 115
            + 
Sbjct: 112 KIP 114


>gi|260775412|ref|ZP_05884309.1| preprotein translocase subunit SecG [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608593|gb|EEX34758.1| preprotein translocase subunit SecG [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 111

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  VG++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +     +  +     +  Q +D   +  +P  D +  
Sbjct: 61  TVFFILSLVLGNMSTHKTESQWVDPTQ---GQVIQQADDAASEVPAPTGDEIPQ 111


>gi|148260240|ref|YP_001234367.1| preprotein translocase, SecG subunit [Acidiphilium cryptum JF-5]
 gi|326403426|ref|YP_004283507.1| protein translocase subunit SecG [Acidiphilium multivorum AIU301]
 gi|146401921|gb|ABQ30448.1| protein translocase subunit secG [Acidiphilium cryptum JF-5]
 gi|325050287|dbj|BAJ80625.1| protein translocase subunit SecG [Acidiphilium multivorum AIU301]
          Length = 160

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS-----SNFTSVRSTAHSLGRFTAILAF 55
          M   L+V+   + + L+ V+LIQ S+    G        +F + R TA+ L R TA+LA 
Sbjct: 1  MITVLLVLQAFITIALIGVVLIQRSEGGGLGLGTSQGMGSFMTGRGTANLLTRVTAVLAT 60

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           F   S+ L ++ R+      +++
Sbjct: 61 LFMVLSLVLALLYRHGGGGSAESI 84


>gi|239996534|ref|ZP_04717058.1| protein-export membrane protein secG(General Secretory Pathway)
           [Alteromonas macleodii ATCC 27126]
          Length = 137

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 54/120 (45%), Gaps = 7/120 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           +   L+V +LIV + L+  +LIQ    +    +FGS  + T      + + + R TAILA
Sbjct: 2   IYEVLLVAYLIVALLLIGFVLIQQGKGADMGASFGSGGSNTVFGSSGSGNFMTRTTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S++LG ++       +D  +   V +  ++  +   D   P ++  +      V
Sbjct: 62  GLFFLISLSLGAMTANR-ESAEDEWNNLEVPAAVEESVELPADQDVPVIEDAAQTDVPVV 120


>gi|262042733|ref|ZP_06015887.1| protein-export membrane protein SecG [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039958|gb|EEW41075.1| protein-export membrane protein SecG [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 115

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 56/121 (46%), Gaps = 13/121 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV ++++Q    +        G+S        + + + R T ILA
Sbjct: 1   MYEALLVVFLIVAIGLVGLVMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTGILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ALG I+   +++  +  + S   + + Q        ++P   +  A+ +S +
Sbjct: 61  ALFFIISLALGNINSNKTSKGSEWDNLSAPKTEQTQ-------PTAPAQPTAPAQPTSDI 113

Query: 115 V 115
            
Sbjct: 114 P 114


>gi|221234727|ref|YP_002517163.1| protein translocase subunit SecG [Caulobacter crescentus NA1000]
 gi|220963899|gb|ACL95255.1| protein translocase subunit secG [Caulobacter crescentus NA1000]
          Length = 155

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 25/124 (20%), Positives = 50/124 (40%), Gaps = 5/124 (4%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSS---SNFTSVRSTAHSLGRFTAILAFFFFAT 60
            L+ ++++V +GL+ V+L+Q S+  A G         + R     L R T IL   F   
Sbjct: 5   VLLAINIVVCLGLIGVVLLQRSEGGALGMGGNSGGLMTARGAGDLLTRITWILFSIFLTI 64

Query: 61  SIALGMISRY--TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           S+ L +++     S    D++      ++++        GS   L S +          +
Sbjct: 65  SLVLTILTGRLDKSGSVADSIKGLDAKTLQNVPAPTPAPGSLNSLPSSAQPGGIQAPTPQ 124

Query: 119 RSSS 122
            ++ 
Sbjct: 125 INTP 128


>gi|262163946|ref|ZP_06031685.1| preprotein translocase subunit SecG [Vibrio mimicus VM223]
 gi|262027474|gb|EEY46140.1| preprotein translocase subunit SecG [Vibrio mimicus VM223]
          Length = 114

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 50/121 (41%), Gaps = 17/121 (14%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 4   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ LG +S + +                D         +   +    AKSS  +
Sbjct: 64  TIFFVISLVLGNMSTHKTES-----------QWVDPSQGQVIQQADDTVSETPAKSSDEI 112

Query: 115 V 115
            
Sbjct: 113 P 113


>gi|110616589|gb|ABF05256.1| protein export - membrane protein [Shigella flexneri 5 str. 8401]
          Length = 135

 Score = 71.3 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 49/119 (41%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 26  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 85

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + R  +          ++       + + P   +       +
Sbjct: 86  TLFFIISLVLGNINSNKTNRGSE---------WENLSAPAKTEQTQPAAPAKPTSDIPN 135


>gi|260771176|ref|ZP_05880103.1| preprotein translocase subunit SecG [Vibrio furnissii CIP 102972]
 gi|260613773|gb|EEX38965.1| preprotein translocase subunit SecG [Vibrio furnissii CIP 102972]
 gi|315179218|gb|ADT86132.1| preprotein translocase subunit SecG [Vibrio furnissii NCTC 11218]
          Length = 112

 Score = 71.3 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 53/114 (46%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  VG++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVGIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +      +  S    I+ +  +   D  +   D +  
Sbjct: 61  TVFFIISLVLGNMSTHKTE--SQWVDPSQGQVIQQKAAETVSDAPAKSGDEIPQ 112


>gi|332174439|gb|AEE23693.1| preprotein translocase, SecG subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 123

 Score = 71.3 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 33/118 (27%), Positives = 48/118 (40%), Gaps = 7/118 (5%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILAFFF 57
            L+VV+LIV + L+  +LIQ    +    +FGS  + T      + + L R TAILA FF
Sbjct: 5   VLIVVYLIVAIMLIGFVLIQQGKGADMGASFGSGGSNTVFGSTGSGNFLTRTTAILATFF 64

Query: 58  FATSIALGMISRYTSTRYKDNMH-RSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
           F  S+ LG  +        D  +    V     Q      +   P   S +  S    
Sbjct: 65  FVISLILGNQTADKEKAVDDWQNIEVPVLDEPAQSTPAPVESDVPVTTSDAPASDVPQ 122


>gi|294142063|ref|YP_003558041.1| preprotein translocase subunit SecG [Shewanella violacea DSS12]
 gi|293328532|dbj|BAJ03263.1| preprotein translocase, SecG subunit [Shewanella violacea DSS12]
          Length = 111

 Score = 71.3 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+V++L+V +GLV +ILIQ    +        G+S+         + L R TA+LA
Sbjct: 1  MYEVLIVIYLLVAIGLVGLILIQQGKGADMGASFGAGASATLFGSSGAGNFLTRSTAVLA 60

Query: 55 FFFFATSIALGMISRYTSTR 74
            FFA S+ +G +S   +  
Sbjct: 61 IGFFALSLIIGNLSANHTKS 80


>gi|258625323|ref|ZP_05720223.1| translocase [Vibrio mimicus VM603]
 gi|262172284|ref|ZP_06039962.1| preprotein translocase subunit SecG [Vibrio mimicus MB-451]
 gi|258582389|gb|EEW07238.1| translocase [Vibrio mimicus VM603]
 gi|261893360|gb|EEY39346.1| preprotein translocase subunit SecG [Vibrio mimicus MB-451]
          Length = 111

 Score = 71.3 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 50/121 (41%), Gaps = 17/121 (14%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ LG +S + +                D         +   +    AKSS  +
Sbjct: 61  TIFFVISLVLGNMSTHKTES-----------QWVDPSQGQVIQQADDTVSETPAKSSDEI 109

Query: 115 V 115
            
Sbjct: 110 P 110


>gi|323491476|ref|ZP_08096659.1| preprotein translocase subunit SecG [Vibrio brasiliensis LMG 20546]
 gi|323314260|gb|EGA67341.1| preprotein translocase subunit SecG [Vibrio brasiliensis LMG 20546]
          Length = 110

 Score = 71.3 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 53/114 (46%), Gaps = 10/114 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  VG++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +     +           Q  D+  D  +P+ D +  
Sbjct: 61  TVFFVISLVLGNMSTHKTESQWVD----PTQGQVIQQADDASDIPAPQGDEIPQ 110


>gi|119944576|ref|YP_942256.1| preprotein translocase, SecG subunit [Psychromonas ingrahamii 37]
 gi|119863180|gb|ABM02657.1| protein translocase subunit secG [Psychromonas ingrahamii 37]
          Length = 107

 Score = 71.0 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVR--STAHSLGRFTAILA 54
          M   L+VV+LIV + L+  +LIQ    +     FGS S+ T        + + R TAILA
Sbjct: 1  MYEILLVVYLIVAIILIGFVLIQQGKGAGMGASFGSGSSNTVFGASGAGNFMTRTTAILA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  S+ LG +S    T
Sbjct: 61 IVFFGLSLVLGNLSTNKVT 79


>gi|226946310|ref|YP_002801383.1| preprotein translocase subunit SecG [Azotobacter vinelandii DJ]
 gi|226721237|gb|ACO80408.1| Preprotein translocase SecG subunit [Azotobacter vinelandii DJ]
          Length = 129

 Score = 71.0 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 51/124 (41%), Gaps = 11/124 (8%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILAF 55
           +  ++V HL+  +G++ ++LIQ    +    +FGS ++ T      ++  L R TAILA 
Sbjct: 5   ETIVIVFHLLAALGVIALVLIQQGKGAEAGASFGSGASATVFGSQGSSTFLSRVTAILAT 64

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGD-----GSSPKLDSVSAKS 110
            FF TS+ LG +++  +                 Q      D        P  D+V    
Sbjct: 65  AFFLTSLGLGFLAKEKADSLSKVGLPDPAALEVQQKKPAAEDVPVLEERKPAGDAVDVPQ 124

Query: 111 SSSV 114
           +   
Sbjct: 125 APEQ 128


>gi|90409006|ref|ZP_01217136.1| Biopolymer transport protein [Psychromonas sp. CNPT3]
 gi|90309891|gb|EAS38046.1| Biopolymer transport protein [Psychromonas sp. CNPT3]
          Length = 109

 Score = 71.0 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 40/77 (51%), Gaps = 6/77 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVR--STAHSLGRFTAILA 54
          M   L+VV+LIV V L+  +LIQ    +     FGS ++ T        + + R TA+LA
Sbjct: 1  MYEMLLVVYLIVAVILIGFVLIQQGKGAGMGASFGSGASNTVFGASGAGNFMTRTTAVLA 60

Query: 55 FFFFATSIALGMISRYT 71
            FF  S+ALG +S   
Sbjct: 61 IVFFILSLALGNLSTNK 77


>gi|109897896|ref|YP_661151.1| preprotein translocase subunit SecG [Pseudoalteromonas atlantica
           T6c]
 gi|109700177|gb|ABG40097.1| protein translocase subunit secG [Pseudoalteromonas atlantica T6c]
          Length = 123

 Score = 71.0 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 33/118 (27%), Positives = 48/118 (40%), Gaps = 7/118 (5%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILAFFF 57
            L+VV+LIV + L+  +LIQ    +    +FGS  + T      + + L R TAILA FF
Sbjct: 5   VLIVVYLIVAIMLIGFVLIQQGKGADMGASFGSGGSNTVFGSTGSGNFLTRTTAILATFF 64

Query: 58  FATSIALGMISRYTSTRYKDNMH-RSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
           F  S+ LG  +        D  +    V     Q      +   P   S +  S    
Sbjct: 65  FVISLILGNQTADKEKAVDDWQNIEVPVLDEPAQSTTAPVESDVPVTTSDAPASDVPQ 122


>gi|157962881|ref|YP_001502915.1| preprotein translocase subunit SecG [Shewanella pealeana ATCC
          700345]
 gi|157847881|gb|ABV88380.1| preprotein translocase, SecG subunit [Shewanella pealeana ATCC
          700345]
          Length = 111

 Score = 71.0 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 41/78 (52%), Gaps = 6/78 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   LMVV+L+V +GLV +ILIQ    +        G+S        + + L R TAILA
Sbjct: 1  MYEVLMVVYLLVSIGLVGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAILA 60

Query: 55 FFFFATSIALGMISRYTS 72
            FFA S+ +G +S   +
Sbjct: 61 VAFFALSLTIGNLSANHT 78


>gi|260433187|ref|ZP_05787158.1| preprotein translocase subunit SecG [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417015|gb|EEX10274.1| preprotein translocase subunit SecG [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 121

 Score = 71.0 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS---AFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           M+  ++++HL++ +GL+ V+L+Q S+       G      + RS A +LG+ T ILA  F
Sbjct: 1   MENVVLIIHLLLALGLIAVVLMQRSEGGGLGMGGGGGGAMAGRSAATALGKLTWILAACF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             TSI L +++   S      + R  V +  +       + + P + S  
Sbjct: 61  IVTSITLTILAAQKSAG-TSVIDRLGVPAPAE------TEETVPAVPSAE 103


>gi|221639795|ref|YP_002526057.1| preprotein translocase subunit SecG [Rhodobacter sphaeroides KD131]
 gi|221160576|gb|ACM01556.1| Preprotein translocase SecG subunit [Rhodobacter sphaeroides KD131]
          Length = 227

 Score = 70.6 bits (171), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 30/133 (22%), Positives = 52/133 (39%), Gaps = 10/133 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD-SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
           MQ  +++VHLI+ + L+ V+L+Q S+            + R  A+++ R T I A  F  
Sbjct: 1   MQNVVLIVHLILALLLIGVVLLQRSEGGGLGMGGGGAMTGRQAANAMTRMTWIFAIAFIG 60

Query: 60  TSIALGMISRYTSTRYK-------DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
           TSIAL + +   S                +        GND      +P    ++   + 
Sbjct: 61  TSIALTIFAAQNSHSSSVIDQFGGTVRQEAPATPEAPLGNDLL--PPAPANAPLTPPRAD 118

Query: 113 SVVAGKRSSSRTK 125
              A    +  T+
Sbjct: 119 EQSAPATETPATE 131


>gi|290511552|ref|ZP_06550921.1| preprotein translocase SecG subunit [Klebsiella sp. 1_1_55]
 gi|289776545|gb|EFD84544.1| preprotein translocase SecG subunit [Klebsiella sp. 1_1_55]
          Length = 121

 Score = 70.6 bits (171), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV ++++Q    +        G+S        + + + R T ILA
Sbjct: 13  MYEALLVVFLIVAIGLVGLVMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTGILA 72

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
             FF  S+ALG I+   +++  +  + S   + + Q
Sbjct: 73  ALFFIISLALGNINSNKTSKGSEWDNLSAPKTEQTQ 108


>gi|167625062|ref|YP_001675356.1| preprotein translocase subunit SecG [Shewanella halifaxensis
          HAW-EB4]
 gi|167355084|gb|ABZ77697.1| preprotein translocase, SecG subunit [Shewanella halifaxensis
          HAW-EB4]
          Length = 111

 Score = 70.6 bits (171), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 6/78 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   LM+++L+V +GLV +ILIQ    +        G+S        + + L R TA+LA
Sbjct: 1  MYEVLMIIYLMVAIGLVGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAVLA 60

Query: 55 FFFFATSIALGMISRYTS 72
            FFA S+ +G +S   +
Sbjct: 61 VAFFALSLTIGNLSANHT 78


>gi|229512902|ref|ZP_04402369.1| preprotein translocase subunit SecG [Vibrio cholerae TMA 21]
 gi|229350151|gb|EEO15104.1| preprotein translocase subunit SecG [Vibrio cholerae TMA 21]
          Length = 114

 Score = 70.6 bits (171), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 26/114 (22%), Positives = 51/114 (44%), Gaps = 9/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 4   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +     +  +     +  Q  D   +  +   D +  
Sbjct: 64  TVFFVISLVLGNMSTHKTESQWVDPSQ---GQVIQQTGDTVSEAPAKSSDEIPQ 114


>gi|291616007|ref|YP_003518749.1| SecG [Pantoea ananatis LMG 20103]
 gi|291151037|gb|ADD75621.1| SecG [Pantoea ananatis LMG 20103]
 gi|327396258|dbj|BAK13680.1| protein-export membrane protein SecG [Pantoea ananatis AJ13355]
          Length = 113

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 50/110 (45%), Gaps = 8/110 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S        + + + R TA+LA
Sbjct: 3   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSNGSGNFMTRMTAVLA 62

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG ++   +++  +  + +     + Q        ++P  D
Sbjct: 63  TLFFVISLILGNLNSNKTSKGSEWENLTAPAQSQQQTQP--AKPATPGND 110


>gi|281602558|gb|ADA75542.1| Preprotein translocase IISP family, auxillary membrane component
           [Shigella flexneri 2002017]
          Length = 126

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 49/119 (41%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 17  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 76

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + R  +          ++       + + P   +       +
Sbjct: 77  TLFFIISLVLGNINSNKTNRGSE---------WENLSAPAKTEQTQPAAPAKPTSDIPN 126


>gi|27365054|ref|NP_760582.1| preprotein translocase subunit SecG [Vibrio vulnificus CMCP6]
 gi|37680895|ref|NP_935504.1| preprotein translocase subunit SecG [Vibrio vulnificus YJ016]
 gi|320155438|ref|YP_004187817.1| preprotein translocase subunit SecG [Vibrio vulnificus MO6-24/O]
 gi|27361200|gb|AAO10109.1| preprotein translocase, SecG subunit [Vibrio vulnificus CMCP6]
 gi|37199645|dbj|BAC95475.1| preprotein translocase subunit SecG [Vibrio vulnificus YJ016]
 gi|319930750|gb|ADV85614.1| preprotein translocase subunit SecG [Vibrio vulnificus MO6-24/O]
          Length = 110

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 56/104 (53%), Gaps = 7/104 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAILA
Sbjct: 1   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTS-TRYKDNMHRSLVDSIKDQGNDNFGD 97
             FF  S+ LG +S + + +++ D     +V+ ++D  ++    
Sbjct: 61  TVFFIVSLTLGRMSTHKAESQWVDPTQGQVVEQVQDNVSEAPAK 104


>gi|238896682|ref|YP_002921427.1| preprotein translocase subunit SecG [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238549009|dbj|BAH65360.1| preprotein translocase inner membrane secretion subunit [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 121

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV ++++Q    +        G+S        + + + R T ILA
Sbjct: 13  MYEALLVVFLIVAIGLVGLVMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTGILA 72

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
             FF  S+ALG I+   +++  +  + S   + + Q
Sbjct: 73  ALFFIISLALGNINSNKTSKGSEWDNLSAPKTEQTQ 108


>gi|302879350|ref|YP_003847914.1| preprotein translocase, SecG subunit [Gallionella
          capsiferriformans ES-2]
 gi|302582139|gb|ADL56150.1| preprotein translocase, SecG subunit [Gallionella
          capsiferriformans ES-2]
          Length = 108

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 6/81 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M+  + V HL+  + L  ++L+Q    +        GS+ +      +A+ L R TAI A
Sbjct: 1  METIVWVFHLVTAIALCGLVLVQHGKGADMGAAFGTGSAGSLFGSGGSANFLSRSTAIAA 60

Query: 55 FFFFATSIALGMISRYTSTRY 75
            FF TS+ L  +  + + + 
Sbjct: 61 AIFFVTSLTLTYLYSHPTQQT 81


>gi|261342618|ref|ZP_05970476.1| homoserine dehydrogenase [Enterobacter cancerogenus ATCC 35316]
 gi|288315266|gb|EFC54204.1| homoserine dehydrogenase [Enterobacter cancerogenus ATCC 35316]
          Length = 110

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 49/118 (41%), Gaps = 15/118 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ LIV + LV +I++Q    +        G+S        +A+ + R TAILA
Sbjct: 1   MYEALLVIFLIVAIALVALIMLQQGKGADMGASFGAGASGTLFGSSGSANFMTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             FF  S+ LG I+   +++  +          ++    +  + + P   +       
Sbjct: 61  TLFFIISLVLGNINSNKTSKGSE---------WENLSAPSKTEQTQPAEPAKPTSDIP 109


>gi|311277851|ref|YP_003940082.1| preprotein translocase, SecG subunit [Enterobacter cloacae SCF1]
 gi|308747046|gb|ADO46798.1| preprotein translocase, SecG subunit [Enterobacter cloacae SCF1]
          Length = 109

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 31/115 (26%), Positives = 52/115 (45%), Gaps = 13/115 (11%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TAILA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF  S+ALG I+   + +  +  + +   S + Q        ++P   S    
Sbjct: 61  TLFFIISLALGNINTNKTNKGSEWENLTAPKSEQTQ-------PAAPAQPSSDIP 108


>gi|229505738|ref|ZP_04395248.1| preprotein translocase subunit SecG [Vibrio cholerae BX 330286]
 gi|229509229|ref|ZP_04398714.1| preprotein translocase subunit SecG [Vibrio cholerae B33]
 gi|229519562|ref|ZP_04409005.1| preprotein translocase subunit SecG [Vibrio cholerae RC9]
 gi|229520931|ref|ZP_04410353.1| preprotein translocase subunit SecG [Vibrio cholerae TM 11079-80]
 gi|229530445|ref|ZP_04419833.1| preprotein translocase subunit SecG [Vibrio cholerae 12129(1)]
 gi|229608849|ref|YP_002879497.1| preprotein translocase subunit SecG [Vibrio cholerae MJ-1236]
 gi|229332218|gb|EEN97706.1| preprotein translocase subunit SecG [Vibrio cholerae 12129(1)]
 gi|229342164|gb|EEO07160.1| preprotein translocase subunit SecG [Vibrio cholerae TM 11079-80]
 gi|229344251|gb|EEO09226.1| preprotein translocase subunit SecG [Vibrio cholerae RC9]
 gi|229353801|gb|EEO18737.1| preprotein translocase subunit SecG [Vibrio cholerae B33]
 gi|229357961|gb|EEO22878.1| preprotein translocase subunit SecG [Vibrio cholerae BX 330286]
 gi|229371504|gb|ACQ61927.1| preprotein translocase subunit SecG [Vibrio cholerae MJ-1236]
          Length = 114

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 50/121 (41%), Gaps = 17/121 (14%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 4   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ LG +S + +                D         +   +    AKSS  +
Sbjct: 64  TVFFVISLVLGNMSTHKTES-----------QWVDPSQGQVIQQAGDSVSEAPAKSSDEI 112

Query: 115 V 115
            
Sbjct: 113 P 113


>gi|260596199|ref|YP_003208770.1| protein-export membrane protein secG [Cronobacter turicensis z3032]
 gi|260215376|emb|CBA27397.1| Protein-export membrane protein secG [Cronobacter turicensis z3032]
          Length = 122

 Score = 70.6 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 49/118 (41%), Gaps = 15/118 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 13  MYEALLVVFLIVALGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 72

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             FF  S+ LG I+   +++  +          ++       + + P   +       
Sbjct: 73  TLFFIISLVLGNINSNKTSKGSE---------WENLTAPAKTEQTQPAAPAKPTSDIP 121


>gi|261253853|ref|ZP_05946426.1| preprotein translocase subunit SecG [Vibrio orientalis CIP 102891]
 gi|323499458|ref|ZP_08104430.1| preprotein translocase subunit SecG [Vibrio sinaloensis DSM 21326]
 gi|260937244|gb|EEX93233.1| preprotein translocase subunit SecG [Vibrio orientalis CIP 102891]
 gi|323315514|gb|EGA68553.1| preprotein translocase subunit SecG [Vibrio sinaloensis DSM 21326]
          Length = 110

 Score = 70.6 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 53/114 (46%), Gaps = 10/114 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  VG++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +     +           Q  D+  +  +P+ D +  
Sbjct: 61  TVFFILSLVLGNMSTHKTESQWVD----PTQGQVIQQADDASEIPAPQGDEIPQ 110


>gi|229592639|ref|YP_002874758.1| preprotein translocase subunit SecG [Pseudomonas fluorescens SBW25]
 gi|229364505|emb|CAY52355.1| general secretory pathway, protein-export membrane protein
           [Pseudomonas fluorescens SBW25]
          Length = 127

 Score = 70.6 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 55/127 (43%), Gaps = 8/127 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +    +FG+ ++ T      ++  L +FTAILA
Sbjct: 2   LETVVVVFHLLAALGVVALVLLQQGKGADAGASFGAGASNTVFGSQGSSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ LG  ++  +         +       +          P L    + + ++ 
Sbjct: 62  AGFFITSLGLGYFAKEKAHVLTQVGLPNPAVLEVPKAKP--ASDDVPVLQEQKSATPATD 119

Query: 115 VAGKRSS 121
           V   +  
Sbjct: 120 VPPAQEQ 126


>gi|261212249|ref|ZP_05926535.1| preprotein translocase subunit SecG [Vibrio sp. RC341]
 gi|260838857|gb|EEX65508.1| preprotein translocase subunit SecG [Vibrio sp. RC341]
          Length = 111

 Score = 70.2 bits (170), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 50/121 (41%), Gaps = 17/121 (14%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ LG +S + +                D         +   +    AKSS  +
Sbjct: 61  TVFFVISLVLGNMSTHKTES-----------QWVDPSQGQVIQQAGETVSEAPAKSSDEI 109

Query: 115 V 115
            
Sbjct: 110 P 110


>gi|262189771|ref|ZP_06048122.1| preprotein translocase subunit SecG [Vibrio cholerae CT 5369-93]
 gi|262034348|gb|EEY52737.1| preprotein translocase subunit SecG [Vibrio cholerae CT 5369-93]
          Length = 111

 Score = 70.2 bits (170), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 26/114 (22%), Positives = 51/114 (44%), Gaps = 9/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +     +  +     +  Q  D   +  +   D +  
Sbjct: 61  TVFFVISLVLGNMSTHKTESQWLDPSQ---GQVIQQTGDTVSEAPAKSSDEIPQ 111


>gi|258623145|ref|ZP_05718156.1| translocase [Vibrio mimicus VM573]
 gi|258584565|gb|EEW09303.1| translocase [Vibrio mimicus VM573]
          Length = 111

 Score = 70.2 bits (170), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 50/111 (45%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG +S + +     +  +  V    D         SS ++  
Sbjct: 61  TIFFVISLVLGNMSTHKTESQWVDPSQGQVIQQADDTVSETPAKSSDEIPQ 111


>gi|254507459|ref|ZP_05119593.1| preprotein translocase, SecG subunit [Vibrio parahaemolyticus 16]
 gi|219549529|gb|EED26520.1| preprotein translocase, SecG subunit [Vibrio parahaemolyticus 16]
          Length = 110

 Score = 70.2 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 53/114 (46%), Gaps = 10/114 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  VG++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +     +           Q  D+  +  +P+ D +  
Sbjct: 61  TVFFILSLVLGNMSTHKTESQWVD----PTQGQIIQQADDASEIPAPQGDEIPQ 110


>gi|212634071|ref|YP_002310596.1| preprotein translocase subunit SecG [Shewanella piezotolerans
          WP3]
 gi|212555555|gb|ACJ28009.1| Preprotein translocase, SecG subunit [Shewanella piezotolerans
          WP3]
          Length = 111

 Score = 70.2 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 41/80 (51%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   LMVV+L+V +GLV +ILIQ    +        G+S        + + L R TAILA
Sbjct: 1  MYEVLMVVYLLVAIGLVGMILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAILA 60

Query: 55 FFFFATSIALGMISRYTSTR 74
            FFA S+ +G +S   +  
Sbjct: 61 IAFFALSLTIGNLSANHTQS 80


>gi|26110186|gb|AAN82372.1|AE016767_132 Protein-export membrane protein secG [Escherichia coli CFT073]
 gi|91074170|gb|ABE09051.1| protein-export membrane protein SecG [Escherichia coli UTI89]
          Length = 126

 Score = 70.2 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 49/119 (41%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 17  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 76

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + +  +          ++       + + P   +       +
Sbjct: 77  TLFFIISLVLGNINSNKTNKGSE---------WENLSAPAKTEQTQPAAPAKPTSDIPN 126


>gi|262274886|ref|ZP_06052697.1| hypothetical protein VHA_001868 [Grimontia hollisae CIP 101886]
 gi|262221449|gb|EEY72763.1| hypothetical protein VHA_001868 [Grimontia hollisae CIP 101886]
          Length = 110

 Score = 70.2 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 52/110 (47%), Gaps = 7/110 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1   MYEILLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGSGGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG ++   +    +    S V   + Q  D    G++  + 
Sbjct: 61  TVFFVLSLVLGNLTAKQTEVGGEYDDLS-VPVEQIQSGDVPAAGNNSDIP 109


>gi|238918421|ref|YP_002931935.1| preprotein translocase, SecG subunit, putative [Edwardsiella
           ictaluri 93-146]
 gi|238867989|gb|ACR67700.1| preprotein translocase, SecG subunit, putative [Edwardsiella
           ictaluri 93-146]
          Length = 111

 Score = 70.2 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 48/116 (41%), Gaps = 11/116 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L++ V L+ +I++Q    +        G+S+       T + + R T ILA
Sbjct: 1   MYEALLVIFLLISVALIALIMLQQGKGADMGASFGAGASATLFGSSGTGNFMTRTTGILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FF  S+ LG +S + S +  +       +  +    +     + P   S    +
Sbjct: 61  TLFFVLSLVLGNLSGHQSKQGSE-----WDNLGQPMKTEQPAKPAVPATPSSDIPN 111


>gi|254292206|ref|ZP_04962974.1| preprotein translocase, SecG subunit [Vibrio cholerae AM-19226]
 gi|150421887|gb|EDN13866.1| preprotein translocase, SecG subunit [Vibrio cholerae AM-19226]
          Length = 111

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/114 (22%), Positives = 52/114 (45%), Gaps = 9/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +     +  +     +  Q  D+  +  +   D +  
Sbjct: 61  TVFFVISLVLGNMSTHKTESQWVDPSQ---GQVIQQTGDSVSEAPAKSSDEIPQ 111


>gi|312885111|ref|ZP_07744796.1| preprotein translocase subunit SecG [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367211|gb|EFP94778.1| preprotein translocase subunit SecG [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 111

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 53/106 (50%), Gaps = 7/106 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  VG++ ++LIQ    +    +FG+ ++ T      + + L R TA+ A
Sbjct: 1   MFNVLLVIYLLAAVGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAVFA 60

Query: 55  FFFFATSIALGMISRYTST-RYKDNMHRSLVDSIKDQGNDNFGDGS 99
             FF  S+ALG +S + S  +  D      ++  K+ G  +    S
Sbjct: 61  TVFFVISLALGNMSTHKSDAQGVDVSQGQFIEKTKNNGESSQSSNS 106


>gi|90580526|ref|ZP_01236331.1| putative protein export-membrane protein [Vibrio angustum S14]
 gi|90438184|gb|EAS63370.1| putative protein export-membrane protein [Photobacterium angustum
           S14]
          Length = 113

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 48/114 (42%), Gaps = 7/114 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++L+Q    +        G+S        + + L R T +LA
Sbjct: 1   MYEILLVIYLVAALGVIGLVLVQQGKGADMGASFGAGASGTLFGSSGSGNFLTRMTTVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S   +T      + +   + +        + + P  D +  
Sbjct: 61  AIFFVISLVLGNMSAKQATEGSGWDNLTAPATTQPVVEKTKTEKA-PSTDEIPQ 113


>gi|323376931|gb|ADX49199.1| preprotein translocase, SecG subunit [Escherichia coli KO11]
          Length = 126

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 49/119 (41%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 17  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 76

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + +  +          ++       + + P   +       +
Sbjct: 77  TLFFIISLVLGNINSNKTNKGSE---------WENLSAPVKTEQTQPAAPAKPTSDIPN 126


>gi|229525293|ref|ZP_04414698.1| preprotein translocase subunit SecG [Vibrio cholerae bv. albensis
           VL426]
 gi|229338874|gb|EEO03891.1| preprotein translocase subunit SecG [Vibrio cholerae bv. albensis
           VL426]
          Length = 114

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 50/121 (41%), Gaps = 17/121 (14%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 4   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ LG +S + +                D         +   +    AKSS  +
Sbjct: 64  TVFFVISLVLGNMSTHKTES-----------QWVDPSQGQVIQQAGDTVSETPAKSSDEI 112

Query: 115 V 115
            
Sbjct: 113 P 113


>gi|170727897|ref|YP_001761923.1| preprotein translocase subunit SecG [Shewanella woodyi ATCC
          51908]
 gi|169813244|gb|ACA87828.1| preprotein translocase, SecG subunit [Shewanella woodyi ATCC
          51908]
          Length = 113

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 41/80 (51%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   LMVV+L+V +GLV +ILIQ    +        G+S+         + L R TAILA
Sbjct: 1  MYEVLMVVYLLVAIGLVGLILIQQGKGADMGASFGAGASATLFGSSGAGNFLTRSTAILA 60

Query: 55 FFFFATSIALGMISRYTSTR 74
            FFA S+ +G +S   +  
Sbjct: 61 IGFFALSLIIGNLSANHAKG 80


>gi|89072572|ref|ZP_01159144.1| putative protein export-membrane protein [Photobacterium sp. SKA34]
 gi|89051676|gb|EAR57129.1| putative protein export-membrane protein [Photobacterium sp. SKA34]
          Length = 113

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/114 (21%), Positives = 49/114 (42%), Gaps = 7/114 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++L+Q    +        G+S        + + L R T +LA
Sbjct: 1   MYEILLVIYLVAALGVIGLVLVQQGKGADMGASFGAGASGTLFGSSGSGNFLTRMTTVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S   +T      + +   +I+        + + P  D +  
Sbjct: 61  AIFFVISLVLGNMSAKQATEGSGWDNLTAPATIQPVVEKTKTEKA-PSTDEIPQ 113


>gi|288942135|ref|YP_003444375.1| preprotein translocase subunit SecG [Allochromatium vinosum DSM
           180]
 gi|288897507|gb|ADC63343.1| preprotein translocase, SecG subunit [Allochromatium vinosum DSM
           180]
          Length = 152

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 53/123 (43%), Gaps = 9/123 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           MQ  L V+ + + +GL+ ++LIQ    +    AFGS ++ T      +   L R TAILA
Sbjct: 1   MQTILTVLQVFLSLGLIGLVLIQHGKGADAGAAFGSGASATVFGAQGSGSFLTRLTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRY---KDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
             FF TS+AL   +  TS             +V S+  +          P +   +  S 
Sbjct: 61  TLFFLTSMALAYYATQTSGPAGLMDKMGDAVVVPSVPAESIPRPASSDVPAIPGAAMPSE 120

Query: 112 SSV 114
           S+ 
Sbjct: 121 STA 123


>gi|90416129|ref|ZP_01224061.1| preprotein translocase IISP family, auxillary membrane component
          [marine gamma proteobacterium HTCC2207]
 gi|90331854|gb|EAS47068.1| preprotein translocase IISP family, auxillary membrane component
          [marine gamma proteobacterium HTCC2207]
          Length = 116

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 46/86 (53%), Gaps = 6/86 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
          M+ F+++ H +V V L+ +IL+Q    +    +FG+  + T      + +   R TAIL+
Sbjct: 1  MENFILIFHFLVAVFLIGLILVQQGKGAEAGASFGAGGSQTVFGSGGSWNFFSRMTAILS 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMH 80
            FF TS++L +I++  +    D + 
Sbjct: 61 TIFFVTSVSLAVIAKNKTVVDADLLP 86


>gi|289207892|ref|YP_003459958.1| preprotein translocase, SecG subunit [Thioalkalivibrio sp. K90mix]
 gi|288943523|gb|ADC71222.1| preprotein translocase, SecG subunit [Thioalkalivibrio sp. K90mix]
          Length = 126

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 59/123 (47%), Gaps = 7/123 (5%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILAFFF 57
            L+VV + V + L+ ++L+Q    +    AFGS ++ T    R +A+ L R TA LA  F
Sbjct: 5   LLLVVQVAVSIALIALVLMQHGKGADAGAAFGSGASATVFGARGSANFLSRSTAFLAVVF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           F  S+ L  ++  ++ + +  M +   + ++++G+   G   +   D  S   +S   A 
Sbjct: 65  FVNSLTLAYLAS-STPQAESLMDQLEAEEMREEGDIPEGIPGTVPRDDESDAPASDRPAD 123

Query: 118 KRS 120
              
Sbjct: 124 VPE 126


>gi|15640660|ref|NP_230289.1| preprotein translocase subunit SecG [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|147675589|ref|YP_001216134.1| preprotein translocase subunit SecG [Vibrio cholerae O395]
 gi|153215849|ref|ZP_01950181.1| preprotein translocase, SecG subunit [Vibrio cholerae 1587]
 gi|153820383|ref|ZP_01973050.1| preprotein translocase, SecG subunit [Vibrio cholerae NCTC 8457]
 gi|227080821|ref|YP_002809372.1| preprotein translocase, SecG subunit [Vibrio cholerae M66-2]
 gi|254850874|ref|ZP_05240224.1| preprotein translocase subunit SecG [Vibrio cholerae MO10]
 gi|255744143|ref|ZP_05418096.1| preprotein translocase subunit SecG [Vibrio cholera CIRS 101]
 gi|262156119|ref|ZP_06029238.1| preprotein translocase subunit SecG [Vibrio cholerae INDRE 91/1]
 gi|262169939|ref|ZP_06037629.1| preprotein translocase subunit SecG [Vibrio cholerae RC27]
 gi|297580766|ref|ZP_06942692.1| preprotein translocase [Vibrio cholerae RC385]
 gi|298500756|ref|ZP_07010559.1| preprotein translocase subunit SecG [Vibrio cholerae MAK 757]
 gi|9655076|gb|AAF93806.1| preprotein translocase, SecG subunit [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|124114566|gb|EAY33386.1| preprotein translocase, SecG subunit [Vibrio cholerae 1587]
 gi|126509073|gb|EAZ71667.1| preprotein translocase, SecG subunit [Vibrio cholerae NCTC 8457]
 gi|146317472|gb|ABQ22011.1| preprotein translocase, SecG subunit [Vibrio cholerae O395]
 gi|227008709|gb|ACP04921.1| preprotein translocase, SecG subunit [Vibrio cholerae M66-2]
 gi|227012465|gb|ACP08675.1| preprotein translocase, SecG subunit [Vibrio cholerae O395]
 gi|254846579|gb|EET24993.1| preprotein translocase subunit SecG [Vibrio cholerae MO10]
 gi|255738083|gb|EET93475.1| preprotein translocase subunit SecG [Vibrio cholera CIRS 101]
 gi|262021673|gb|EEY40384.1| preprotein translocase subunit SecG [Vibrio cholerae RC27]
 gi|262030155|gb|EEY48800.1| preprotein translocase subunit SecG [Vibrio cholerae INDRE 91/1]
 gi|297535182|gb|EFH74017.1| preprotein translocase [Vibrio cholerae RC385]
 gi|297540537|gb|EFH76595.1| preprotein translocase subunit SecG [Vibrio cholerae MAK 757]
 gi|327483442|gb|AEA77849.1| Preprotein translocase subunit SecG [Vibrio cholerae LMA3894-4]
          Length = 111

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 50/121 (41%), Gaps = 17/121 (14%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ LG +S + +                D         +   +    AKSS  +
Sbjct: 61  TVFFVISLVLGNMSTHKTES-----------QWVDPSQGQVIQQAGDSVSEAPAKSSDEI 109

Query: 115 V 115
            
Sbjct: 110 P 110


>gi|162139538|ref|YP_218219.2| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|224585088|ref|YP_002638887.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|224469616|gb|ACN47446.1| protein-export membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|322716288|gb|EFZ07859.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 110

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 49/118 (41%), Gaps = 15/118 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             FF  S+ LG I+   + +  +          ++       + + P   +  A    
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSE---------WENLSAPAKTEQTQPAAPAQPASDIP 109


>gi|299134973|ref|ZP_07028164.1| preprotein translocase, SecG subunit [Afipia sp. 1NLS2]
 gi|298589950|gb|EFI50154.1| preprotein translocase, SecG subunit [Afipia sp. 1NLS2]
          Length = 117

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 33/101 (32%), Positives = 46/101 (45%), Gaps = 4/101 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           MQ  ++V+HLI+V  L+ V+L+Q S+    G        F S R T + L R TAILA  
Sbjct: 1   MQTVVIVIHLIIVAALIGVVLLQRSEGGGLGIGGGGGGGFMSSRGTTNLLTRTTAILAAG 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGD 97
           FF TS+ L  ++ Y +             S       N  D
Sbjct: 61  FFITSLFLSWLAGYDNRPKSLINPAPTSQSGSPAPEKNLLD 101


>gi|123440810|ref|YP_001004801.1| preprotein translocase subunit SecG [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238761765|ref|ZP_04622739.1| Protein-export membrane protein secG [Yersinia kristensenii ATCC
           33638]
 gi|332160076|ref|YP_004296653.1| preprotein translocase subunit SecG [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|122087771|emb|CAL10557.1| protein-export membrane protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238699879|gb|EEP92622.1| Protein-export membrane protein secG [Yersinia kristensenii ATCC
           33638]
 gi|318607364|emb|CBY28862.1| preprotein translocase subunit SecG [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664306|gb|ADZ40950.1| preprotein translocase subunit SecG [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862033|emb|CBX72199.1| protein-export membrane protein secG [Yersinia enterocolitica
           W22703]
          Length = 111

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 49/120 (40%), Gaps = 15/120 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L++ +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVIFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ LG +S     +  +          ++ G     + ++  +      S    
Sbjct: 61  ALFFVISLILGNMSTNQGNKGSE---------WENLGQPAKAEQTTAPVAPTKPSSDIPQ 111


>gi|71280755|ref|YP_270121.1| preprotein translocase subunit SecG [Colwellia psychrerythraea 34H]
 gi|71146495|gb|AAZ26968.1| preprotein translocase, SecG subunit [Colwellia psychrerythraea
           34H]
          Length = 134

 Score = 69.8 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 54/131 (41%), Gaps = 10/131 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           +   L++V++++ + L+ ++LIQ    +        GSS+       + + L   T  LA
Sbjct: 2   LYQVLIIVYVLIALALIGLVLIQQGKGADMGASFGAGSSATVFGSGGSGNFLTSATTYLA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+   ++   T+ R K     + +    DQ  D     S     ++ A  +S V
Sbjct: 62  VGFFVISL---ILGNLTANRTKSVDEWNNLAVPTDQAVDAIPSESVEAT-TLPAVQNSDV 117

Query: 115 VAGKRSSSRTK 125
            A    + + +
Sbjct: 118 PASDEPAKKEE 128


>gi|156935697|ref|YP_001439613.1| preprotein translocase subunit SecG [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156533951|gb|ABU78777.1| hypothetical protein ESA_03566 [Cronobacter sakazakii ATCC BAA-894]
          Length = 110

 Score = 69.4 bits (168), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 48/118 (40%), Gaps = 15/118 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVALGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             FF  S+ LG I+   + +  +          ++       + + P   +       
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSE---------WENLTAPAKTEQTQPAAPAKPTSDIP 109


>gi|329113483|ref|ZP_08242264.1| Protein Translocase Subunit SecG [Acetobacter pomorum DM001]
 gi|326697308|gb|EGE48968.1| Protein Translocase Subunit SecG [Acetobacter pomorum DM001]
          Length = 114

 Score = 69.4 bits (168), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 5/62 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
          M   L+++H  V + L+ V+LIQ S+    G  S+     F S R TA+ L R TA+LA 
Sbjct: 1  MTTALLILHFCVTIALIGVVLIQRSEGGGLGIGSSQGMGAFMSGRGTANLLTRTTAVLAG 60

Query: 56 FF 57
           F
Sbjct: 61 VF 62


>gi|258542320|ref|YP_003187753.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-01]
 gi|256633398|dbj|BAH99373.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-01]
 gi|256636457|dbj|BAI02426.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-03]
 gi|256639510|dbj|BAI05472.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-07]
 gi|256642566|dbj|BAI08521.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-22]
 gi|256645621|dbj|BAI11569.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-26]
 gi|256648674|dbj|BAI14615.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-32]
 gi|256651727|dbj|BAI17661.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-01-42C]
 gi|256654718|dbj|BAI20645.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-12]
          Length = 114

 Score = 69.4 bits (168), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 5/62 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
          M   L+++H  V + L+ V+LIQ S+    G  S+     F S R TA+ L R TA+LA 
Sbjct: 1  MTTALLILHFCVTIALIGVVLIQRSEGGGLGIGSSQGMGAFMSGRGTANLLTRTTAVLAG 60

Query: 56 FF 57
           F
Sbjct: 61 VF 62


>gi|304414226|ref|ZP_07395594.1| Preprotein translocase subunit SecG [Candidatus Regiella
           insecticola LSR1]
 gi|304283440|gb|EFL91836.1| Preprotein translocase subunit SecG [Candidatus Regiella
           insecticola LSR1]
          Length = 138

 Score = 69.4 bits (168), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 48/110 (43%), Gaps = 11/110 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M + L+V  L++ +GL+ +I++Q    +        G+SS       + + + R TAILA
Sbjct: 31  MYVTLLVFFLLISIGLIALIVLQQGKGADMGASFGAGASSTLFGSSGSGNFMTRMTAILA 90

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG +S     +  +  + S     +   ++       P  D
Sbjct: 91  TLFFIVSLVLGNMSSKQHRQSSEWENLS-----QPAKDEKISAPPKPSSD 135


>gi|294083770|ref|YP_003550527.1| preprotein translocase SecG subunit [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663342|gb|ADE38443.1| preprotein translocase SecG subunit [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 103

 Score = 69.4 bits (168), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 49/106 (46%), Gaps = 11/106 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
           MQ  ++ +H+++ +GLV  +L+Q S+    G         F + R TA+ + R T +LA 
Sbjct: 1   MQTLVLTIHILIALGLVGAVLLQRSEGGGLGIGGGGSGGGFMTARGTANLMTRVTTVLAA 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
            FF TSI L +++             S+VD + +         + P
Sbjct: 61  GFFTTSIILAIMAGAGKESV------SIVDDVINNTPAPVSGPAVP 100


>gi|329297287|ref|ZP_08254623.1| SecG [Plautia stali symbiont]
          Length = 111

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 47/111 (42%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S        + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSTGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG ++   +++  +  + S     + Q            +  
Sbjct: 61  TLFFIISLILGNLNSNKTSKGSEWENLSAPAQSQQQTQPAKPATPGNDIPQ 111


>gi|283788199|ref|YP_003368064.1| protein-export membrane protein [Citrobacter rodentium ICC168]
 gi|282951653|emb|CBG91353.1| protein-export membrane protein [Citrobacter rodentium ICC168]
          Length = 126

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 48/119 (40%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 17  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 76

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + +  +          ++       + + P   +        
Sbjct: 77  TLFFIISLVLGNINSNKTNKGSE---------WENLSAPAKTEQTQPAAPAQPTSDIPQ 126


>gi|119504347|ref|ZP_01626427.1| secretion protein SecG [marine gamma proteobacterium HTCC2080]
 gi|119459855|gb|EAW40950.1| secretion protein SecG [marine gamma proteobacterium HTCC2080]
          Length = 142

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 58/125 (46%), Gaps = 10/125 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M+  ++VVHL+V +G++ +I++Q    +    +FG+  + T      +A+ L + TA L 
Sbjct: 1   MEQIILVVHLLVALGIIGLIMMQQGKGADIGASFGAGGSQTLFGSVGSANLLTKLTAWLV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIK----DQGNDNFGDGSSPKLDSVSAKS 110
             FFA+S  L MI+   +    D      +++++         +   G  P +   +  S
Sbjct: 61  AAFFASSFGLAMIADSRTAGDDDLGFELPMEAVEMTPVQPLESDVPVGDMPDMTFEAEAS 120

Query: 111 SSSVV 115
              V+
Sbjct: 121 DLPVL 125


>gi|170765735|ref|ZP_02900546.1| preprotein translocase, SecG subunit [Escherichia albertii TW07627]
 gi|170124881|gb|EDS93812.1| preprotein translocase, SecG subunit [Escherichia albertii TW07627]
          Length = 110

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 49/119 (41%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + +  +          ++       + + P   +       +
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSE---------WENLSAPAKAEQTQPAAPAKPTSDIPN 110


>gi|161506144|ref|YP_001573256.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867491|gb|ABX24114.1| hypothetical protein SARI_04332 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 110

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 48/118 (40%), Gaps = 15/118 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             FF  S+ LG I+   + +  +          ++       + + P   +       
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSE---------WENLSAPTKTEQTQPAAPAQPTSDIP 109


>gi|330447380|ref|ZP_08311029.1| preprotein translocase, SecG subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328491571|dbj|GAA05526.1| preprotein translocase, SecG subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 113

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 48/114 (42%), Gaps = 7/114 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++L+Q    +        G+S        + + L R T +LA
Sbjct: 1   MYEILLVIYLVAALGVIGLVLVQQGKGADMGASFGAGASGTLFGSSGSGNFLTRMTTLLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S   +T      + +   + +    +      +P  D +  
Sbjct: 61  AIFFVISLVLGNMSAKQATEGSGWENLTAPATTQPVV-EKTNTEKAPSHDEIPQ 113


>gi|146308626|ref|YP_001189091.1| preprotein translocase subunit SecG [Pseudomonas mendocina ymp]
 gi|145576827|gb|ABP86359.1| protein translocase subunit secG [Pseudomonas mendocina ymp]
          Length = 125

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 52/124 (41%), Gaps = 10/124 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           ++  ++V+HL+  +G+V ++L+Q    +        G+S+     + +A  L +FTAILA
Sbjct: 2   LETVIVVLHLLGAIGVVVLVLLQQGKGADAGASFGAGASATVFGSQGSATFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNM---HRSLVDSIKDQGND-NFGDGSSPKLDSVSAKS 110
             FF TS+ L   ++  +             L    K    D    +  +P  D+     
Sbjct: 62  TGFFITSLGLAFFAKEKADALSQVGLPDPAVLEVQQKPAVEDVPVLEEQAPASDASDVPE 121

Query: 111 SSSV 114
           +   
Sbjct: 122 APEQ 125


>gi|323144912|ref|ZP_08079475.1| preprotein translocase, SecG subunit [Succinatimonas hippei YIT
           12066]
 gi|322415310|gb|EFY06081.1| preprotein translocase, SecG subunit [Succinatimonas hippei YIT
           12066]
          Length = 117

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 49/115 (42%), Gaps = 7/115 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVR--STAHSLGRFTAILA 54
           M   ++VV L+V V +V +IL+Q    +     FG+ ++ T      + + L R T +LA
Sbjct: 1   MYEIVIVVFLLVAVAMVALILVQQGKGAGMGASFGAGASNTVFGAVGSGNFLTRSTWLLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FFA  + +G + +  S +     + S    I     +N      P +D     
Sbjct: 61  IVFFAICLFIGWLQKDHSVQNDSFTNISSESEISTPV-ENKTPADVPTVDGDVPS 114


>gi|83942932|ref|ZP_00955392.1| preprotein translocase, SecG subunit [Sulfitobacter sp. EE-36]
 gi|83954106|ref|ZP_00962826.1| preprotein translocase, SecG subunit [Sulfitobacter sp. NAS-14.1]
 gi|83841143|gb|EAP80313.1| preprotein translocase, SecG subunit [Sulfitobacter sp. NAS-14.1]
 gi|83845940|gb|EAP83817.1| preprotein translocase, SecG subunit [Sulfitobacter sp. EE-36]
          Length = 122

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 54/119 (45%), Gaps = 4/119 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M+  +++VHLI+ +GL+ V+L+Q S+        G      S R+ A ++G+ T +LA  
Sbjct: 1   MENVVLIVHLILALGLIAVVLLQRSEGGGLGMGGGGGGGAVSGRAAATAMGKLTWVLAAA 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
           F  TSI L +I+   S                +QG+      +   L    A+++  V 
Sbjct: 61  FIVTSITLTIIAAEKSAGSSVIDRLGGTPPALNQGDAPALPDADALLPPTPAENTPQVP 119


>gi|149192455|ref|ZP_01870648.1| protein-export membrane protein [Vibrio shilonii AK1]
 gi|148833706|gb|EDL50750.1| protein-export membrane protein [Vibrio shilonii AK1]
          Length = 111

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 49/121 (40%), Gaps = 17/121 (14%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1   MIQVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ LG +  +                  D       +        V AKSS  +
Sbjct: 61  IVFFVISLVLGNMYTHKGES-----------QWVDPSQGQVVEQQVDAASDVPAKSSDEI 109

Query: 115 V 115
            
Sbjct: 110 P 110


>gi|157148744|ref|YP_001456063.1| preprotein translocase subunit SecG [Citrobacter koseri ATCC
           BAA-895]
 gi|157085949|gb|ABV15627.1| hypothetical protein CKO_04576 [Citrobacter koseri ATCC BAA-895]
          Length = 110

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 50/118 (42%), Gaps = 15/118 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             FF  S+ALG I+   + +  +          ++       + + P   +  +    
Sbjct: 61  TLFFIISLALGNINSNKTNKGSE---------WENLSAPAKTEQTQPVAPAQPSSDIP 109


>gi|270265056|ref|ZP_06193319.1| hypothetical protein SOD_k00920 [Serratia odorifera 4Rx13]
 gi|270040990|gb|EFA14091.1| hypothetical protein SOD_k00920 [Serratia odorifera 4Rx13]
          Length = 111

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 49/115 (42%), Gaps = 11/115 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L++ +GLV +I++Q    +        G+S        + + + R TAILA
Sbjct: 1   MYEALLVIFLLISIGLVALIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF  S+ LG +S   S +  +       +  +   ++     ++P   S    
Sbjct: 61  ALFFVISLILGNLSTNQSKKGSE-----WENLGQPVKSEQTTAPAAPTKPSSDIP 110


>gi|24114464|ref|NP_708974.1| preprotein translocase subunit SecG [Shigella flexneri 2a str. 301]
 gi|30064513|ref|NP_838684.1| preprotein translocase subunit SecG [Shigella flexneri 2a str.
           2457T]
 gi|82545587|ref|YP_409534.1| preprotein translocase subunit SecG [Shigella boydii Sb227]
 gi|162139328|ref|YP_690561.2| preprotein translocase subunit SecG [Shigella flexneri 5 str. 8401]
 gi|24053646|gb|AAN44681.1| protein translocase membrane component [Shigella flexneri 2a str.
           301]
 gi|30042772|gb|AAP18495.1| protein translocase membrane component [Shigella flexneri 2a str.
           2457T]
 gi|81246998|gb|ABB67706.1| SecG [Shigella boydii Sb227]
 gi|313648583|gb|EFS13025.1| preprotein translocase, SecG subunit [Shigella flexneri 2a str.
           2457T]
          Length = 110

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 49/119 (41%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + R  +          ++       + + P   +       +
Sbjct: 61  TLFFIISLVLGNINSNKTNRGSE---------WENLSAPAKTEQTQPAAPAKPTSDIPN 110


>gi|82778489|ref|YP_404838.1| preprotein translocase subunit SecG [Shigella dysenteriae Sd197]
 gi|309785503|ref|ZP_07680134.1| preprotein translocase, SecG subunit [Shigella dysenteriae 1617]
 gi|81242637|gb|ABB63347.1| protein export - membrane protein [Shigella dysenteriae Sd197]
 gi|308926623|gb|EFP72099.1| preprotein translocase, SecG subunit [Shigella dysenteriae 1617]
          Length = 110

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 49/119 (41%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GL+ +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLIGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + +  +          K+       + + P   +       +
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSE---------WKNLSAPAKTEQTQPAAPAKPTSDIPN 110


>gi|91776415|ref|YP_546171.1| preprotein translocase subunit SecG [Methylobacillus flagellatus
           KT]
 gi|91710402|gb|ABE50330.1| protein translocase subunit secG [Methylobacillus flagellatus KT]
          Length = 111

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/111 (19%), Positives = 48/111 (43%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M+  + V+H+I  +G+V ++L+Q    +        G+S +   V  +++ + R TAI  
Sbjct: 1   METIVTVIHVIAALGVVALVLLQHGKGADMGAAFGSGASGSLFGVSGSSNFMSRATAICV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS++L  ++ + S +        +  +            S+  +  
Sbjct: 61  AIFFVTSMSLAYLASHRSEQGSVVQKSVVKSAPASDVPKPAEPTSAKDVPQ 111


>gi|307546730|ref|YP_003899209.1| hypothetical protein HELO_4140 [Halomonas elongata DSM 2581]
 gi|307218754|emb|CBV44024.1| hypothetical protein predicted by Glimmer/Critica [Halomonas
           elongata DSM 2581]
          Length = 120

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 46/113 (40%), Gaps = 6/113 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           MQ+ ++++H+ + + LV +IL+Q    +        G+S      R +   L R TA+LA
Sbjct: 1   MQVAILMIHVAIAIALVALILLQQGKGADAGASFGGGASQTVFGSRGSGSFLSRATAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             FFATS+ L   +       ++          +        D  +   ++  
Sbjct: 61  AAFFATSLTLAYFASQAGEAPEEVGIPDAEVVEQQSAEPTLDDKGNGADNAAP 113


>gi|251791038|ref|YP_003005759.1| preprotein translocase subunit SecG [Dickeya zeae Ech1591]
 gi|247539659|gb|ACT08280.1| preprotein translocase, SecG subunit [Dickeya zeae Ech1591]
          Length = 111

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/107 (25%), Positives = 48/107 (44%), Gaps = 8/107 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V +GLV +I++Q    +        G+S+       + + + R TA+ A
Sbjct: 1   MYEALLVIFLLVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALFA 60

Query: 55  FFFFATSIALGMISRYTSTRYK--DNMHRSLVDSIKDQGNDNFGDGS 99
             FF  S+ LG +S   S +    DN+ + +     +Q        S
Sbjct: 61  TLFFVLSLILGNMSSDHSKKGSGWDNLSQPVAPEKAEQSKAPAAPSS 107


>gi|260427354|ref|ZP_05781333.1| preprotein translocase subunit SecG [Citreicella sp. SE45]
 gi|260421846|gb|EEX15097.1| preprotein translocase subunit SecG [Citreicella sp. SE45]
          Length = 126

 Score = 69.0 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 4/116 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD--SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
           MQ  +++VHL++ + L+ V+L+Q S+      G      S R+ A +LG+ T ILA  F 
Sbjct: 1   MQNVILIVHLLLALSLIGVVLLQRSEGGGLGMGGGGGAMSQRAAATALGKITWILAICFI 60

Query: 59  ATSIALGMISRYTSTRYK--DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
           ATS+ L +++   ++     D +      + +          S     S S   +S
Sbjct: 61  ATSLTLTILAAQDASGVSVMDRLTGGAPAAEEPSTPGEIDTDSLLPPPSASGSETS 116


>gi|293416605|ref|ZP_06659244.1| protein-export membrane protein secG [Escherichia coli B185]
 gi|291431961|gb|EFF04944.1| protein-export membrane protein secG [Escherichia coli B185]
          Length = 110

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/119 (21%), Positives = 49/119 (41%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GL+ +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLIGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + +  +          ++       + + P   +       +
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSE---------WENLSAPAKTEQTQPAAPAKPTSDIPN 110


>gi|16762055|ref|NP_457672.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16766589|ref|NP_462204.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29143544|ref|NP_806886.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56415222|ref|YP_152297.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|167552062|ref|ZP_02345815.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167990144|ref|ZP_02571244.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168231900|ref|ZP_02656958.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168237991|ref|ZP_02663049.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168243125|ref|ZP_02668057.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168262698|ref|ZP_02684671.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168463486|ref|ZP_02697403.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168819641|ref|ZP_02831641.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194446778|ref|YP_002042549.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194448171|ref|YP_002047320.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194471973|ref|ZP_03077957.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194734665|ref|YP_002116240.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197250047|ref|YP_002148217.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197262591|ref|ZP_03162665.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197364152|ref|YP_002143789.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|198245348|ref|YP_002217264.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200388900|ref|ZP_03215512.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204928325|ref|ZP_03219525.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205354194|ref|YP_002227995.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207858541|ref|YP_002245192.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213029357|ref|ZP_03343804.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
 gi|213052985|ref|ZP_03345863.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213425429|ref|ZP_03358179.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213622801|ref|ZP_03375584.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213645862|ref|ZP_03375915.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213865086|ref|ZP_03387205.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|238910086|ref|ZP_04653923.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289825805|ref|ZP_06544973.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25306332|pir||AD0902 protein-export membrane protein [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16421850|gb|AAL22163.1| preprotein translocase IISP family protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|16504358|emb|CAD07810.1| protein-export membrane protein [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139178|gb|AAO70746.1| export membrane protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56129479|gb|AAV78985.1| protein-export membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|194405441|gb|ACF65663.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194406475|gb|ACF66694.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194458337|gb|EDX47176.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194710167|gb|ACF89388.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195633471|gb|EDX51885.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197095629|emb|CAR61197.1| protein-export membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197213750|gb|ACH51147.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197240846|gb|EDY23466.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197289167|gb|EDY28536.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197939864|gb|ACH77197.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199605998|gb|EDZ04543.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204322647|gb|EDZ07844.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205273975|emb|CAR38981.1| protein-export membrane protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205323209|gb|EDZ11048.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205331185|gb|EDZ17949.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205333739|gb|EDZ20503.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205337750|gb|EDZ24514.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205343277|gb|EDZ30041.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205348487|gb|EDZ35118.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206710344|emb|CAR34702.1| protein-export membrane protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|261248457|emb|CBG26294.1| protein-export membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|301159841|emb|CBW19360.1| protein-export membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312914317|dbj|BAJ38291.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320087737|emb|CBY97501.1| Protein-export membrane protein secG Preprotein translocase band 1
           subunit; P12 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321225975|gb|EFX51029.1| Preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322615296|gb|EFY12217.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618345|gb|EFY15236.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322622850|gb|EFY19694.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626828|gb|EFY23625.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322631397|gb|EFY28157.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635336|gb|EFY32050.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643335|gb|EFY39899.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647093|gb|EFY43594.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322648896|gb|EFY45341.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655088|gb|EFY51399.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657691|gb|EFY53959.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664187|gb|EFY60385.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322667470|gb|EFY63632.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674718|gb|EFY70810.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322675649|gb|EFY71722.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682285|gb|EFY78308.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322684888|gb|EFY80886.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323131651|gb|ADX19081.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323191865|gb|EFZ77113.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199024|gb|EFZ84121.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204276|gb|EFZ89285.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207623|gb|EFZ92570.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211324|gb|EFZ96168.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323214734|gb|EFZ99483.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221214|gb|EGA05640.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224045|gb|EGA08338.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323230306|gb|EGA14425.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323233282|gb|EGA17376.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323239319|gb|EGA23369.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323242430|gb|EGA26456.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323246940|gb|EGA30906.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323254127|gb|EGA37947.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255244|gb|EGA39021.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262707|gb|EGA46263.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323264017|gb|EGA47525.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269403|gb|EGA52858.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326625042|gb|EGE31387.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326629315|gb|EGE35658.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 110

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 48/118 (40%), Gaps = 15/118 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             FF  S+ LG I+   + +  +          ++       + + P   +       
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSE---------WENLSAPAKTEQTQPAAPAQPTSDIP 109


>gi|238787591|ref|ZP_04631389.1| Protein-export membrane protein secG [Yersinia frederiksenii ATCC
           33641]
 gi|238724378|gb|EEQ16020.1| Protein-export membrane protein secG [Yersinia frederiksenii ATCC
           33641]
          Length = 111

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 49/120 (40%), Gaps = 15/120 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L++ +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVIFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ LG +S     +  +          ++ G     + ++  +      S    
Sbjct: 61  TLFFVISLILGNMSTNQGNKGSE---------WENLGQPAKTEQTTAPVAPTKPSSDIPQ 111


>gi|226329686|ref|ZP_03805204.1| hypothetical protein PROPEN_03598 [Proteus penneri ATCC 35198]
 gi|225202872|gb|EEG85226.1| hypothetical protein PROPEN_03598 [Proteus penneri ATCC 35198]
          Length = 133

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/114 (22%), Positives = 50/114 (43%), Gaps = 6/114 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V+ +IV  GLV +IL+Q    +    +FG+ ++ T      +A+ + R TA+LA
Sbjct: 20  MYTALIVILIIVATGLVGLILLQQGKGADMGASFGAGASGTVFGSSGSANFMTRMTAVLA 79

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             F   ++ LG +S   + R           + + +  +      +P    +  
Sbjct: 80  TAFIVLALILGNLSANKTVREDSKWMSIEQTTEEAKKAEQLAAPVAPANTDIPQ 133


>gi|90412482|ref|ZP_01220485.1| putative protein export-membrane protein [Photobacterium
          profundum 3TCK]
 gi|90326519|gb|EAS42925.1| putative protein export-membrane protein [Photobacterium
          profundum 3TCK]
          Length = 111

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+V++L+  +G++ ++L+Q    +        G+S        + + L R T + A
Sbjct: 1  MYEILLVIYLLAALGVIGLVLVQQGKGADMGASFGAGASGTLFGASGSGNFLTRMTTVCA 60

Query: 55 FFFFATSIALGMISRYTSTRYK 76
            FF  S+ LG +S   ++   
Sbjct: 61 AIFFVISLVLGNMSAKQASEKS 82


>gi|296104886|ref|YP_003615032.1| preprotein translocase subunit SecG [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295059345|gb|ADF64083.1| preprotein translocase subunit SecG [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295097661|emb|CBK86751.1| protein translocase subunit secG [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 110

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 48/119 (40%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ LIV + LV +I++Q    +        G+S        +A+ + R TAILA
Sbjct: 1   MYEALLVIFLIVAIALVALIMLQQGKGADMGASFGAGASGTLFGSSGSANFMTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   +++  +          ++       + + P   +        
Sbjct: 61  TLFFIISLVLGNINSNKTSKGSE---------WENLSAPAKTEQTQPAAPAKPTSDIPQ 110


>gi|54307812|ref|YP_128832.1| putative protein export-membrane protein [Photobacterium
          profundum SS9]
 gi|46912235|emb|CAG19030.1| putative protein export-membrane protein [Photobacterium
          profundum SS9]
          Length = 111

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+V++L+  +G++ ++L+Q    +        G+S        + + L R T + A
Sbjct: 1  MYEILLVIYLLAALGVIGLVLVQQGKGADMGASFGAGASGTLFGASGSGNFLTRMTTVCA 60

Query: 55 FFFFATSIALGMISRYTSTRYK 76
            FF  S+ LG +S   ++   
Sbjct: 61 AIFFVISLVLGNMSAKQASEKS 82


>gi|152972099|ref|YP_001337245.1| preprotein translocase subunit SecG [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|206580958|ref|YP_002236413.1| preprotein translocase, SecG subunit [Klebsiella pneumoniae 342]
 gi|288933397|ref|YP_003437456.1| preprotein translocase subunit G [Klebsiella variicola At-22]
 gi|329997756|ref|ZP_08302906.1| preprotein translocase, SecG subunit [Klebsiella sp. MS 92-3]
 gi|150956948|gb|ABR78978.1| protein-export membrane protein [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|206570016|gb|ACI11792.1| preprotein translocase, SecG subunit [Klebsiella pneumoniae 342]
 gi|288888126|gb|ADC56444.1| preprotein translocase, SecG subunit [Klebsiella variicola At-22]
 gi|328538916|gb|EGF64976.1| preprotein translocase, SecG subunit [Klebsiella sp. MS 92-3]
          Length = 109

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+VV LIV +GLV ++++Q    +        G+S        + + + R T ILA
Sbjct: 1  MYEALLVVFLIVAIGLVGLVMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTGILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
            FF  S+ALG I+   +++  +  + S   + + Q
Sbjct: 61 ALFFIISLALGNINSNKTSKGSEWDNLSAPKTEQTQ 96


>gi|89095217|ref|ZP_01168140.1| Preprotein translocase SecG subunit [Oceanospirillum sp. MED92]
 gi|89080514|gb|EAR59763.1| Preprotein translocase SecG subunit [Oceanospirillum sp. MED92]
          Length = 130

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 53/127 (41%), Gaps = 6/127 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M+  ++++H+++   ++ +IL+Q    +    +FG+ ++ T      + + L R TAI+A
Sbjct: 1   METVVLIIHVLLAAAIIGLILLQQGKGAEAGASFGAGASQTVFGSTGSGNFLSRMTAIVA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
              FATS  L + ++  +    D    S          D        +L ++     + V
Sbjct: 61  AGIFATSFVLAVYAKNKADTVSDAGIPSAEVIESRAAADAAAAEDQAQLPALEESKPAEV 120

Query: 115 VAGKRSS 121
            A     
Sbjct: 121 PAESDIP 127


>gi|15833308|ref|NP_312081.1| preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           Sakai]
 gi|16131065|ref|NP_417642.1| preprotein translocase membrane subunit [Escherichia coli str. K-12
           substr. MG1655]
 gi|74313712|ref|YP_312131.1| preprotein translocase subunit SecG [Shigella sonnei Ss046]
 gi|89109938|ref|AP_003718.1| preprotein translocase membrane subunit [Escherichia coli str. K-12
           substr. W3110]
 gi|110643415|ref|YP_671145.1| preprotein translocase subunit SecG [Escherichia coli 536]
 gi|117625469|ref|YP_858792.1| preprotein translocase subunit SecG [Escherichia coli APEC O1]
 gi|161486108|ref|NP_755798.2| preprotein translocase subunit SecG [Escherichia coli CFT073]
 gi|162138366|ref|YP_542582.2| preprotein translocase subunit SecG [Escherichia coli UTI89]
 gi|168749232|ref|ZP_02774254.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4113]
 gi|168754154|ref|ZP_02779161.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4401]
 gi|168762139|ref|ZP_02787146.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4501]
 gi|168769591|ref|ZP_02794598.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773160|ref|ZP_02798167.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4196]
 gi|168781316|ref|ZP_02806323.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4076]
 gi|168786058|ref|ZP_02811065.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC869]
 gi|168797774|ref|ZP_02822781.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC508]
 gi|170082710|ref|YP_001732030.1| preprotein translocase membrane subunit [Escherichia coli str. K-12
           substr. DH10B]
 gi|187733049|ref|YP_001881910.1| preprotein translocase subunit SecG [Shigella boydii CDC 3083-94]
 gi|191172219|ref|ZP_03033762.1| preprotein translocase, SecG subunit [Escherichia coli F11]
 gi|193062136|ref|ZP_03043232.1| preprotein translocase, SecG subunit [Escherichia coli E22]
 gi|194430232|ref|ZP_03062730.1| preprotein translocase, SecG subunit [Escherichia coli B171]
 gi|194433719|ref|ZP_03065994.1| preprotein translocase, SecG subunit [Shigella dysenteriae 1012]
 gi|195938393|ref|ZP_03083775.1| preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           EC4024]
 gi|208806607|ref|ZP_03248944.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4206]
 gi|208814133|ref|ZP_03255462.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4045]
 gi|208818987|ref|ZP_03259307.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4042]
 gi|209400768|ref|YP_002272645.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4115]
 gi|215488491|ref|YP_002330922.1| preprotein translocase subunit SecG [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217326643|ref|ZP_03442726.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           TW14588]
 gi|218550458|ref|YP_002384249.1| preprotein translocase subunit SecG [Escherichia fergusonii ATCC
           35469]
 gi|218555745|ref|YP_002388658.1| preprotein translocase subunit SecG [Escherichia coli IAI1]
 gi|218560245|ref|YP_002393158.1| preprotein translocase subunit SecG [Escherichia coli S88]
 gi|218691465|ref|YP_002399677.1| preprotein translocase subunit SecG [Escherichia coli ED1a]
 gi|218696880|ref|YP_002404547.1| preprotein translocase subunit SecG [Escherichia coli 55989]
 gi|218701944|ref|YP_002409573.1| preprotein translocase subunit SecG [Escherichia coli IAI39]
 gi|218706795|ref|YP_002414314.1| preprotein translocase subunit SecG [Escherichia coli UMN026]
 gi|227887896|ref|ZP_04005701.1| Sec family type II general secretory pathway preprotein translocase
           SecG [Escherichia coli 83972]
 gi|238902277|ref|YP_002928073.1| preprotein translocase membrane subunit [Escherichia coli BW2952]
 gi|254795124|ref|YP_003079961.1| preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           TW14359]
 gi|256024251|ref|ZP_05438116.1| preprotein translocase subunit SecG [Escherichia sp. 4_1_40B]
 gi|260845988|ref|YP_003223766.1| preprotein translocase membrane subunit [Escherichia coli O103:H2
           str. 12009]
 gi|261228185|ref|ZP_05942466.1| preprotein translocase membrane subunit [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261255041|ref|ZP_05947574.1| preprotein translocase membrane subunit [Escherichia coli O157:H7
           str. FRIK966]
 gi|291284549|ref|YP_003501367.1| Preprotein translocase IISP family, auxillary membrane component
           [Escherichia coli O55:H7 str. CB9615]
 gi|293406784|ref|ZP_06650710.1| protein-export membrane protein secG [Escherichia coli FVEC1412]
 gi|293412547|ref|ZP_06655270.1| preprotein translocase subunit SecG [Escherichia coli B354]
 gi|298382525|ref|ZP_06992122.1| preprotein translocase SecG subunit [Escherichia coli FVEC1302]
 gi|300897939|ref|ZP_07116318.1| preprotein translocase, SecG subunit [Escherichia coli MS 198-1]
 gi|300918931|ref|ZP_07135490.1| preprotein translocase, SecG subunit [Escherichia coli MS 115-1]
 gi|300938085|ref|ZP_07152863.1| preprotein translocase, SecG subunit [Escherichia coli MS 21-1]
 gi|300948824|ref|ZP_07162892.1| preprotein translocase, SecG subunit [Escherichia coli MS 116-1]
 gi|300955760|ref|ZP_07168105.1| preprotein translocase, SecG subunit [Escherichia coli MS 175-1]
 gi|300980133|ref|ZP_07174853.1| preprotein translocase, SecG subunit [Escherichia coli MS 200-1]
 gi|300990776|ref|ZP_07179348.1| preprotein translocase, SecG subunit [Escherichia coli MS 45-1]
 gi|301022030|ref|ZP_07185973.1| preprotein translocase, SecG subunit [Escherichia coli MS 69-1]
 gi|301025981|ref|ZP_07189463.1| preprotein translocase, SecG subunit [Escherichia coli MS 196-1]
 gi|301047982|ref|ZP_07195024.1| preprotein translocase, SecG subunit [Escherichia coli MS 185-1]
 gi|301644885|ref|ZP_07244857.1| preprotein translocase, SecG subunit [Escherichia coli MS 146-1]
 gi|307139860|ref|ZP_07499216.1| preprotein translocase subunit SecG [Escherichia coli H736]
 gi|312968488|ref|ZP_07782697.1| preprotein translocase, SecG subunit [Escherichia coli 2362-75]
 gi|331643873|ref|ZP_08345004.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli H736]
 gi|331648975|ref|ZP_08350063.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli M605]
 gi|331654779|ref|ZP_08355779.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli M718]
 gi|331659462|ref|ZP_08360404.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli TA206]
 gi|331664787|ref|ZP_08365692.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli TA143]
 gi|331684822|ref|ZP_08385414.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli H299]
 gi|84028696|sp|P0AGA1|SECG_ECO57 RecName: Full=Protein-export membrane protein secG; AltName:
           Full=P12; AltName: Full=Preprotein translocase band 1
           subunit
 gi|84028697|sp|P0AGA0|SECG_ECOL6 RecName: Full=Protein-export membrane protein secG; AltName:
           Full=P12; AltName: Full=Preprotein translocase band 1
           subunit
 gi|84028698|sp|P0AG99|SECG_ECOLI RecName: Full=Protein-export membrane protein SecG; AltName:
           Full=P12; AltName: Full=Preprotein translocase band 1
           subunit
 gi|431135|dbj|BAA03930.1| p12 [Escherichia coli]
 gi|606113|gb|AAA57976.1| p12 [Escherichia coli str. K-12 substr. MG1655]
 gi|746404|gb|AAA97511.1| membrane protein [Escherichia coli]
 gi|1789565|gb|AAC76207.1| preprotein translocase membrane subunit [Escherichia coli str. K-12
           substr. MG1655]
 gi|13363527|dbj|BAB37477.1| protein-export protein SecG [Escherichia coli O157:H7 str. Sakai]
 gi|73857189|gb|AAZ89896.1| SecG [Shigella sonnei Ss046]
 gi|85675969|dbj|BAE77219.1| preprotein translocase membrane subunit [Escherichia coli str. K12
           substr. W3110]
 gi|110345007|gb|ABG71244.1| protein-export membrane protein SecG [Escherichia coli 536]
 gi|115514593|gb|ABJ02668.1| putative export membrane protein [Escherichia coli APEC O1]
 gi|169890545|gb|ACB04252.1| preprotein translocase membrane subunit [Escherichia coli str. K-12
           substr. DH10B]
 gi|187430041|gb|ACD09315.1| preprotein translocase, SecG subunit [Shigella boydii CDC 3083-94]
 gi|187770894|gb|EDU34738.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4196]
 gi|188016351|gb|EDU54473.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4113]
 gi|189001111|gb|EDU70097.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4076]
 gi|189358577|gb|EDU76996.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4401]
 gi|189361469|gb|EDU79888.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4486]
 gi|189367573|gb|EDU85989.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4501]
 gi|189373954|gb|EDU92370.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC869]
 gi|189379688|gb|EDU98104.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC508]
 gi|190907529|gb|EDV67125.1| preprotein translocase, SecG subunit [Escherichia coli F11]
 gi|192932356|gb|EDV84954.1| preprotein translocase, SecG subunit [Escherichia coli E22]
 gi|194411733|gb|EDX28057.1| preprotein translocase, SecG subunit [Escherichia coli B171]
 gi|194417982|gb|EDX34076.1| preprotein translocase, SecG subunit [Shigella dysenteriae 1012]
 gi|208726408|gb|EDZ76009.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4206]
 gi|208735410|gb|EDZ84097.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4045]
 gi|208739110|gb|EDZ86792.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4042]
 gi|209162168|gb|ACI39601.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4115]
 gi|209758288|gb|ACI77456.1| protein-export protein SecG [Escherichia coli]
 gi|209758290|gb|ACI77457.1| protein-export protein SecG [Escherichia coli]
 gi|209758292|gb|ACI77458.1| protein-export protein SecG [Escherichia coli]
 gi|209758294|gb|ACI77459.1| protein-export protein SecG [Escherichia coli]
 gi|209758296|gb|ACI77460.1| protein-export protein SecG [Escherichia coli]
 gi|215266563|emb|CAS11002.1| preprotein translocase membrane subunit [Escherichia coli O127:H6
           str. E2348/69]
 gi|217319010|gb|EEC27435.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           TW14588]
 gi|218353612|emb|CAU99807.1| preprotein translocase membrane subunit [Escherichia coli 55989]
 gi|218357999|emb|CAQ90645.1| preprotein translocase membrane subunit [Escherichia fergusonii
           ATCC 35469]
 gi|218362513|emb|CAR00137.1| preprotein translocase membrane subunit [Escherichia coli IAI1]
 gi|218367014|emb|CAR04785.1| preprotein translocase membrane subunit [Escherichia coli S88]
 gi|218371930|emb|CAR19786.1| preprotein translocase membrane subunit [Escherichia coli IAI39]
 gi|218429029|emb|CAR09976.2| preprotein translocase membrane subunit [Escherichia coli ED1a]
 gi|218433892|emb|CAR14809.1| preprotein translocase membrane subunit [Escherichia coli UMN026]
 gi|227835292|gb|EEJ45758.1| Sec family type II general secretory pathway preprotein translocase
           SecG [Escherichia coli 83972]
 gi|238863271|gb|ACR65269.1| preprotein translocase membrane subunit [Escherichia coli BW2952]
 gi|254594524|gb|ACT73885.1| preprotein translocase membrane subunit [Escherichia coli O157:H7
           str. TW14359]
 gi|257761135|dbj|BAI32632.1| preprotein translocase membrane subunit [Escherichia coli O103:H2
           str. 12009]
 gi|260447798|gb|ACX38220.1| preprotein translocase, SecG subunit [Escherichia coli DH1]
 gi|281180217|dbj|BAI56547.1| preprotein translocase [Escherichia coli SE15]
 gi|284923198|emb|CBG36292.1| protein-export membrane protein [Escherichia coli 042]
 gi|290764422|gb|ADD58383.1| Preprotein translocase IISP family, auxillary membrane component
           [Escherichia coli O55:H7 str. CB9615]
 gi|291426790|gb|EFE99822.1| protein-export membrane protein secG [Escherichia coli FVEC1412]
 gi|291469318|gb|EFF11809.1| preprotein translocase subunit SecG [Escherichia coli B354]
 gi|294493447|gb|ADE92203.1| preprotein translocase, SecG subunit [Escherichia coli IHE3034]
 gi|298277665|gb|EFI19181.1| preprotein translocase SecG subunit [Escherichia coli FVEC1302]
 gi|299879876|gb|EFI88087.1| preprotein translocase, SecG subunit [Escherichia coli MS 196-1]
 gi|300300125|gb|EFJ56510.1| preprotein translocase, SecG subunit [Escherichia coli MS 185-1]
 gi|300307855|gb|EFJ62375.1| preprotein translocase, SecG subunit [Escherichia coli MS 200-1]
 gi|300317393|gb|EFJ67177.1| preprotein translocase, SecG subunit [Escherichia coli MS 175-1]
 gi|300358369|gb|EFJ74239.1| preprotein translocase, SecG subunit [Escherichia coli MS 198-1]
 gi|300397745|gb|EFJ81283.1| preprotein translocase, SecG subunit [Escherichia coli MS 69-1]
 gi|300407084|gb|EFJ90622.1| preprotein translocase, SecG subunit [Escherichia coli MS 45-1]
 gi|300413957|gb|EFJ97267.1| preprotein translocase, SecG subunit [Escherichia coli MS 115-1]
 gi|300451713|gb|EFK15333.1| preprotein translocase, SecG subunit [Escherichia coli MS 116-1]
 gi|300456945|gb|EFK20438.1| preprotein translocase, SecG subunit [Escherichia coli MS 21-1]
 gi|301076830|gb|EFK91636.1| preprotein translocase, SecG subunit [Escherichia coli MS 146-1]
 gi|307555269|gb|ADN48044.1| protein-export membrane protein SecG [Escherichia coli ABU 83972]
 gi|307625226|gb|ADN69530.1| preprotein translocase subunit SecG [Escherichia coli UM146]
 gi|309703601|emb|CBJ02941.1| protein-export membrane protein [Escherichia coli ETEC H10407]
 gi|312286706|gb|EFR14617.1| preprotein translocase, SecG subunit [Escherichia coli 2362-75]
 gi|315137761|dbj|BAJ44920.1| preprotein translocase IISP family [Escherichia coli DH1]
 gi|315288923|gb|EFU48321.1| preprotein translocase, SecG subunit [Escherichia coli MS 110-3]
 gi|315294921|gb|EFU54260.1| preprotein translocase, SecG subunit [Escherichia coli MS 153-1]
 gi|315297874|gb|EFU57144.1| preprotein translocase, SecG subunit [Escherichia coli MS 16-3]
 gi|320174539|gb|EFW49675.1| Preprotein translocase subunit SecG [Shigella dysenteriae CDC
           74-1112]
 gi|320181450|gb|EFW56368.1| Preprotein translocase subunit SecG [Shigella boydii ATCC 9905]
 gi|320186662|gb|EFW61386.1| Preprotein translocase subunit SecG [Shigella flexneri CDC 796-83]
 gi|320189528|gb|EFW64187.1| Preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           EC1212]
 gi|320194660|gb|EFW69290.1| Preprotein translocase subunit SecG [Escherichia coli WV_060327]
 gi|320640245|gb|EFX09817.1| preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           G5101]
 gi|320645542|gb|EFX14551.1| preprotein translocase subunit SecG [Escherichia coli O157:H- str.
           493-89]
 gi|320650852|gb|EFX19309.1| preprotein translocase subunit SecG [Escherichia coli O157:H- str.
           H 2687]
 gi|320656233|gb|EFX24145.1| preprotein translocase subunit SecG [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661923|gb|EFX29331.1| preprotein translocase subunit SecG [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320666758|gb|EFX33737.1| preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323162867|gb|EFZ48702.1| preprotein translocase, SecG subunit [Escherichia coli E128010]
 gi|323165134|gb|EFZ50924.1| preprotein translocase, SecG subunit [Shigella sonnei 53G]
 gi|323173565|gb|EFZ59194.1| preprotein translocase, SecG subunit [Escherichia coli LT-68]
 gi|323183129|gb|EFZ68527.1| preprotein translocase, SecG subunit [Escherichia coli 1357]
 gi|323189204|gb|EFZ74488.1| preprotein translocase, SecG subunit [Escherichia coli RN587/1]
 gi|323936131|gb|EGB32425.1| preprotein translocase SecG [Escherichia coli E1520]
 gi|323951306|gb|EGB47181.1| preprotein translocase SecG subunit [Escherichia coli H252]
 gi|323957678|gb|EGB53392.1| preprotein translocase SecG subunit [Escherichia coli H263]
 gi|323966355|gb|EGB61789.1| preprotein translocase SecG subunit [Escherichia coli M863]
 gi|323979108|gb|EGB74186.1| preprotein translocase SecG subunit [Escherichia coli TW10509]
 gi|324012098|gb|EGB81317.1| preprotein translocase, SecG subunit [Escherichia coli MS 60-1]
 gi|324115221|gb|EGC09185.1| preprotein translocase SecG subunit [Escherichia fergusonii B253]
 gi|324119540|gb|EGC13422.1| preprotein translocase SecG subunit [Escherichia coli E1167]
 gi|326337875|gb|EGD61709.1| Preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           1125]
 gi|326347445|gb|EGD71170.1| Preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           1044]
 gi|330909229|gb|EGH37743.1| preprotein translocase subunit SecG [Escherichia coli AA86]
 gi|331037344|gb|EGI09568.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli H736]
 gi|331042722|gb|EGI14864.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli M605]
 gi|331048161|gb|EGI20238.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli M718]
 gi|331054044|gb|EGI26073.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli TA206]
 gi|331058035|gb|EGI30017.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli TA143]
 gi|331078437|gb|EGI49643.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli H299]
 gi|332086095|gb|EGI91257.1| preprotein translocase, SecG subunit [Shigella boydii 5216-82]
          Length = 110

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 49/119 (41%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + +  +          ++       + + P   +       +
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSE---------WENLSAPAKTEQTQPAAPAKPTSDIPN 110


>gi|312170902|emb|CBX79161.1| Protein-export membrane protein secG [Erwinia amylovora ATCC
           BAA-2158]
          Length = 110

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 46/119 (38%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S        + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + +  +          ++         + P   +        
Sbjct: 61  TLFFIISLILGNINSNKTQKGSE---------WENLTQPAQSKQTQPAKPATPGSDIPQ 110


>gi|86148841|ref|ZP_01067103.1| translocase [Vibrio sp. MED222]
 gi|85833368|gb|EAQ51564.1| translocase [Vibrio sp. MED222]
          Length = 110

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
          M   L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1  MFTVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFA 60

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF  S+ LG +S + +  
Sbjct: 61 TTFFILSLVLGNMSTHKTES 80


>gi|197287227|ref|YP_002153099.1| protein-export membrane protein [Proteus mirabilis HI4320]
 gi|227357078|ref|ZP_03841448.1| Sec family type II general secretory pathway preprotein translocase
           SecG [Proteus mirabilis ATCC 29906]
 gi|194684714|emb|CAR46694.1| protein-export membrane protein [Proteus mirabilis HI4320]
 gi|227162770|gb|EEI47733.1| Sec family type II general secretory pathway preprotein translocase
           SecG [Proteus mirabilis ATCC 29906]
          Length = 114

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 48/114 (42%), Gaps = 6/114 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+V+ +I   GLV +IL+Q    +    +FG+ ++ T      +A+ + R TA+LA
Sbjct: 1   MYTALIVILIIAATGLVGLILLQQGKGADMGASFGAGASGTVFGSSGSANFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             F    + LG +S   + R           + + +  +      +P    +  
Sbjct: 61  TVFIVLCLILGNLSANKTVREDSKWMSIEQTAEEAKKAEQLAAPVAPANTDIPQ 114


>gi|260459246|ref|ZP_05807501.1| preprotein translocase, SecG subunit [Mesorhizobium opportunistum
           WSM2075]
 gi|259034800|gb|EEW36056.1| preprotein translocase, SecG subunit [Mesorhizobium opportunistum
           WSM2075]
          Length = 158

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 60/123 (48%), Gaps = 9/123 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL+VV+ LV V+L+Q S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMVVLALVGVVLLQRSEGGGLGIGGGSGFMTARGAANALTRATAILAAAFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
            TS+ L +I+RY   +  D + R    S +       G G   +L   +  + +      
Sbjct: 61  VTSLTLSIIARY-GEKPIDILDRVPATSGE------AGKGVLNQLPGTTTPAPAGNATPT 113

Query: 119 RSS 121
             S
Sbjct: 114 PPS 116


>gi|83593223|ref|YP_426975.1| protein translocase subunit secG [Rhodospirillum rubrum ATCC 11170]
 gi|83576137|gb|ABC22688.1| protein translocase subunit secG [Rhodospirillum rubrum ATCC 11170]
          Length = 146

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 46/116 (39%), Gaps = 2/116 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV--RSTAHSLGRFTAILAFFFF 58
           M   ++V+HL++ + +V +IL+Q S+  A G       +  R   + L R T ILA  F 
Sbjct: 1   MITVILVIHLLIAIAMVTLILLQRSEGGALGIGGGGGFMTGRQAGNVLTRTTGILAAAFM 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
            TS+ L +++      +   +    + SI         D         +    S  
Sbjct: 61  TTSMLLALLANKGEDGFSHILDSIDLPSINSLIGGESKDAPEAGTPVEAPAGDSGA 116


>gi|157155933|ref|YP_001464650.1| preprotein translocase subunit SecG [Escherichia coli E24377A]
 gi|157162658|ref|YP_001459976.1| preprotein translocase subunit SecG [Escherichia coli HS]
 gi|170018575|ref|YP_001723529.1| preprotein translocase subunit SecG [Escherichia coli ATCC 8739]
 gi|188492818|ref|ZP_03000088.1| preprotein translocase, SecG subunit [Escherichia coli 53638]
 gi|191168047|ref|ZP_03029847.1| preprotein translocase, SecG subunit [Escherichia coli B7A]
 gi|193067481|ref|ZP_03048449.1| preprotein translocase, SecG subunit [Escherichia coli E110019]
 gi|194438755|ref|ZP_03070841.1| preprotein translocase, SecG subunit [Escherichia coli 101-1]
 gi|209920650|ref|YP_002294734.1| preprotein translocase subunit SecG [Escherichia coli SE11]
 gi|253771991|ref|YP_003034822.1| preprotein translocase subunit SecG [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254163117|ref|YP_003046225.1| preprotein translocase subunit SecG [Escherichia coli B str.
           REL606]
 gi|256018907|ref|ZP_05432772.1| preprotein translocase subunit SecG [Shigella sp. D9]
 gi|260857302|ref|YP_003231193.1| preprotein translocase membrane subunit [Escherichia coli O26:H11
           str. 11368]
 gi|260869926|ref|YP_003236328.1| preprotein translocase membrane subunit [Escherichia coli O111:H-
           str. 11128]
 gi|293449509|ref|ZP_06663930.1| preprotein translocase SecG subunit [Escherichia coli B088]
 gi|297518209|ref|ZP_06936595.1| preprotein translocase subunit SecG [Escherichia coli OP50]
 gi|300817573|ref|ZP_07097789.1| preprotein translocase, SecG subunit [Escherichia coli MS 107-1]
 gi|300823862|ref|ZP_07103986.1| preprotein translocase, SecG subunit [Escherichia coli MS 119-7]
 gi|300904360|ref|ZP_07122213.1| preprotein translocase, SecG subunit [Escherichia coli MS 84-1]
 gi|300926086|ref|ZP_07141904.1| preprotein translocase, SecG subunit [Escherichia coli MS 182-1]
 gi|300929865|ref|ZP_07145311.1| preprotein translocase, SecG subunit [Escherichia coli MS 187-1]
 gi|301301768|ref|ZP_07207902.1| preprotein translocase, SecG subunit [Escherichia coli MS 124-1]
 gi|301326403|ref|ZP_07219757.1| preprotein translocase, SecG subunit [Escherichia coli MS 78-1]
 gi|307313120|ref|ZP_07592746.1| preprotein translocase, SecG subunit [Escherichia coli W]
 gi|309793752|ref|ZP_07688178.1| preprotein translocase, SecG subunit [Escherichia coli MS 145-7]
 gi|312972551|ref|ZP_07786725.1| preprotein translocase, SecG subunit [Escherichia coli 1827-70]
 gi|331670002|ref|ZP_08370847.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli TA271]
 gi|331679254|ref|ZP_08379926.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli H591]
 gi|157068338|gb|ABV07593.1| preprotein translocase, SecG subunit [Escherichia coli HS]
 gi|157077963|gb|ABV17671.1| preprotein translocase, SecG subunit [Escherichia coli E24377A]
 gi|169753503|gb|ACA76202.1| preprotein translocase, SecG subunit [Escherichia coli ATCC 8739]
 gi|188488017|gb|EDU63120.1| preprotein translocase, SecG subunit [Escherichia coli 53638]
 gi|190901916|gb|EDV61665.1| preprotein translocase, SecG subunit [Escherichia coli B7A]
 gi|192959438|gb|EDV89873.1| preprotein translocase, SecG subunit [Escherichia coli E110019]
 gi|194422227|gb|EDX38228.1| preprotein translocase, SecG subunit [Escherichia coli 101-1]
 gi|209913909|dbj|BAG78983.1| preprotein translocase [Escherichia coli SE11]
 gi|242378718|emb|CAQ33508.1| secG, subunit of SecEGY-Secretion Complex and Sec Protein Secretion
           Complex [Escherichia coli BL21(DE3)]
 gi|253323035|gb|ACT27637.1| preprotein translocase, SecG subunit [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975018|gb|ACT40689.1| protein-export membrane protein [Escherichia coli B str. REL606]
 gi|253979174|gb|ACT44844.1| protein-export membrane protein [Escherichia coli BL21(DE3)]
 gi|257755951|dbj|BAI27453.1| preprotein translocase membrane subunit [Escherichia coli O26:H11
           str. 11368]
 gi|257766282|dbj|BAI37777.1| preprotein translocase membrane subunit [Escherichia coli O111:H-
           str. 11128]
 gi|291322599|gb|EFE62028.1| preprotein translocase SecG subunit [Escherichia coli B088]
 gi|300403711|gb|EFJ87249.1| preprotein translocase, SecG subunit [Escherichia coli MS 84-1]
 gi|300417851|gb|EFK01162.1| preprotein translocase, SecG subunit [Escherichia coli MS 182-1]
 gi|300462227|gb|EFK25720.1| preprotein translocase, SecG subunit [Escherichia coli MS 187-1]
 gi|300523630|gb|EFK44699.1| preprotein translocase, SecG subunit [Escherichia coli MS 119-7]
 gi|300529871|gb|EFK50933.1| preprotein translocase, SecG subunit [Escherichia coli MS 107-1]
 gi|300842749|gb|EFK70509.1| preprotein translocase, SecG subunit [Escherichia coli MS 124-1]
 gi|300846892|gb|EFK74652.1| preprotein translocase, SecG subunit [Escherichia coli MS 78-1]
 gi|306907031|gb|EFN37539.1| preprotein translocase, SecG subunit [Escherichia coli W]
 gi|308122709|gb|EFO59971.1| preprotein translocase, SecG subunit [Escherichia coli MS 145-7]
 gi|310334928|gb|EFQ01133.1| preprotein translocase, SecG subunit [Escherichia coli 1827-70]
 gi|315062481|gb|ADT76808.1| preprotein translocase membrane subunit [Escherichia coli W]
 gi|315257100|gb|EFU37068.1| preprotein translocase, SecG subunit [Escherichia coli MS 85-1]
 gi|320202089|gb|EFW76664.1| Preprotein translocase subunit SecG [Escherichia coli EC4100B]
 gi|323154388|gb|EFZ40589.1| preprotein translocase, SecG subunit [Escherichia coli EPECa14]
 gi|323178649|gb|EFZ64225.1| preprotein translocase, SecG subunit [Escherichia coli 1180]
 gi|323941725|gb|EGB37904.1| preprotein translocase SecG subunit [Escherichia coli E482]
 gi|323946971|gb|EGB42987.1| preprotein translocase SecG [Escherichia coli H120]
 gi|323961170|gb|EGB56784.1| preprotein translocase SecG subunit [Escherichia coli H489]
 gi|323970262|gb|EGB65533.1| preprotein translocase SecG subunit [Escherichia coli TA007]
 gi|324018300|gb|EGB87519.1| preprotein translocase, SecG subunit [Escherichia coli MS 117-3]
 gi|331062915|gb|EGI34829.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli TA271]
 gi|331073319|gb|EGI44642.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli H591]
 gi|332102347|gb|EGJ05693.1| preprotein translocase subunit SecG [Shigella sp. D9]
          Length = 110

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 49/119 (41%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + +  +          ++       + + P   +       +
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSE---------WENLSAPVKTEQTQPAAPAKPTSDIPN 110


>gi|296116176|ref|ZP_06834794.1| preprotein translocase, SecG subunit [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295977282|gb|EFG84042.1| preprotein translocase, SecG subunit [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 101

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 31/115 (26%), Positives = 50/115 (43%), Gaps = 20/115 (17%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS-----SNFTSVRSTAHSLGRFTAILAF 55
           M   L+++HL V V L+  ILIQ S+    G        +F S R TA  L R TA+L  
Sbjct: 1   MITVLLLLHLFVTVALIGTILIQRSEGGGLGIGSSQGMGSFMSGRGTATLLTRSTAVLGT 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
            F   S+ L +++R  S+                 G+D     ++P + + +  +
Sbjct: 61  IFMVLSLTLAIMNRGASSGV---------------GHDILAQPAAPSVPATTTPA 100


>gi|77457003|ref|YP_346508.1| preprotein translocase subunit SecG [Pseudomonas fluorescens Pf0-1]
 gi|77381006|gb|ABA72519.1| general secretory pathway, protein-export membrane protein
           [Pseudomonas fluorescens Pf0-1]
          Length = 127

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 56/127 (44%), Gaps = 8/127 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +    +FG+ ++ T      ++  L +FTAILA
Sbjct: 2   LETVVVVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGSQGSSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ LG  ++  + +       +       +          P L    + + ++ 
Sbjct: 62  AGFFITSLGLGYFAKEKAHQLTQAGLPNPAVLEVPKQQP--ASDDVPVLQEQKSATPATD 119

Query: 115 VAGKRSS 121
           V   +  
Sbjct: 120 VPPAQEQ 126


>gi|91792364|ref|YP_562015.1| preprotein translocase subunit SecG [Shewanella denitrificans
          OS217]
 gi|91714366|gb|ABE54292.1| protein translocase subunit secG [Shewanella denitrificans OS217]
          Length = 110

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 6/82 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   LMVV+L+V +GLV +ILIQ    +        G+S        + + L R TA+LA
Sbjct: 1  MYEVLMVVYLMVSIGLVGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAVLA 60

Query: 55 FFFFATSIALGMISRYTSTRYK 76
            FFA S+ +G +S     +  
Sbjct: 61 IGFFALSLIIGNLSANHVKQGD 82


>gi|85058352|ref|YP_454054.1| preprotein translocase subunit SecG [Sodalis glossinidius str.
           'morsitans']
 gi|84778872|dbj|BAE73649.1| protein-export protein SecG [Sodalis glossinidius str. 'morsitans']
          Length = 110

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 46/110 (41%), Gaps = 9/110 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V VGLV +I++Q    +        G+S        + + + R TA+LA
Sbjct: 1   MYQALLVIFLLVAVGLVALIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG +S     +     +   ++  +          + P  D
Sbjct: 61  TLFFVLSLVLGNLSSNHGQKGSQWDN---LNQAQQADKAPAEAPAKPGND 107


>gi|257095320|ref|YP_003168961.1| preprotein translocase subunit SecG [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047844|gb|ACV37032.1| preprotein translocase, SecG subunit [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 123

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 53/117 (45%), Gaps = 10/117 (8%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
             ++VVH++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA  
Sbjct: 6   SAVLVVHILAAMGVIGLVLVQHGKGADMGAAFGSGASGSLFGATGSANFLSRATAVLATV 65

Query: 57  FFATSIALGMIS----RYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
           FF TS++L  I+    + T +  +D ++ + V        D     + P   +    
Sbjct: 66  FFVTSLSLAYIASSKPKTTGSVMQDAVNSTPVPVPPAGSVDKPASPADPDSKAKDIP 122


>gi|317046738|ref|YP_004114386.1| preprotein translocase subunit SecG [Pantoea sp. At-9b]
 gi|316948355|gb|ADU67830.1| preprotein translocase, SecG subunit [Pantoea sp. At-9b]
          Length = 110

 Score = 68.3 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/119 (21%), Positives = 49/119 (41%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVALGLVGLIMLQQGKGADMGASFGAGASATLFGSTGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG ++   +++  +          ++       + + P   +        
Sbjct: 61  TLFFIISLILGNLNTNKTSKGSE---------WENLTAPAKSEQTQPAKPATPGNDIPQ 110


>gi|315127236|ref|YP_004069239.1| preprotein translocase subunit SecG [Pseudoalteromonas sp. SM9913]
 gi|315015750|gb|ADT69088.1| preprotein translocase subunit SecG [Pseudoalteromonas sp. SM9913]
          Length = 117

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 53/126 (42%), Gaps = 15/126 (11%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+VV+LIV + LV ++LIQ    +    +FG+ ++ T        + + + T +LA
Sbjct: 1   MYEILLVVYLIVALALVGMVLIQQGKGADMGSSFGAGASSTVFGSSGAGNFMTKTTTVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  SI LG ++     +          D  ++       +  +P  + V   S+   
Sbjct: 61  TIFFVLSIVLGNLTAGQIKKT---------DEWENLEAAPAVETVTPVEEDVPVTSTKEQ 111

Query: 115 VAGKRS 120
            +   +
Sbjct: 112 SSDVPN 117


>gi|262401662|ref|ZP_06078228.1| preprotein translocase subunit SecG [Vibrio sp. RC586]
 gi|262352079|gb|EEZ01209.1| preprotein translocase subunit SecG [Vibrio sp. RC586]
          Length = 110

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
          M   L+V++L+  V ++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 1  MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF  S+ LG +S + +  
Sbjct: 61 TIFFVISLVLGNMSTHKTES 80


>gi|306816483|ref|ZP_07450615.1| preprotein translocase subunit SecG [Escherichia coli NC101]
 gi|222034892|emb|CAP77635.1| Protein-export membrane protein secG [Escherichia coli LF82]
 gi|305850048|gb|EFM50507.1| preprotein translocase subunit SecG [Escherichia coli NC101]
 gi|312947732|gb|ADR28559.1| preprotein translocase subunit SecG [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|324008775|gb|EGB77994.1| preprotein translocase, SecG subunit [Escherichia coli MS 57-2]
          Length = 110

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 49/119 (41%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + +  +          ++       + + P   +       +
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSE---------WENLSAPAKTEQTQPAAPAKQTSDIPN 110


>gi|259907039|ref|YP_002647395.1| preprotein translocase subunit SecG [Erwinia pyrifoliae Ep1/96]
 gi|224962661|emb|CAX54116.1| Protein-export membrane protein SecG (Preprotein translocase band 1
           subunit) [Erwinia pyrifoliae Ep1/96]
 gi|283476835|emb|CAY72673.1| Protein-export membrane protein secG [Erwinia pyrifoliae DSM 12163]
 gi|310766251|gb|ADP11201.1| protein-export protein [Erwinia sp. Ejp617]
          Length = 110

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 46/119 (38%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S        + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + +  +          ++         + P   +        
Sbjct: 61  TLFFIISLILGNINSNKTQKGSE---------WENLTQPAQSQQTQPAKPAAPGSDIPQ 110


>gi|197105215|ref|YP_002130592.1| preprotein translocase, SecG subunit [Phenylobacterium zucineum
           HLK1]
 gi|196478635|gb|ACG78163.1| preprotein translocase, SecG subunit [Phenylobacterium zucineum
           HLK1]
          Length = 149

 Score = 68.3 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 4/118 (3%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSAFGSS---SNFTSVRSTAHSLGRFTAILAFFFFA 59
             L+V+ +IV   L+ V+L+Q S+  A G     S F + R     + R T IL   FF 
Sbjct: 4   TLLLVIEVIVAFFLIVVVLLQRSEGGALGMGGGPSGFMTARGAGDLMTRITWILGSVFFV 63

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
             + L +++          + R  VD+I     +      +P   +    +     A 
Sbjct: 64  LGLLLTIMAGREG-GSSSVVDRLKVDAIDPNSLNQSAPQPTPAAPAQGGPAPLQAPAP 120


>gi|188532501|ref|YP_001906298.1| preprotein translocase subunit SecG [Erwinia tasmaniensis Et1/99]
 gi|188027543|emb|CAO95390.1| Protein-export membrane protein SecG (Preprotein translocase band 1
           subunit) [Erwinia tasmaniensis Et1/99]
          Length = 110

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 47/110 (42%), Gaps = 9/110 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S        + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG I+   + +  +  +   +              ++P  D
Sbjct: 61  TLFFIISLILGNINSNKTQKGSEWEN---LSQPAQSQQTQPAKPATPGSD 107


>gi|331674711|ref|ZP_08375470.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli TA280]
 gi|331068150|gb|EGI39546.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli TA280]
          Length = 110

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 49/119 (41%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + +  +          ++       + + P   +       +
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSE---------WENLSAPANTEQTQPAAPAKPTSDIPN 110


>gi|254469843|ref|ZP_05083248.1| preprotein translocase, SecG subunit [Pseudovibrio sp. JE062]
 gi|211961678|gb|EEA96873.1| preprotein translocase, SecG subunit [Pseudovibrio sp. JE062]
          Length = 121

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 42/119 (35%), Positives = 60/119 (50%), Gaps = 5/119 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF----TSVRSTAHSLGRFTAILAFF 56
           M+  L+V+HL+VVV LV ++L+Q S+  A G          S R TA+ L R TAILA  
Sbjct: 1   METVLIVIHLMVVVALVAMVLLQRSEGGALGIGGGGGGGVMSSRGTANVLTRGTAILAVC 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
           FFATS+AL +++RY   R    + +    S         G+G   +L   S  +   V 
Sbjct: 61  FFATSLALSLLARYD-ERPGSLLDQVPAGSATQGTEQGSGNGLLDQLQQQSQPTGPQVP 118


>gi|283836282|ref|ZP_06356023.1| homoserine dehydrogenase [Citrobacter youngae ATCC 29220]
 gi|291067645|gb|EFE05754.1| homoserine dehydrogenase [Citrobacter youngae ATCC 29220]
          Length = 110

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 46/118 (38%), Gaps = 15/118 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S        + + + R TA+L 
Sbjct: 1   MHEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAVLG 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             FF  S+ LG ++   + +  +          ++       + + P   +       
Sbjct: 61  TLFFIISLVLGNMNSNKTNKGSE---------WENLSAPAKTEQTQPAAPAQPTSDIP 109


>gi|148651970|ref|YP_001279063.1| preprotein translocase subunit SecG [Psychrobacter sp. PRwf-1]
 gi|148571054|gb|ABQ93113.1| protein translocase subunit secG [Psychrobacter sp. PRwf-1]
          Length = 105

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
          M   ++ +H+IV + ++ +ILIQ    +    +FG+ ++ T      +A+ L R TAILA
Sbjct: 1  MFNIILAIHIIVAIAMIGLILIQHGKGADAGASFGAGASGTVFGAAGSANFLTRATAILA 60

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF TS+ L + +R  +  
Sbjct: 61 IIFFTTSLTLAVHARKQAEG 80


>gi|13470810|ref|NP_102379.1| preprotein translocase subunit SecG [Mesorhizobium loti MAFF303099]
 gi|14021553|dbj|BAB48165.1| protein-export membrane protein [Mesorhizobium loti MAFF303099]
          Length = 154

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 59/115 (51%), Gaps = 5/115 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL+VV+ LV V+L+Q S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMVVLALVGVVLLQRSEGGGLGIGGGSGFMTARGAANALTRATAILAAAFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
            TS+ L +I+RY   +  D + R    +      +     ++P     +A +  S
Sbjct: 61  VTSLTLSIIARY-GEKPIDILDRVP--ATGKGVLNQLPGTTTPAPAGSTAPTPPS 112


>gi|88860508|ref|ZP_01135146.1| protein-export membrane protein secG (General Secretory Pathway)
          [Pseudoalteromonas tunicata D2]
 gi|88817706|gb|EAR27523.1| protein-export membrane protein secG (General Secretory Pathway)
          [Pseudoalteromonas tunicata D2]
          Length = 118

 Score = 67.9 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 6/94 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
          M   L++V+LIV + L+ ++LIQ    +    +FG+ ++ T        + + + T  LA
Sbjct: 1  MYEILLIVYLIVALALIGMVLIQQGKGADMGSSFGAGASATVFGSSGAGNFMTKTTTTLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
            FF  SI LG ++     +  +    S   S +
Sbjct: 61 AVFFVLSIVLGNLTAGQIKKTDEWTDLSTAPSAE 94


>gi|292486834|ref|YP_003529704.1| protein-export membrane protein SecG [Erwinia amylovora CFBP1430]
 gi|292900768|ref|YP_003540137.1| protein-export protein [Erwinia amylovora ATCC 49946]
 gi|291200616|emb|CBJ47748.1| protein-export protein [Erwinia amylovora ATCC 49946]
 gi|291552251|emb|CBA19288.1| Protein-export membrane protein secG [Erwinia amylovora CFBP1430]
          Length = 110

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 46/119 (38%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S        + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + +  +          ++         + P   +        
Sbjct: 61  TLFFIISLILGNINSNKTQKGSE---------WENLTQPAQSQQTQPAKPATPGSDIPQ 110


>gi|71906587|ref|YP_284174.1| preprotein translocase subunit SecG [Dechloromonas aromatica RCB]
 gi|71846208|gb|AAZ45704.1| protein translocase subunit secG [Dechloromonas aromatica RCB]
          Length = 123

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/119 (21%), Positives = 45/119 (37%), Gaps = 8/119 (6%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
             ++ VH++V + ++ ++L+Q    +        G+S +      +A+ L R T ILA  
Sbjct: 6   SLVLTVHILVAIVIIGLVLMQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAGV 65

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
           FF TS+ L  I           M   +      Q       G SP     +   +  + 
Sbjct: 66  FFVTSLTLAYIGSNKPKTTGSLMQEPVQSQTVSQ--PASAGGESPAAPVEAGSRAKDIP 122


>gi|15965192|ref|NP_385545.1| preprotein translocase subunit SecG [Sinorhizobium meliloti 1021]
 gi|307309206|ref|ZP_07588877.1| preprotein translocase, SecG subunit [Sinorhizobium meliloti
          BL225C]
 gi|307321536|ref|ZP_07600931.1| preprotein translocase, SecG subunit [Sinorhizobium meliloti
          AK83]
 gi|15074372|emb|CAC46018.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306892843|gb|EFN23634.1| preprotein translocase, SecG subunit [Sinorhizobium meliloti
          AK83]
 gi|306900352|gb|EFN30968.1| preprotein translocase, SecG subunit [Sinorhizobium meliloti
          BL225C]
          Length = 161

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 57/97 (58%), Gaps = 3/97 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V++L+VVV L+ V+LIQ S+    G      F S R TA++L R TA+LAF FF
Sbjct: 1  MQTVLLVIYLMVVVALIGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAVLAFLFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF 95
          A ++A+G++SRY   +  D + R    S      D+ 
Sbjct: 61 ALALAMGILSRYE-PQATDILDRIPGTSSSGGVLDSL 96


>gi|186476765|ref|YP_001858235.1| preprotein translocase subunit SecG [Burkholderia phymatum
          STM815]
 gi|184193224|gb|ACC71189.1| preprotein translocase, SecG subunit [Burkholderia phymatum
          STM815]
          Length = 130

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +        G+S +      +A+ L R TAILA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAILA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF T++AL  +  Y S      +
Sbjct: 64 AVFFVTTLALTYLGAYHSKPSAGVL 88


>gi|261345164|ref|ZP_05972808.1| homoserine dehydrogenase [Providencia rustigianii DSM 4541]
 gi|282566855|gb|EFB72390.1| homoserine dehydrogenase [Providencia rustigianii DSM 4541]
          Length = 114

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/111 (21%), Positives = 47/111 (42%), Gaps = 7/111 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M I L+++ L+V + L+ ++++Q    +        G+S+       + + + R T ILA
Sbjct: 1   MYIALLIIFLLVAISLIGLVMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTGILA 60

Query: 55  FFFFATSIALGMISRYT-STRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG ++     T            +  +Q  D     ++P  D
Sbjct: 61  AVFFIISLVLGNMTANKYGTGTGSKWENISEPAKVEQPTDVPAAPATPTSD 111


>gi|104780025|ref|YP_606523.1| preprotein translocase subunit SecG [Pseudomonas entomophila L48]
 gi|95109012|emb|CAK13708.1| putative preprotein translocase SecG Subunit [Pseudomonas
           entomophila L48]
          Length = 130

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 57/131 (43%), Gaps = 10/131 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           ++  ++V HL+  + LV ++L+Q    +    +FG+ ++ T      +A  L + TAILA
Sbjct: 2   LETVVVVFHLLAALALVVMVLLQQGKGAEAGASFGAGASNTVFGSQGSATFLSKVTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF T++ LG  ++  + +    + ++ +               +  +  +  + S + 
Sbjct: 62  ATFFLTALGLGYFAKQQAHQ----LTQAGLPDPAVLEVKEQKPAVNDDVPVLQQQKSETT 117

Query: 115 VAGKRSSSRTK 125
            +G       +
Sbjct: 118 NSGDVPPPAKE 128


>gi|293393156|ref|ZP_06637471.1| homoserine dehydrogenase [Serratia odorifera DSM 4582]
 gi|291424302|gb|EFE97516.1| homoserine dehydrogenase [Serratia odorifera DSM 4582]
          Length = 111

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 48/115 (41%), Gaps = 11/115 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L++ +GLV +I++Q    +        G+S        + + + R TA+LA
Sbjct: 1   MYEALLVIFLLISIGLVALIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF  S+ LG +S   S +  +       +  +    +     ++P   S    
Sbjct: 61  TLFFVISLILGNLSSNQSQKGSE-----WENLGQPVKTEQTTAPAAPAKPSSDIP 110


>gi|322831212|ref|YP_004211239.1| preprotein translocase SecG subunit [Rahnella sp. Y9602]
 gi|321166413|gb|ADW72112.1| preprotein translocase, SecG subunit [Rahnella sp. Y9602]
          Length = 111

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/110 (20%), Positives = 44/110 (40%), Gaps = 6/110 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ LIV +GL+ ++++Q    +        G+S        + + + R T +LA
Sbjct: 1   MYDALLVIFLIVAIGLIALVMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTGVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG +S     +  +  + S     +           +  + 
Sbjct: 61  ALFFIISLILGNMSTNKGQKGSEWENLSQPAKTEQTTAPAAPAAPNSDVP 110


>gi|126462773|ref|YP_001043887.1| preprotein translocase subunit SecG [Rhodobacter sphaeroides ATCC
           17029]
 gi|126104437|gb|ABN77115.1| preprotein translocase, SecG subunit [Rhodobacter sphaeroides ATCC
           17029]
          Length = 203

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 49/116 (42%), Gaps = 2/116 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD-SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
           MQ  +++VHLI+ + L+ V+L+Q S+            + R  A+++ R T I A  F  
Sbjct: 1   MQNVVLIVHLILALLLIGVVLLQRSEGGGLGMGGGGAMTGRQAANAMTRMTWIFAIAFIG 60

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
           TSIAL + +   ++     + +      ++          +  L    A +  +  
Sbjct: 61  TSIALTIFAA-QNSHSSSVIDQFGGTVRQEAPATPEAPLGNDLLPPAPANAPLTPP 115


>gi|153875561|ref|ZP_02003309.1| preprotein translocase, SecG subunit [Beggiatoa sp. PS]
 gi|152067976|gb|EDN66692.1| preprotein translocase, SecG subunit [Beggiatoa sp. PS]
          Length = 135

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 10/128 (7%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILAFFF 57
            L++ H+I+ + L+ +ILIQ    +    AFGS ++ T      +   L R T +LA  F
Sbjct: 5   ILVIFHVILSLALIGLILIQHGKGADAGAAFGSGASATVFGSQGSGSFLTRTTGVLATLF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN---FGDGSSPKLDSVSAKSSSSV 114
           F TS+ L   +       K  +  S+V        ++     + +  +L  V    +S++
Sbjct: 65  FVTSLTLAYFT-IQRIEPKSVLESSVVTQQPAPTTESEVPVTEKTDSELPPVENNETSTI 123

Query: 115 VAGKRSSS 122
            A +  + 
Sbjct: 124 PATETENP 131


>gi|84387289|ref|ZP_00990310.1| translocase [Vibrio splendidus 12B01]
 gi|84377936|gb|EAP94798.1| translocase [Vibrio splendidus 12B01]
          Length = 110

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 43/80 (53%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
          M   L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TA+ A
Sbjct: 1  MFTVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAVFA 60

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF  S+ LG +S + +  
Sbjct: 61 TTFFILSLVLGNMSTHKTES 80


>gi|77463939|ref|YP_353443.1| preprotein translocase subunit SecG [Rhodobacter sphaeroides 2.4.1]
 gi|77388357|gb|ABA79542.1| Preprotein translocase SecG subunit [Rhodobacter sphaeroides 2.4.1]
          Length = 208

 Score = 67.9 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 49/116 (42%), Gaps = 2/116 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD-SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
           MQ  +++VHLI+ + L+ V+L+Q S+            + R  A+++ R T I A  F  
Sbjct: 1   MQNVVLIVHLILALLLIGVVLLQRSEGGGLGMGGGGAMTGRQAANAMTRMTWIFAIAFIG 60

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
           TSIAL + +   ++     + +      ++          +  L    A +  +  
Sbjct: 61  TSIALTIFAA-QNSHGSSVIDQFGGTVRQEAPATPEAPLGNDLLPPAPANAPLTPP 115


>gi|30142057|gb|AAO17817.1| SecG [Citrobacter rodentium]
          Length = 110

 Score = 67.5 bits (163), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 48/119 (40%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + +  +          ++       + + P   +        
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSE---------WENLSAPAKTEQTQPAAPAQPTSDIPQ 110


>gi|253686970|ref|YP_003016160.1| preprotein translocase, SecG subunit [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251753548|gb|ACT11624.1| preprotein translocase, SecG subunit [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 110

 Score = 67.5 bits (163), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 48/115 (41%), Gaps = 12/115 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V +GLV +I++Q    +        G+S+       + + + R TAILA
Sbjct: 1   MYEALLVIFLLVSIGLVALIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF  S+ LG +S         +      +  + +  +     ++P   +    
Sbjct: 61  TLFFIISLVLGNLSSLQKKGGAWD------NLNQPEKAEQTTTPAAPSTPASDIP 109


>gi|163793239|ref|ZP_02187215.1| preprotein translocase, SecG subunit [alpha proteobacterium
          BAL199]
 gi|159181885|gb|EDP66397.1| preprotein translocase, SecG subunit [alpha proteobacterium
          BAL199]
          Length = 105

 Score = 67.5 bits (163), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 7/98 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-------NFTSVRSTAHSLGRFTAIL 53
          M   ++ +HL++ + LV V+L+Q S+    G          +F S R TA+ L R TAIL
Sbjct: 1  MTAIVLTIHLMIALALVIVVLLQRSEGGGLGIGGGGGGGMGSFMSARGTANLLTRTTAIL 60

Query: 54 AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG 91
          A  F +TSI L +++  T T+   +   ++  +    G
Sbjct: 61 AACFMSTSILLAILAGNTGTQSIVDRPAAVDTAPAKTG 98


>gi|157368733|ref|YP_001476722.1| preprotein translocase subunit SecG [Serratia proteamaculans 568]
 gi|157320497|gb|ABV39594.1| preprotein translocase, SecG subunit [Serratia proteamaculans 568]
          Length = 111

 Score = 67.5 bits (163), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/115 (20%), Positives = 49/115 (42%), Gaps = 11/115 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L++ +GLV +I++Q    +        G+S        + + + R TA+LA
Sbjct: 1   MYEALLVIFLLISIGLVALIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF  S+ LG +S   + +  +       +  +   ++     ++P   S    
Sbjct: 61  TLFFVISLILGNLSTNQTKKGSE-----WENLGQPVKSEQTTAPAAPTKPSSDIP 110


>gi|218710448|ref|YP_002418069.1| preprotein translocase subunit SecG [Vibrio splendidus LGP32]
 gi|218323467|emb|CAV19644.1| Preprotein translocase subunit SecG [Vibrio splendidus LGP32]
          Length = 124

 Score = 67.5 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
          M   L+V++L+  +G++ ++LIQ    +    +FG+ ++ T      + + L R TAI A
Sbjct: 15 MFTVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFA 74

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF  S+ LG +S + +  
Sbjct: 75 TTFFILSLVLGNMSTHKTES 94


>gi|261856551|ref|YP_003263834.1| preprotein translocase, SecG subunit [Halothiobacillus neapolitanus
           c2]
 gi|261837020|gb|ACX96787.1| preprotein translocase, SecG subunit [Halothiobacillus neapolitanus
           c2]
          Length = 152

 Score = 67.5 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 51/128 (39%), Gaps = 6/128 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
           MQ  +++ H+++ + L+ ++LIQ    +    AFGS S+ T    R  A  L + T  L 
Sbjct: 1   MQTLILIGHVLIGLALIGLVLIQHGKGADAGAAFGSGSSGTVFGARGAATFLQKLTGWLV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FFATS+ L  +   + +         +  +    G+      S P        + +S 
Sbjct: 61  VAFFATSLLLAYVINTSHSPSSVVNSVPVSKTDSGDGSKPNPQNSVPSTSESVTPAPASQ 120

Query: 115 VAGKRSSS 122
                  S
Sbjct: 121 GKPSDVPS 128


>gi|183600363|ref|ZP_02961856.1| hypothetical protein PROSTU_03926 [Providencia stuartii ATCC 25827]
 gi|188020154|gb|EDU58194.1| hypothetical protein PROSTU_03926 [Providencia stuartii ATCC 25827]
          Length = 112

 Score = 67.5 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 47/110 (42%), Gaps = 7/110 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M I L++V L+V +GL+ +I++Q    +        G+S+       + + + R T ILA
Sbjct: 1   MYIALLIVFLLVAIGLIGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTGILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG ++                 +  +Q  D     ++P  D
Sbjct: 61  AVFFIISLILGNMTANK-YGTGSKWENISEPAKVEQPTDVPAAPATPTSD 109


>gi|209963460|ref|YP_002296375.1| preprotein translocase, SecG subunit, putative [Rhodospirillum
          centenum SW]
 gi|209956926|gb|ACI97562.1| preprotein translocase, SecG subunit, putative [Rhodospirillum
          centenum SW]
          Length = 117

 Score = 67.5 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 30/89 (33%), Positives = 44/89 (49%), Gaps = 5/89 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV----RSTAHSLGRFTAILAFF 56
          M+  ++VVHL++ V LV V+LIQ S+    G            R +A+ L R TAILA  
Sbjct: 1  MEKVVLVVHLLIAVSLVGVVLIQKSEGGGLGIGGGTMGGLMTTRGSANLLTRTTAILAAC 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVD 85
          FF TS+ L  ++  T    +    R+   
Sbjct: 61 FFTTSLVLAAMTGATG-PAESIFDRTAPG 88


>gi|170025948|ref|YP_001722453.1| preprotein translocase subunit SecG [Yersinia pseudotuberculosis
           YPIII]
 gi|169752482|gb|ACA70000.1| preprotein translocase, SecG subunit [Yersinia pseudotuberculosis
           YPIII]
          Length = 111

 Score = 67.1 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 49/120 (40%), Gaps = 15/120 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V  L++ +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVFFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ LG +S     +  +          ++ G     + ++  +  V   S    
Sbjct: 61  TLFFVISLILGNMSSNQGQKSSE---------WENLGQPLKTEQTTTPVAPVKPSSDIPQ 111


>gi|261820125|ref|YP_003258231.1| preprotein translocase subunit SecG [Pectobacterium wasabiae
           WPP163]
 gi|261604138|gb|ACX86624.1| preprotein translocase, SecG subunit [Pectobacterium wasabiae
           WPP163]
          Length = 110

 Score = 67.1 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 47/115 (40%), Gaps = 12/115 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V +GLV +I++Q    +        G+S+       + + + R TAILA
Sbjct: 1   MYEVLLVIFLLVSIGLVALIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF  S+ LG +S         +      +  + +  +      +P   +    
Sbjct: 61  TLFFIISLILGNLSSLQKRGGTWD------NLSQPERVEQTTAPVAPSTPASDIP 109


>gi|304396344|ref|ZP_07378225.1| preprotein translocase, SecG subunit [Pantoea sp. aB]
 gi|304355853|gb|EFM20219.1| preprotein translocase, SecG subunit [Pantoea sp. aB]
          Length = 112

 Score = 67.1 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 7/110 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+VV LIV + LV +I++Q    +    +FG+ ++ T      + + + R T ILA
Sbjct: 1   MYEALLVVFLIVAIALVGMIMLQQGKGADMGASFGAGASGTVFGSSGSGNFMTRTTGILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG ++   +++  +  + S       Q         +P  D
Sbjct: 61  ALFFIISLVLGNLNSNKASKGSEWENLSAPAQSSQQTEKP-AQPVTPGSD 109


>gi|93004902|ref|YP_579339.1| preprotein translocase subunit SecG [Psychrobacter cryohalolentis
          K5]
 gi|92392580|gb|ABE73855.1| protein translocase subunit secG [Psychrobacter cryohalolentis
          K5]
          Length = 102

 Score = 67.1 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 44/80 (55%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
          M  F++ +H+IV + ++ +ILIQ    +    +FG+ S+ T      TA+ L R TA+L 
Sbjct: 1  MFTFILALHIIVAIAMIGLILIQHGKGADAGASFGAGSSGTVFGAAGTANFLTRATAVLT 60

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF TS+ L + +R  +  
Sbjct: 61 AIFFITSMTLAVHARKQAED 80


>gi|271499171|ref|YP_003332196.1| preprotein translocase subunit SecG [Dickeya dadantii Ech586]
 gi|270342726|gb|ACZ75491.1| preprotein translocase, SecG subunit [Dickeya dadantii Ech586]
          Length = 111

 Score = 67.1 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 47/115 (40%), Gaps = 11/115 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+++ L+V +GLV +I++Q    +        G+S+       + + + R TA+ A
Sbjct: 1   MYEALLIIFLLVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF  S+ LG +S   S +     + S     +    +      +P   S    
Sbjct: 61  TLFFVLSLILGNMSSDHSKKSSGWDNLS-----QPAAAEKADQPKAPAAPSSDIP 110


>gi|308189110|ref|YP_003933241.1| Protein-export membrane protein secG [Pantoea vagans C9-1]
 gi|308059620|gb|ADO11792.1| Protein-export membrane protein secG [Pantoea vagans C9-1]
          Length = 112

 Score = 67.1 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 7/110 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+VV LIV + LV +I++Q    +    +FG+ ++ T      + + + R T ILA
Sbjct: 1   MYEALLVVFLIVAIALVGMIMLQQGKGADMGASFGAGASGTVFGSSGSGNFMTRTTGILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG ++   +++  +  + S       Q         +P  D
Sbjct: 61  ALFFIISLVLGNLNSNKASKGSEWENLSAPVQSSQQTEKP-AQPVTPGSD 109


>gi|212710005|ref|ZP_03318133.1| hypothetical protein PROVALCAL_01056 [Providencia alcalifaciens DSM
           30120]
 gi|212687414|gb|EEB46942.1| hypothetical protein PROVALCAL_01056 [Providencia alcalifaciens DSM
           30120]
          Length = 114

 Score = 67.1 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 47/111 (42%), Gaps = 7/111 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M I L+VV L+  +GL+ ++++Q    +        G+S+       + + + R T ILA
Sbjct: 1   MYIALLVVFLLAAIGLIGLVMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTGILA 60

Query: 55  FFFFATSIALGMISRYT-STRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG ++     T            +  +Q  D     ++P  D
Sbjct: 61  AVFFVISLILGNMTANKYGTGAGSKWENISEPAKVEQPTDVPAAPATPTSD 111


>gi|163746028|ref|ZP_02153387.1| preprotein translocase, SecG subunit, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161380773|gb|EDQ05183.1| preprotein translocase, SecG subunit, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 118

 Score = 67.1 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 8/112 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD--SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
           M+  ++++HLI+ +GL+ V+L+Q S+      G      S RS A +LG+ T ILA  F 
Sbjct: 1   MENVVLIIHLILALGLIAVVLLQRSEGGGLGMGGGGGAVSGRSAATALGKITWILAAGFI 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
            TSI L +I+   S         S     ++      G  + P  D +   S
Sbjct: 61  VTSITLTIIAAEKSAGSSVIDRLSATPPAQN------GSPALPAGDDLLPPS 106


>gi|71064647|ref|YP_263374.1| preprotein translocase subunit SecG [Psychrobacter arcticus
          273-4]
 gi|71037632|gb|AAZ17940.1| protein translocase subunit secG [Psychrobacter arcticus 273-4]
          Length = 102

 Score = 67.1 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
          M  F++ +H+IV + ++ +ILIQ    +    +FG+ S+ T      TA+ L R TA+L 
Sbjct: 1  MFTFILTLHIIVAIAMIGLILIQHGKGADAGASFGAGSSGTVFGAAGTANFLTRATAVLT 60

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF TS++L + +R  +  
Sbjct: 61 AIFFITSMSLAVHARKQAED 80


>gi|195941094|ref|ZP_03086476.1| preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           EC4024]
          Length = 105

 Score = 67.1 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 48/113 (42%), Gaps = 15/113 (13%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ LIV + LV +I++Q    +        G+S        +A+ + R TAILA
Sbjct: 1   MYEALLVIFLIVAIALVALIMLQQGKGADMGASFGAGASGTLFGSSGSANFMTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             FF  S+ LG I+   +++  +          ++       + + P   +  
Sbjct: 61  TLFFIISLVLGNINSNKTSKGSE---------WENLSAPAKTEQTQPAAPAKP 104


>gi|307129382|ref|YP_003881398.1| preprotein translocase membrane subunit [Dickeya dadantii 3937]
 gi|306526911|gb|ADM96841.1| preprotein translocase membrane subunit [Dickeya dadantii 3937]
          Length = 111

 Score = 67.1 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 49/110 (44%), Gaps = 8/110 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ LIV +GLV +I++Q    +        G+S+       + + + R TA+ A
Sbjct: 1   MYEALLVIFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG +S   S +  +    SL      +  +     ++P  D
Sbjct: 61  TLFFVLSLILGNMSSDHSKKGSEW--ESLSQPAAPEKAEQSKAPAAPSSD 108


>gi|170680429|ref|YP_001745447.1| preprotein translocase subunit SecG [Escherichia coli SMS-3-5]
 gi|170518147|gb|ACB16325.1| preprotein translocase, SecG subunit [Escherichia coli SMS-3-5]
          Length = 110

 Score = 66.7 bits (161), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 48/110 (43%), Gaps = 9/110 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG I+   + +  +  + S     +          + P  D
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSEWENLSAPAKTE---QTQSAAPAKPTSD 107


>gi|15803715|ref|NP_289749.1| preprotein translocase subunit SecG [Escherichia coli O157:H7
           EDL933]
 gi|25306329|pir||A85981 protein export membrane protein [imported] - Escherichia coli
           (strain O157:H7, substrain EDL933)
 gi|12517787|gb|AAG58309.1|AE005546_3 protein export - membrane protein [Escherichia coli O157:H7 str.
           EDL933]
          Length = 110

 Score = 66.7 bits (161), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 25/119 (21%), Positives = 48/119 (40%), Gaps = 15/119 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GL  +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLXGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  S+ LG I+   + +  +          ++       + + P   +       +
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSE---------WENLSAPAKTEQTQPAAPAKPTSDIPN 110


>gi|22124599|ref|NP_668022.1| preprotein translocase subunit SecG [Yersinia pestis KIM 10]
 gi|45440438|ref|NP_991977.1| preprotein translocase subunit SecG [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51594829|ref|YP_069020.1| preprotein translocase subunit SecG [Yersinia pseudotuberculosis IP
           32953]
 gi|108806047|ref|YP_649963.1| preprotein translocase subunit SecG [Yersinia pestis Antiqua]
 gi|108813403|ref|YP_649170.1| preprotein translocase subunit SecG [Yersinia pestis Nepal516]
 gi|145600795|ref|YP_001164871.1| preprotein translocase subunit SecG [Yersinia pestis Pestoides F]
 gi|153948565|ref|YP_001402553.1| preprotein translocase subunit SecG [Yersinia pseudotuberculosis IP
           31758]
 gi|153997276|ref|ZP_02022376.1| protein-export membrane protein [Yersinia pestis CA88-4125]
 gi|162418621|ref|YP_001608283.1| preprotein translocase subunit SecG [Yersinia pestis Angola]
 gi|165937570|ref|ZP_02226133.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166214015|ref|ZP_02240050.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167401353|ref|ZP_02306853.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167420700|ref|ZP_02312453.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167423246|ref|ZP_02314999.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|186893838|ref|YP_001870950.1| preprotein translocase subunit SecG [Yersinia pseudotuberculosis
           PB1/+]
 gi|218930513|ref|YP_002348388.1| preprotein translocase subunit SecG [Yersinia pestis CO92]
 gi|229839151|ref|ZP_04459310.1| preprotein translocase membrane subunit [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229896640|ref|ZP_04511807.1| preprotein translocase membrane subunit [Yersinia pestis Pestoides
           A]
 gi|229899715|ref|ZP_04514856.1| preprotein translocase membrane subunit [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229903877|ref|ZP_04518990.1| preprotein translocase membrane subunit [Yersinia pestis Nepal516]
 gi|270489133|ref|ZP_06206207.1| preprotein translocase, SecG subunit [Yersinia pestis KIM D27]
 gi|21957402|gb|AAM84273.1|AE013670_10 protein export - membrane protein [Yersinia pestis KIM 10]
 gi|45435295|gb|AAS60854.1| protein-export membrane protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51588111|emb|CAH19717.1| protein-export membrane protein segG [Yersinia pseudotuberculosis
           IP 32953]
 gi|108777051|gb|ABG19570.1| protein translocase subunit secG [Yersinia pestis Nepal516]
 gi|108777960|gb|ABG12018.1| protein translocase subunit secG [Yersinia pestis Antiqua]
 gi|115349124|emb|CAL22087.1| protein-export membrane protein [Yersinia pestis CO92]
 gi|145212491|gb|ABP41898.1| protein translocase subunit secG [Yersinia pestis Pestoides F]
 gi|149288913|gb|EDM38993.1| protein-export membrane protein [Yersinia pestis CA88-4125]
 gi|152960060|gb|ABS47521.1| preprotein translocase, SecG subunit [Yersinia pseudotuberculosis
           IP 31758]
 gi|162351436|gb|ABX85384.1| preprotein translocase, SecG subunit [Yersinia pestis Angola]
 gi|165914675|gb|EDR33289.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166204810|gb|EDR49290.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166961506|gb|EDR57527.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167049378|gb|EDR60786.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167057416|gb|EDR67162.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|186696864|gb|ACC87493.1| preprotein translocase, SecG subunit [Yersinia pseudotuberculosis
           PB1/+]
 gi|229679647|gb|EEO75750.1| preprotein translocase membrane subunit [Yersinia pestis Nepal516]
 gi|229687207|gb|EEO79282.1| preprotein translocase membrane subunit [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229695517|gb|EEO85564.1| preprotein translocase membrane subunit [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229700418|gb|EEO88450.1| preprotein translocase membrane subunit [Yersinia pestis Pestoides
           A]
 gi|270337637|gb|EFA48414.1| preprotein translocase, SecG subunit [Yersinia pestis KIM D27]
 gi|320013702|gb|ADV97273.1| preprotein translocase membrane subunit [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 111

 Score = 66.7 bits (161), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 49/120 (40%), Gaps = 15/120 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V  L++ +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVFFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ LG +S     +  +          ++ G     + ++  +  V   S    
Sbjct: 61  TLFFVISLILGNMSSNQGQKSSE---------WENLGQPLKTEQTATPVAPVKPSSDIPQ 111


>gi|255261282|ref|ZP_05340624.1| preprotein translocase subunit SecG [Thalassiobium sp. R2A62]
 gi|255103617|gb|EET46291.1| preprotein translocase subunit SecG [Thalassiobium sp. R2A62]
          Length = 121

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 49/114 (42%), Gaps = 5/114 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRSTAHSLGRFTAILAF 55
           M+  +++VHL++ + L+  +L+Q S+         G      S RS A +LG+ T ILA 
Sbjct: 1   MENVVLIVHLLLALSLIGAVLLQRSEGGGLGMGGGGGGGGAMSNRSAATALGKVTWILAI 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
            F  TS+AL +I+   S             ++    +   GD   P     S  
Sbjct: 61  AFICTSVALTIIAASNSAGSSVIDRLGDAPAVSGDADVPEGDSLLPPSADDSTP 114


>gi|254482491|ref|ZP_05095730.1| preprotein translocase SecG subunit, putative [marine gamma
          proteobacterium HTCC2148]
 gi|214037182|gb|EEB77850.1| preprotein translocase SecG subunit, putative [marine gamma
          proteobacterium HTCC2148]
          Length = 129

 Score = 66.7 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 44/94 (46%), Gaps = 6/94 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVR------STAHSLGRFTAILA 54
          M+  +++VHL+V + ++ +I++Q    +  G+S    + +       + + L R T    
Sbjct: 1  MEQIILIVHLLVALAIIGLIMLQQGKGADMGASFGAGASQTLFGSDGSGNVLTRATGWFV 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
            FFATS  L +I+  +S    D        +++
Sbjct: 61 TLFFATSFGLALIASQSSQPVNDLGIDIPGAAMQ 94


>gi|304322179|ref|YP_003855822.1| hypothetical protein PB2503_13214 [Parvularcula bermudensis
           HTCC2503]
 gi|303301081|gb|ADM10680.1| hypothetical protein PB2503_13214 [Parvularcula bermudensis
           HTCC2503]
          Length = 138

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 34/126 (26%), Positives = 53/126 (42%), Gaps = 9/126 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           M   L+ +H ++V+ LV V+L+Q S+       G   NF S R TA  L R T  L   F
Sbjct: 1   MTAVLLTLHTLIVIALVGVVLLQRSEGGALGMGGGGGNFLSGRGTADVLTRSTTALGAAF 60

Query: 58  FATSIALGMIS--RYTSTRYKDNM----HRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
           FATS+ L + S    ++   +  +      +  D  +   +D F  G           ++
Sbjct: 61  FATSLLLAITSDRGISAVELRQELIGEEEAAPTDPSEIDASDIFDFGDEAPTAPTPNPAA 120

Query: 112 SSVVAG 117
              VA 
Sbjct: 121 DPAVAP 126


>gi|319783644|ref|YP_004143120.1| preprotein translocase, SecG subunit [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
 gi|317169532|gb|ADV13070.1| preprotein translocase, SecG subunit [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
          Length = 156

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/88 (39%), Positives = 52/88 (59%), Gaps = 3/88 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          M+  L+V+HL+VV+ LV V+L+Q S+    G      F + R  A++L R TAILA  FF
Sbjct: 1  METVLIVIHLMVVLALVGVVLLQRSEGGGLGIGGGSGFMTARGAANALTRATAILAAAFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDS 86
          ATS+ L +++RY   +  D + R    S
Sbjct: 61 ATSLTLSIVARY-GEKPIDILDRVPATS 87


>gi|291613537|ref|YP_003523694.1| preprotein translocase, SecG subunit [Sideroxydans lithotrophicus
           ES-1]
 gi|291583649|gb|ADE11307.1| preprotein translocase, SecG subunit [Sideroxydans lithotrophicus
           ES-1]
          Length = 115

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 47/115 (40%), Gaps = 7/115 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M+  + V+H++  V L+ ++LIQ    +        GS+ +      +A+ L R TA+ A
Sbjct: 1   MENIVWVIHVVTAVVLIGLVLIQHGKGADMGAAFGSGSAGSVFGSSGSANFLSRSTAVAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF TS+AL  +           + +  V +++ Q         +    S    
Sbjct: 61  TIFFITSLALTYLYSRPGKDQG-VIDKVDVKTLQQQAVPAPAGTETSDSKSQQIP 114


>gi|227328607|ref|ZP_03832631.1| preprotein translocase subunit SecG [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
 gi|290454896|emb|CBJ57154.1| preprotein translocase subunit SecG [Pectobacterium carotovorum]
          Length = 110

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 48/115 (41%), Gaps = 12/115 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V +GLV +I++Q    +        G+S+       + + + R TAILA
Sbjct: 1   MYEALLVIFLLVSIGLVALIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF  S+ LG +S         +      +  + +  +     ++P   +    
Sbjct: 61  TLFFIISLILGNLSSLQKKGGAWD------NLSQPEKAEQTTTPAAPSTPASDIP 109


>gi|192361247|ref|YP_001983129.1| putative preprotein translocase SecG subunit [Cellvibrio japonicus
           Ueda107]
 gi|190687412|gb|ACE85090.1| putative preprotein translocase SecG subunit [Cellvibrio japonicus
           Ueda107]
          Length = 135

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 49/117 (41%), Gaps = 6/117 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVR------STAHSLGRFTAILA 54
           M+ F++V+H +  + ++ ++L+Q    +A G+S    + +       + +   R T  +A
Sbjct: 1   MEKFILVIHALAALVIIGLVLLQQGKGAAMGASFGAGASQTVFGSEGSGNFFTRATWTIA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
             FF TS  L +I++  S          ++            D    +  + +A+S 
Sbjct: 61  ALFFCTSFGLAVIAKNNSQVASQGEIVPVIQQEVPAVQVPASDIPEAQAPAANAESD 117


>gi|86136597|ref|ZP_01055176.1| preprotein translocase, SecG subunit [Roseobacter sp. MED193]
 gi|85827471|gb|EAQ47667.1| preprotein translocase, SecG subunit [Roseobacter sp. MED193]
          Length = 124

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 57/127 (44%), Gaps = 14/127 (11%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRSTAHSLGRFTAILAF 55
           M+  ++++HL++ +GL+ V+L+Q S+       + G      S RS A +LG+ T +LA 
Sbjct: 1   MENVVLIIHLLLALGLIAVVLLQRSEGGGLGMGSGGGGGGAMSGRSAATALGKVTWVLAI 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            F  TSI L +++   S      +   ++ S  + GN       +P        S     
Sbjct: 61  CFICTSITLTVLAAKKSAGSS--VADGILPSTTESGN-------APAAPIAPLGSDLLPP 111

Query: 116 AGKRSSS 122
           A   ++ 
Sbjct: 112 AEGDNAP 118


>gi|269137760|ref|YP_003294460.1| preprotein translocase subunit SecG [Edwardsiella tarda EIB202]
 gi|267983420|gb|ACY83249.1| preprotein translocase subunit SecG [Edwardsiella tarda EIB202]
 gi|304557817|gb|ADM40481.1| Preprotein translocase subunit SecG [Edwardsiella tarda FL6-60]
          Length = 111

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 6/83 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+V+ L+V V L+ +I++Q    +        G+S+       T + + R T ILA
Sbjct: 1  MYEALLVIFLLVSVALIALIMLQQGKGADMGASFGAGASATLFGSSGTGNFMTRTTGILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKD 77
            FF  S+ LG +S + S +  +
Sbjct: 61 TLFFVLSLVLGNLSGHQSKQGSE 83


>gi|238897566|ref|YP_002923245.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229465323|gb|ACQ67097.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 109

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/111 (18%), Positives = 47/111 (42%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L++  L++ + LV  I++Q    +        G S++      + + + R T++LA
Sbjct: 1   MYHALLIFFLLISILLVGCIMLQQGKGADVGASFGAGVSTSLFGSNGSGNFMTRMTSVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG I+    + +++        S + +  +N  +     +  
Sbjct: 61  TLFFIISLILGNIATNKKSEWENL--NQPEKSGQAKKTENPVNKPQTDIPQ 109


>gi|268592828|ref|ZP_06127049.1| homoserine dehydrogenase [Providencia rettgeri DSM 1131]
 gi|291311613|gb|EFE52066.1| homoserine dehydrogenase [Providencia rettgeri DSM 1131]
          Length = 114

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/111 (21%), Positives = 47/111 (42%), Gaps = 7/111 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M + L+++ L+  +GL+ +I++Q    +        G+S+       + + + R T ILA
Sbjct: 1   MYVALLIIFLLAAIGLIGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTGILA 60

Query: 55  FFFFATSIALGMISRYT-STRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG ++     T            +  +Q  D     ++P  D
Sbjct: 61  AVFFIISLILGNMTANKYGTGSGSKWENISEPTKVEQPTDVPAAPATPTSD 111


>gi|254467886|ref|ZP_05081292.1| preprotein translocase, SecG subunit [beta proteobacterium KB13]
 gi|207086696|gb|EDZ63979.1| preprotein translocase, SecG subunit [beta proteobacterium KB13]
          Length = 118

 Score = 66.3 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 60/122 (49%), Gaps = 14/122 (11%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M+  L+++HL+  +G++ ++L+Q+   +        G+SS    ++ +++ + + TA   
Sbjct: 1   METILIILHLLASIGVIGLVLLQNGRGADAGSAFGGGNSSGSFGIQGSSNFMTKATAFCV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TSI+L +++            RS+VD+      D   DG+    D V ++  S  
Sbjct: 61  TLFFITSISLALVASNKH------GDRSVVDASSIDTFDTLDDGN--SFDDVQSEDLSEE 112

Query: 115 VA 116
           ++
Sbjct: 113 LS 114


>gi|300718580|ref|YP_003743383.1| Protein-export membrane protein SecG (Preprotein translocase band
          1 subunit) [Erwinia billingiae Eb661]
 gi|299064416|emb|CAX61536.1| Protein-export membrane protein SecG (Preprotein translocase band
          1 subunit) [Erwinia billingiae Eb661]
          Length = 110

 Score = 65.9 bits (159), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
          M   L+VV LIV +GLV +I++Q    +    +FG+  + T      + + + R TA+LA
Sbjct: 1  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGGSATLFGSNGSGNFMTRMTAVLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKD 77
            FF  S+ LG ++   + +  +
Sbjct: 61 TLFFIISLILGNLNSNKTQKGSE 83


>gi|307942207|ref|ZP_07657558.1| preprotein translocase subunit SecG [Roseibium sp. TrichSKD4]
 gi|307774493|gb|EFO33703.1| preprotein translocase subunit SecG [Roseibium sp. TrichSKD4]
          Length = 124

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 40/122 (32%), Positives = 58/122 (47%), Gaps = 6/122 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M+  ++V+HL++V+ LV V+L+Q S+  A G          S R TA+ L R TAILA  
Sbjct: 1   METVVIVIHLMIVLALVLVVLLQRSEGGALGIGGGGGGGMMSARGTANVLTRATAILAVA 60

Query: 57  FFATSIALGMISRYTSTRYK--DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
           FF TS++L +I++         D    +  DS     +   G G    L   S  S   V
Sbjct: 61  FFITSLSLSLIAKNEDRPSSILDATSPAASDSAPTTADGESGGGILDALKEQSQPSGPQV 120

Query: 115 VA 116
            A
Sbjct: 121 PA 122


>gi|308050587|ref|YP_003914153.1| protein translocase subunit secG [Ferrimonas balearica DSM 9799]
 gi|307632777|gb|ADN77079.1| protein translocase subunit secG [Ferrimonas balearica DSM 9799]
          Length = 106

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 49/103 (47%), Gaps = 6/103 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   LMVV+L+V +G++ ++LIQ    +        G+S+       + + L R TA+LA
Sbjct: 1   MFEILMVVYLLVALGIIGLVLIQQGQGASMGASFGAGASATLFGSSGSGNFLTRATALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGD 97
             FF  S+ LG +S +++   +     ++    +       GD
Sbjct: 61  TAFFVLSLVLGRMSAHSAKPTEGWDEINVPVVEQPAETQPSGD 103


>gi|150396289|ref|YP_001326756.1| preprotein translocase subunit SecG [Sinorhizobium medicae
          WSM419]
 gi|150027804|gb|ABR59921.1| preprotein translocase, SecG subunit [Sinorhizobium medicae
          WSM419]
          Length = 156

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 57/97 (58%), Gaps = 3/97 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V++L+VVV L+ V+LIQ S+    G      F S R TA++L R TA+LAF FF
Sbjct: 1  MQTILLVIYLMVVVALIGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAVLAFLFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF 95
          A ++A+G++SRY   +  D + R    S      D+ 
Sbjct: 61 ALALAMGILSRYE-PQATDILDRIPGTSSSGGVLDSL 96


>gi|294634512|ref|ZP_06713047.1| homoserine dehydrogenase [Edwardsiella tarda ATCC 23685]
 gi|291092026|gb|EFE24587.1| homoserine dehydrogenase [Edwardsiella tarda ATCC 23685]
          Length = 120

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 6/83 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+V+ L++ V L+ +I++Q    +        G+S+       + + + R T ILA
Sbjct: 10 MYEALLVIFLLISVALIALIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRTTGILA 69

Query: 55 FFFFATSIALGMISRYTSTRYKD 77
            FF  S+ LG +S + + +  +
Sbjct: 70 TLFFVLSLVLGNLSGHQNKQGSE 92


>gi|317493623|ref|ZP_07952044.1| preprotein translocase SecG subunit protein [Enterobacteriaceae
          bacterium 9_2_54FAA]
 gi|316918566|gb|EFV39904.1| preprotein translocase SecG subunit protein [Enterobacteriaceae
          bacterium 9_2_54FAA]
          Length = 111

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 6/83 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+V+ L+V +GLV ++++Q    +        G+S+       + + + R TA+LA
Sbjct: 1  MYEALLVIFLLVSIGLVAMVMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRTTAVLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKD 77
            FF  S+ LG +S     +  +
Sbjct: 61 TLFFVLSLVLGNLSGQQGKKGSE 83


>gi|253991505|ref|YP_003042861.1| preprotein translocase subunit SecG [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|211638383|emb|CAR67005.1| protein-export membrane protein secg (preprotein translocase band
           subunit) (p12) [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782955|emb|CAQ86120.1| protein-export membrane protein secg (preprotein translocase band
           subunit) (p12) [Photorhabdus asymbiotica]
          Length = 114

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 48/111 (43%), Gaps = 7/111 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L++V L+V +GL+ ++++Q    +        G+S+       + + + R TAI A
Sbjct: 1   MYEALLIVFLLVAIGLIALVMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG ++    T            +  ++  +     ++P  +S
Sbjct: 61  ALFFIISLVLGNMTSNQ-TGTSSKWENIGEPAKVEKSTEVPTAPAAPTPNS 110


>gi|170696400|ref|ZP_02887529.1| preprotein translocase, SecG subunit [Burkholderia graminis
          C4D1M]
 gi|170138728|gb|EDT06927.1| preprotein translocase, SecG subunit [Burkholderia graminis
          C4D1M]
          Length = 128

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF T++ L  +  Y +      +
Sbjct: 64 AVFFVTTLTLTYLGAYRAKPSAGVL 88


>gi|227112559|ref|ZP_03826215.1| preprotein translocase subunit SecG [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 110

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 48/115 (41%), Gaps = 12/115 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V +GLV +I++Q    +        G+S+       + + + R TAILA
Sbjct: 1   MYEALLVIFLLVSIGLVALIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF  S+ LG +S         +      +  + +  +     ++P   +    
Sbjct: 61  TLFFIISLILGNLSSLQKRGGAWD------NLSQPEKVEQTTTPAAPSTPASDIP 109


>gi|254511065|ref|ZP_05123132.1| preprotein translocase, SecG subunit [Rhodobacteraceae bacterium
           KLH11]
 gi|221534776|gb|EEE37764.1| preprotein translocase, SecG subunit [Rhodobacteraceae bacterium
           KLH11]
          Length = 122

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 53/126 (42%), Gaps = 10/126 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA---HSLGRFTAILAFFF 57
           M+  ++++HL++ +GL+ V+L+Q S+    G         +      +LG+ T ILA  F
Sbjct: 1   MENVVLIIHLLLALGLIAVVLMQRSEGGGLGMGGGGGGAMTGRAAATALGKLTWILAACF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
             TS+ L +++   S+     + R  V +          + S+P + S       S    
Sbjct: 61  IVTSMTLTILAAQKSSG-SSVIDRLGVPAPAS------AEESTPAVPSAEDLLPPSQGDN 113

Query: 118 KRSSSR 123
                +
Sbjct: 114 APLIPQ 119


>gi|307730341|ref|YP_003907565.1| preprotein translocase, SecG subunit [Burkholderia sp. CCGE1003]
 gi|307584876|gb|ADN58274.1| preprotein translocase, SecG subunit [Burkholderia sp. CCGE1003]
          Length = 128

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF T++AL  +  Y        +
Sbjct: 64 AVFFVTTLALTYLGAYRVKPSAGVL 88


>gi|56460079|ref|YP_155360.1| biopolymer transport protein [Idiomarina loihiensis L2TR]
 gi|56179089|gb|AAV81811.1| Biopolymer transport protein [Idiomarina loihiensis L2TR]
          Length = 113

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 48/111 (43%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   LM+  L+V + L+  I++Q    +    +FGS ++ T      + + L R TA LA
Sbjct: 1   MYEILMIAFLVVALVLIGFIMLQQGKGADMGASFGSGASNTVFGSSGSGNFLTRATAGLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG +S  T     D    S+    ++    +    S  ++  
Sbjct: 61  VVFFILSLVLGNLSTSTDESSNDFSDLSVPAEEQELPPADDKSESESEVPP 111


>gi|89055671|ref|YP_511122.1| preprotein translocase subunit SecG [Jannaschia sp. CCS1]
 gi|88865220|gb|ABD56097.1| protein translocase subunit secG [Jannaschia sp. CCS1]
          Length = 123

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 53/122 (43%), Gaps = 11/122 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           M+  ++V+HLI+ + L+ V+L+Q S+    G            + R  A +LG+ T   A
Sbjct: 1   MENVILVIHLILAICLIGVVLLQRSEGGGLGMGGGGGGGGGVMTGRQAATALGKLTWFFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             F ATSI L +I+   S           + +++        D + P +DS+     +  
Sbjct: 61  VAFLATSITLTVIAAQNSAGSSLLDDLGGLPAVEGD-----ADSALPPIDSMLPPIGTDG 115

Query: 115 VA 116
            A
Sbjct: 116 PA 117


>gi|114327491|ref|YP_744648.1| protein translocase subunit secG [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315665|gb|ABI61725.1| protein translocase subunit secG [Granulibacter bethesdensis
           CGDNIH1]
          Length = 133

 Score = 65.6 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/129 (26%), Positives = 54/129 (41%), Gaps = 5/129 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS-----SNFTSVRSTAHSLGRFTAILAF 55
           M   L+++HL V + L+ V+LIQ S+    G        +F S R TA+ L R TAILA 
Sbjct: 1   MNTVLLIIHLFVTLALIGVVLIQRSEGGGLGIGGSQGMGSFMSGRGTANLLTRTTAILAT 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            F   S+ L +++R T+      +      +     +      + P   S  A   +   
Sbjct: 61  LFMLLSLTLALLNRGTAGVGHSVLFGQGTPAAPSSPSLPAAPPAHPPAGSQPAAPDAKTA 120

Query: 116 AGKRSSSRT 124
             K  S+  
Sbjct: 121 VPKTPSAPQ 129


>gi|323525435|ref|YP_004227588.1| preprotein translocase subunit SecG [Burkholderia sp. CCGE1001]
 gi|323382437|gb|ADX54528.1| preprotein translocase, SecG subunit [Burkholderia sp. CCGE1001]
          Length = 131

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF T++AL  +  Y        +
Sbjct: 64 AVFFVTTLALTYLGAYRVKPSAGVL 88


>gi|320540174|ref|ZP_08039829.1| preprotein translocase membrane subunit [Serratia symbiotica str.
           Tucson]
 gi|320029840|gb|EFW11864.1| preprotein translocase membrane subunit [Serratia symbiotica str.
           Tucson]
          Length = 111

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/115 (20%), Positives = 47/115 (40%), Gaps = 11/115 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L++ + LV +I++Q    +        G+S        + + +   TA+LA
Sbjct: 1   MYEALLVIFLLISIALVALIMLQQGKGAQAGASFGAGASGTLFGSSGSGNFMTHMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF  S+ LG +S   S +  +       +  +   ++     S+P   S    
Sbjct: 61  TLFFVISLILGNLSSNKSKKGSE-----WENLGQPVKSEQTTVPSAPAKPSSDIP 110


>gi|300721534|ref|YP_003710809.1| preprotein translocase membrane protein [Xenorhabdus nematophila
           ATCC 19061]
 gi|297628026|emb|CBJ88575.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Xenorhabdus
           nematophila ATCC 19061]
          Length = 112

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 50/110 (45%), Gaps = 7/110 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+ + L+V +GL+ ++L+Q    +    +FG+ ++ T      + + + R TAILA
Sbjct: 1   MYEALLGIFLLVGIGLIALVLLQQGKGADMGASFGAGASNTLFGSSGSGNFMTRMTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             F   S+ LG ++           + S  + ++ Q  D   +   P  D
Sbjct: 61  TLFIVISLILGNMTSNKVGSGSKWDNLSEPEKVEKQT-DIPAEPVKPNSD 109


>gi|284006665|emb|CBA71927.1| protein-export membrane protein [Arsenophonus nasoniae]
          Length = 112

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 47/115 (40%), Gaps = 10/115 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M I L+V+ L+V + L+ ++++Q    +        G+S+       + + + R TAI A
Sbjct: 1   MYITLLVIFLLVSIALIGMVMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF  S+ LG ++   S       +         +     G  ++P + +    
Sbjct: 61  TLFFIISLILGNLTSNKSVTGSKWEN----IGEPVKVEKPAGVPTAPAVPTSDIP 111


>gi|119386420|ref|YP_917475.1| preprotein translocase subunit SecG [Paracoccus denitrificans
           PD1222]
 gi|119377015|gb|ABL71779.1| protein translocase subunit secG [Paracoccus denitrificans PD1222]
          Length = 176

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 47/124 (37%), Gaps = 3/124 (2%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF---TSVRSTAHSLGRFTAILAFFFF 58
           +  ++ VHLI+ V L+ V+L+Q S+    G         + R  A++L R T I A  F 
Sbjct: 3   ENIVLTVHLILAVLLIGVVLLQRSEGGGLGMGGGGGGVMTGRQAANALSRLTWIFAIGFI 62

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
            TS+ L +I+   ++        +L  + +    D  G G                    
Sbjct: 63  ITSMTLTLIAAQNASSGSIVDQLNLGGTEQAPATDLPGIGDYTPPPGAGQPVVPGAGQPV 122

Query: 119 RSSS 122
              +
Sbjct: 123 APPA 126


>gi|126208223|ref|YP_001053448.1| preprotein translocase subunit SecG [Actinobacillus
          pleuropneumoniae L20]
 gi|190150056|ref|YP_001968581.1| protein-export membrane protein [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|303251465|ref|ZP_07337641.1| preprotein translocase subunit SecG [Actinobacillus
          pleuropneumoniae serovar 6 str. Femo]
 gi|303252338|ref|ZP_07338504.1| preprotein translocase subunit SecG [Actinobacillus
          pleuropneumoniae serovar 2 str. 4226]
 gi|307245603|ref|ZP_07527689.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 1 str. 4074]
 gi|307247723|ref|ZP_07529761.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 2 str. S1536]
 gi|307249956|ref|ZP_07531928.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 4 str. M62]
 gi|307252299|ref|ZP_07534196.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 6 str. Femo]
 gi|307254559|ref|ZP_07536393.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307256766|ref|ZP_07538545.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 10 str. D13039]
 gi|307259013|ref|ZP_07540744.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 11 str. 56153]
 gi|307261209|ref|ZP_07542884.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 12 str. 1096]
 gi|307263388|ref|ZP_07545004.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 13 str. N273]
 gi|126097015|gb|ABN73843.1| protein-export membrane protein [Actinobacillus pleuropneumoniae
          serovar 5b str. L20]
 gi|189915187|gb|ACE61439.1| protein-export membrane protein [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|302648797|gb|EFL78987.1| preprotein translocase subunit SecG [Actinobacillus
          pleuropneumoniae serovar 2 str. 4226]
 gi|302649697|gb|EFL79877.1| preprotein translocase subunit SecG [Actinobacillus
          pleuropneumoniae serovar 6 str. Femo]
 gi|306853305|gb|EFM85524.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 1 str. 4074]
 gi|306855753|gb|EFM87918.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 2 str. S1536]
 gi|306858016|gb|EFM90100.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 4 str. M62]
 gi|306860221|gb|EFM92237.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 6 str. Femo]
 gi|306862496|gb|EFM94456.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306864814|gb|EFM96718.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 10 str. D13039]
 gi|306867037|gb|EFM98894.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 11 str. 56153]
 gi|306868940|gb|EFN00742.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 12 str. 1096]
 gi|306871266|gb|EFN02994.1| Preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 13 str. N273]
          Length = 108

 Score = 65.2 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
          M   L +++L+V V L+  +L+Q    +    +FG+ ++ T      +A+ L R TA+LA
Sbjct: 1  MLNVLTIIYLVVAVALIGFVLMQQGKGADAGASFGAGASGTVFGSAGSANFLSRTTAVLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
            FF  S+ +G ++ + +         S V    +Q
Sbjct: 61 IIFFGISLLIGNLNSHQTAPKSQFEDLSGVQQKVEQ 96


>gi|148292186|dbj|BAF62901.1| putative protein-export protein [uncultured bacterium]
          Length = 110

 Score = 64.8 bits (156), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 25/109 (22%), Positives = 42/109 (38%), Gaps = 5/109 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA-----FGSSSNFTSVRSTAHSLGRFTAILAF 55
           +   L+ +HL V V ++ ++L+Q    S       GSS +    R +A  L R TA LA 
Sbjct: 2   LTNILLGLHLAVTVAVIILVLLQQGRGSDAGAVFGGSSQSVFGSRGSASFLSRLTAALAT 61

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
            FF  S+ L  +             R++     +          +P  +
Sbjct: 62  LFFVNSLVLAWLYNRDQADLSVTAPRAVEAVTDEAAEPQSDVPDAPDSN 110


>gi|114764013|ref|ZP_01443254.1| preprotein translocase, SecG subunit [Pelagibaca bermudensis
           HTCC2601]
 gi|114543605|gb|EAU46619.1| preprotein translocase, SecG subunit [Roseovarius sp. HTCC2601]
          Length = 127

 Score = 64.8 bits (156), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD--SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
           MQ  +++VHL++ + L+  +L+Q S+      G      S R+ A +LG+ T ILA  F 
Sbjct: 1   MQNVILIVHLLLALSLIGAVLLQRSEGGGLGMGGGGGAMSQRAAATALGKVTWILAIGFI 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
            TSI L +++   ++            S         G+  +  L    + S S      
Sbjct: 61  VTSITLTILAAQDASGVSVMDRLGGSGSAPATEQTAPGEIDTDALLPPPSASDSETAPDA 120

Query: 119 RSSSR 123
               R
Sbjct: 121 PLVPR 125


>gi|221134252|ref|ZP_03560557.1| hypothetical protein GHTCC_04935 [Glaciecola sp. HTCC2999]
          Length = 136

 Score = 64.8 bits (156), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
          +Q  L+V +LIV + L+ ++LIQ    +    + G   + T      + + L R TAILA
Sbjct: 2  LQEVLIVAYLIVALLLIGLVLIQQGKGADMGASLGGGGSNTVFGSSGSGNFLSRSTAILA 61

Query: 55 FFFFATSIALGMISR 69
            FF  S+ LG ++ 
Sbjct: 62 TLFFLISLLLGNLTA 76


>gi|297538987|ref|YP_003674756.1| preprotein translocase subunit SecG [Methylotenera sp. 301]
 gi|297258334|gb|ADI30179.1| preprotein translocase, SecG subunit [Methylotenera sp. 301]
          Length = 118

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 22/114 (19%), Positives = 49/114 (42%), Gaps = 7/114 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M+  ++V+H+I  +G++ ++L+Q    +        G+S +   V  +A+ + R TA+  
Sbjct: 1   MEKLVLVIHVIAALGVIALVLLQHGKGADMGASFGSGASGSLFGVSGSANFMSRATAVFV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF-GDGSSPKLDSVS 107
             FF TS+ L  +S +           +   ++ +        D  +P +    
Sbjct: 61  LIFFTTSLTLAYMSSHKEGDGSVVKALAEKSAVVNTTAPAAKADAVTPPVAPAQ 114


>gi|238793019|ref|ZP_04636648.1| Protein-export membrane protein secG [Yersinia intermedia ATCC
           29909]
 gi|238727619|gb|EEQ19144.1| Protein-export membrane protein secG [Yersinia intermedia ATCC
           29909]
          Length = 111

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 47/120 (39%), Gaps = 15/120 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V  L++ +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1   MYEALLVFFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ LG +S        +          ++ G     + ++  +      S    
Sbjct: 61  TLFFVISLILGNMSTNQGHTGSE---------WENLGTPAKTEQTTAPVAPAKPSSDIPQ 111


>gi|317123040|ref|YP_004103043.1| protein translocase subunit secG [Thermaerobacter marianensis DSM
          12885]
 gi|315593020|gb|ADU52316.1| protein translocase subunit secG [Thermaerobacter marianensis DSM
          12885]
          Length = 71

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 6/69 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAF------GSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          +++VH++ V+GL+ V+++QS  S+        G+ + F   R     LGR T ILA  FF
Sbjct: 1  MLIVHILAVIGLIAVVVLQSGRSAGLSGAIAGGAEAFFGKRRGLDEFLGRMTVILAVVFF 60

Query: 59 ATSIALGMI 67
           TS  LG  
Sbjct: 61 ITSFVLGYF 69


>gi|254516620|ref|ZP_05128679.1| preprotein translocase, SecG subunit [gamma proteobacterium NOR5-3]
 gi|219675043|gb|EED31410.1| preprotein translocase, SecG subunit [gamma proteobacterium NOR5-3]
          Length = 150

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 53/121 (43%), Gaps = 11/121 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           ++  ++V HL++ + ++ +I++Q    +    +FG+ ++ T      + + L R TA + 
Sbjct: 6   IEQLVLVTHLLLSLAIIGLIILQQGKGADAGASFGAGASQTVFGSTGSGNVLTRATAWMV 65

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS  L +I++  ++   +       +S          D     +D +   S S +
Sbjct: 66  TLFFVTSFGLAVIAKNKTSAVDEFAIPVPTNS-----APATLDAGMEAVDDMRPASESDL 120

Query: 115 V 115
            
Sbjct: 121 P 121


>gi|165976159|ref|YP_001651752.1| preprotein translocase subunit SecG [Actinobacillus
          pleuropneumoniae serovar 3 str. JL03]
 gi|165876260|gb|ABY69308.1| preprotein translocase SecG subunit [Actinobacillus
          pleuropneumoniae serovar 3 str. JL03]
          Length = 108

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
          M   L +++L+V V L+  +L+Q    +    +FG+ ++ T      +A+ L R TA+LA
Sbjct: 1  MLNVLPIIYLVVAVALIGFVLMQQGKGADAGASFGAGASGTVFGSAGSANFLSRTTAVLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
            FF  S+ +G ++ + +         S V    +Q
Sbjct: 61 IIFFGISLLIGNLNSHQTAPKSQFEDLSGVQQKVEQ 96


>gi|329889378|ref|ZP_08267721.1| preprotein translocase, SecG subunit [Brevundimonas diminuta ATCC
          11568]
 gi|328844679|gb|EGF94243.1| preprotein translocase, SecG subunit [Brevundimonas diminuta ATCC
          11568]
          Length = 138

 Score = 64.8 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 3/73 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS---SNFTSVRSTAHSLGRFTAILAFFF 57
          +Q  L+V  +++ V L  VIL+Q S+  A G     S F + R   + L R T+ILA  F
Sbjct: 6  LQTILLVAMILISVALSAVILLQRSEGGALGMGGGPSGFMTARGAGNLLTRTTSILAIAF 65

Query: 58 FATSIALGMISRY 70
          F  +I L +   Y
Sbjct: 66 FVCAIGLTIAGNY 78


>gi|50119650|ref|YP_048817.1| preprotein translocase subunit SecG [Pectobacterium atrosepticum
           SCRI1043]
 gi|49610176|emb|CAG73616.1| protein-export membrane protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 110

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 48/115 (41%), Gaps = 12/115 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V +GLV +I++Q    +        G+S+       +++ + R TAILA
Sbjct: 1   MYEALLVIFLLVSIGLVALIMLQQGKGADMGASFGAGASATLFGSSGSSNFMTRMTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF  S+ LG +S         +      +  + +  +      +P   +    
Sbjct: 61  TLFFIISLILGNLSTLQKKGGAWD------NLSQPEKVEQTTTPVAPSTPASDIP 109


>gi|237808993|ref|YP_002893433.1| preprotein translocase, SecG subunit [Tolumonas auensis DSM 9187]
 gi|237501254|gb|ACQ93847.1| preprotein translocase, SecG subunit [Tolumonas auensis DSM 9187]
          Length = 115

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 44/104 (42%), Gaps = 7/104 (6%)

Query: 13  VVGLVCVILIQSSDSSA----FGSSSNFTSVR--STAHSLGRFTAILAFFFFATSIALGM 66
            + LV ++L+Q    ++    FG+ ++ T      + + L + TAILA  FF  S+ALG 
Sbjct: 13  AIALVGLVLVQHGKGASMGASFGAGASNTVFGSSGSGNFLTKSTAILAILFFVISLALGA 72

Query: 67  ISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
           ++     +  DN       +  +Q  D   + +          +
Sbjct: 73  MTNNR-NKPADNWSDLTKPATTEQTVDKPAEKAVDVKKDADVPN 115


>gi|146276923|ref|YP_001167082.1| preprotein translocase subunit SecG [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555164|gb|ABP69777.1| protein translocase subunit secG [Rhodobacter sphaeroides ATCC
           17025]
          Length = 207

 Score = 64.4 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 48/123 (39%), Gaps = 13/123 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD--SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
           MQ  +++VHLI+ + L+ V+L+Q S+      G      + R  A+++ R T + A  F 
Sbjct: 1   MQNVVLIVHLILALLLIGVVLLQRSEGGGLGMGGGGGAMTGRQAANAMTRLTWVFAVAFI 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
            TSIAL + +   S         S++D              +P              A  
Sbjct: 61  GTSIALTIFAAQNSHGS------SVIDQFGGTTR-----QQAPATPEAPLGGDLLPPAPT 109

Query: 119 RSS 121
            + 
Sbjct: 110 NAP 112


>gi|78485161|ref|YP_391086.1| preprotein translocase, SecG subunit [Thiomicrospira crunogena
           XCL-2]
 gi|78363447|gb|ABB41412.1| protein translocase subunit secG [Thiomicrospira crunogena XCL-2]
          Length = 106

 Score = 64.0 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 49/108 (45%), Gaps = 8/108 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   ++ +HL++   L+ ++L+Q    +        GSS +      + + + + T+++A
Sbjct: 1   MFQIILAIHLVIAFILIVLVLLQQGKGADAGANFGGGSSQSVFGSSGSNNFMLKMTSVVA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF TS+AL  +    +  Y+  + +    + ++  + +  +   P 
Sbjct: 61  VVFFITSLALAYLGAQQAKGYQSVVQK--PAAEQNAADSDTNEPVVPN 106


>gi|295676036|ref|YP_003604560.1| preprotein translocase, SecG subunit [Burkholderia sp. CCGE1002]
 gi|295435879|gb|ADG15049.1| preprotein translocase, SecG subunit [Burkholderia sp. CCGE1002]
          Length = 131

 Score = 64.0 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FFAT++AL  +  Y        +
Sbjct: 64 ALFFATTLALTYLGAYHVKPSAGVL 88


>gi|126739990|ref|ZP_01755680.1| preprotein translocase, SecG subunit [Roseobacter sp. SK209-2-6]
 gi|126718809|gb|EBA15521.1| preprotein translocase, SecG subunit [Roseobacter sp. SK209-2-6]
          Length = 122

 Score = 64.0 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 9/107 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           M+  ++++HL++ +GL+ V+L+Q S+       G      + RS A +L + T  LA  F
Sbjct: 1   MENVVLIIHLLLALGLIAVVLLQRSEGGGLGMGGGGGGAMTGRSAATALSKVTWALAIAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             TS+ L +++   S         S+ D I+     + G  S+P   
Sbjct: 61  ICTSVTLTVLAAQKSAGS------SVTDRIEATDGADEGAASAPAAP 101


>gi|313903094|ref|ZP_07836488.1| protein translocase subunit secG [Thermaerobacter subterraneus
          DSM 13965]
 gi|313466596|gb|EFR62116.1| protein translocase subunit secG [Thermaerobacter subterraneus
          DSM 13965]
          Length = 71

 Score = 64.0 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 6/69 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAF------GSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          ++++H++ V+GL+ V+++QS  S+        G+ + F   R     LGR T ILA  FF
Sbjct: 1  MLILHILAVIGLIAVVILQSGRSAGLSGAIAGGAEAFFGKRRGLDDFLGRMTVILAVVFF 60

Query: 59 ATSIALGMI 67
           TS  LG  
Sbjct: 61 VTSFVLGYF 69


>gi|89067833|ref|ZP_01155277.1| preprotein translocase, SecG subunit [Oceanicola granulosus
           HTCC2516]
 gi|89046431|gb|EAR52487.1| preprotein translocase, SecG subunit [Oceanicola granulosus
           HTCC2516]
          Length = 120

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 51/107 (47%), Gaps = 5/107 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           M+  +++VHL++ + L+ V+L+Q S+       G      + RS A +LG+ T  LA  F
Sbjct: 1   MENVILIVHLLLALSLIGVVLMQRSEGGGLGIGGGGGGMMTGRSAATALGKVTWGLAVAF 60

Query: 58  FATSIALGMISRYTSTRYK--DNMHRSLVDSIKDQGNDNFGDGSSPK 102
             TSIAL +++   S      D +  +   +  D   D  G+   P 
Sbjct: 61  IITSIALTIMAARDSASGSVLDRITDTPAGAASDALPDLGGESLLPP 107


>gi|163752376|ref|ZP_02159571.1| preprotein translocase, SecG subunit [Shewanella benthica KT99]
 gi|161327748|gb|EDP98935.1| preprotein translocase, SecG subunit [Shewanella benthica KT99]
          Length = 106

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 6  MVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
          MVV+L+V +GLV +ILIQ    +        G+S+         + L R TA+LA  FFA
Sbjct: 1  MVVYLLVAIGLVGLILIQQGKGADMGASFGAGASATLFGSSGAGNFLTRSTAVLAIGFFA 60

Query: 60 TSIALGMISRYTSTR 74
           S+ +G +S   +  
Sbjct: 61 LSLIIGNLSANHTRS 75


>gi|296160628|ref|ZP_06843443.1| preprotein translocase, SecG subunit [Burkholderia sp. Ch1-1]
 gi|295889154|gb|EFG68957.1| preprotein translocase, SecG subunit [Burkholderia sp. Ch1-1]
          Length = 125

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF T++ L  +  Y +      +
Sbjct: 64 AVFFVTTLTLTYLGAYRAKPSAGVL 88


>gi|187923339|ref|YP_001894981.1| preprotein translocase subunit SecG [Burkholderia phytofirmans
          PsJN]
 gi|187714533|gb|ACD15757.1| preprotein translocase, SecG subunit [Burkholderia phytofirmans
          PsJN]
          Length = 125

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF T++ L  +  Y +      +
Sbjct: 64 AVFFVTTLTLTYLGAYRAKPSAGVL 88


>gi|259416202|ref|ZP_05740122.1| preprotein translocase subunit SecG [Silicibacter sp. TrichCH4B]
 gi|259347641|gb|EEW59418.1| preprotein translocase subunit SecG [Silicibacter sp. TrichCH4B]
          Length = 121

 Score = 64.0 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 57/120 (47%), Gaps = 6/120 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M+  ++++HL++ +GL+ V+L+Q S+        G      + R+ A +L + T +LA  
Sbjct: 1   MENVVLIIHLLLALGLIAVVLLQRSEGGGLGMGGGGGGGAMTGRAAATALSKVTWVLAIA 60

Query: 57  FFATSIALGMISRYTSTRY--KDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
           F ATSI L +++   S R    D++  S  DS  D      G+   P     +A    S 
Sbjct: 61  FIATSITLTVLAAQKSGRSSITDSLVPSTQDSTPDAPTSPLGNDLLPPSSGENAPLVPSA 120


>gi|209518516|ref|ZP_03267337.1| preprotein translocase, SecG subunit [Burkholderia sp. H160]
 gi|209501061|gb|EEA01096.1| preprotein translocase, SecG subunit [Burkholderia sp. H160]
          Length = 128

 Score = 63.6 bits (153), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 42/81 (51%), Gaps = 6/81 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRY 75
            FFAT++AL  +  Y     
Sbjct: 64 ALFFATTLALTYLGAYHVKPS 84


>gi|74317159|ref|YP_314899.1| preprotein translocase subunit SecG [Thiobacillus denitrificans
          ATCC 25259]
 gi|74056654|gb|AAZ97094.1| preprotein translocase SecG subunit [Thiobacillus denitrificans
          ATCC 25259]
          Length = 114

 Score = 63.6 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 7/90 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILA 54
          M+  + V+H+IV + ++ ++L+Q    +  G++    S  S       A+ L R TAI+A
Sbjct: 1  METLVWVLHVIVAIAVIALVLLQHGKGADMGAAFGSGSSGSLFGASGSANFLSRSTAIVA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLV 84
            FF TS+ L         +    + R+ V
Sbjct: 61 TLFFLTSLGLAYFG-LQQHKPASVLDRTQV 89


>gi|53805148|ref|YP_113188.1| preprotein translocase subunit SecG [Methylococcus capsulatus str.
           Bath]
 gi|53758909|gb|AAU93200.1| preprotein translocase, SecG subunit [Methylococcus capsulatus str.
           Bath]
          Length = 117

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 50/122 (40%), Gaps = 15/122 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV------RSTAHSLGRFTAILA 54
           M   L V H+++ + +V ++L+Q    +  G+     S       R  A  L R TAILA
Sbjct: 1   MIQALTVFHVLLALSIVGLVLLQQGRGADAGAGFGGGSSGSLFGARGAASFLSRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ L  +S +   +  D M    V   +            P +    AKS S V
Sbjct: 61  TLFFGTSLTLAYLSGHVDNKRLDIMDVPAVQQSQP---------DMPAVAPEPAKSGSDV 111

Query: 115 VA 116
            A
Sbjct: 112 PA 113


>gi|91782611|ref|YP_557817.1| preprotein translocase subunit SecG [Burkholderia xenovorans
          LB400]
 gi|91686565|gb|ABE29765.1| protein translocase subunit secG [Burkholderia xenovorans LB400]
          Length = 128

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 41/81 (50%), Gaps = 6/81 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRY 75
            FF T++ L  +  Y +   
Sbjct: 64 AVFFITTLTLTYLGAYRAKPS 84


>gi|33152359|ref|NP_873712.1| preprotein translocase subunit SecG [Haemophilus ducreyi 35000HP]
 gi|33148582|gb|AAP96101.1| preprotein translocase SecG subunit [Haemophilus ducreyi 35000HP]
          Length = 109

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 47/99 (47%), Gaps = 6/99 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
          M   L +++LIV + L+  +L+Q    +    +FG+ ++ T      +A+ L R TA LA
Sbjct: 1  MLNVLTIIYLIVAIILIGFVLMQQGKGADTGASFGAGASGTVFGSAGSANFLSRTTAFLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
            FFA S+ +G ++ + +         S +    +Q   
Sbjct: 61 TIFFALSLLIGNLNSHKTGNVSQFEDLSGIQQKVEQSTK 99


>gi|17982794|gb|AAL52028.1| hypothetical protein BMEI0847 [Brucella melitensis bv. 1 str. 16M]
          Length = 129

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 49/105 (46%), Gaps = 12/105 (11%)

Query: 20  ILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKD 77
           +LIQ S+    G      F + R  A++L R TAILA  FFATS+ LG+++RY   R  D
Sbjct: 1   MLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFFATSLLLGIMARY-GERPTD 59

Query: 78  NMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSS 122
            ++R              G  S+P   S +       + G+ S S
Sbjct: 60  ILNRIPA---------TTGSQSAPAGGSTNGGGILDQLGGEPSGS 95


>gi|167585970|ref|ZP_02378358.1| hypothetical protein BuboB_11570 [Burkholderia ubonensis Bu]
          Length = 116

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQVLAALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRATAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL  +  Y ST     +
Sbjct: 64 TIFFVATLALTYLGSYKSTPSAGVL 88


>gi|257453565|ref|ZP_05618855.1| preprotein translocase subunit SecG [Enhydrobacter aerosaccus
          SK60]
 gi|257449023|gb|EEV23976.1| preprotein translocase subunit SecG [Enhydrobacter aerosaccus
          SK60]
          Length = 106

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 6/82 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
          M   ++VVH+IV + ++ +IL+Q    +    +FG+  + T      +A+ L R TA+L 
Sbjct: 1  MYNAILVVHIIVAISMIGLILVQHGKGADAGASFGAGGSATVFGASGSANFLTRLTAVLT 60

Query: 55 FFFFATSIALGMISRYTSTRYK 76
            FF TS+ L + ++  S   +
Sbjct: 61 AIFFITSMTLAVFAKQQSLSSR 82


>gi|160871839|ref|ZP_02061971.1| preprotein translocase SecG subunit [Rickettsiella grylli]
 gi|159120638|gb|EDP45976.1| preprotein translocase SecG subunit [Rickettsiella grylli]
          Length = 116

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/109 (21%), Positives = 52/109 (47%), Gaps = 8/109 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           +Q FL+++H+I+ + L+ ++LIQ    +  G++            + ++  L + T + A
Sbjct: 2   LQQFLVLMHVIISLALIALVLIQQDKGAELGATFGSAASQTVFGSQGSSSFLLKLTGLFA 61

Query: 55  FFFFATSIALGMISRYTS--TRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
             FF TS++LG ++ + +     ++ ++R    S   Q      +   P
Sbjct: 62  LLFFMTSLSLGYLAGHRAKQDPIQNLVNRGHASSFAQQSEPPRLEHEPP 110


>gi|37528351|ref|NP_931696.1| preprotein translocase subunit SecG [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36787789|emb|CAE16904.1| Protein-export membrane protein SecG (Preprotein translocase band 1
           subunit) (P12) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 112

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/110 (20%), Positives = 47/110 (42%), Gaps = 7/110 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV L+V +GL+ ++++Q    +        G+S+       + + + R TA+ A
Sbjct: 1   MYGALLVVFLLVAIGLIALVMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG ++    T            +  ++  +     ++P  D
Sbjct: 61  TLFFIISLVLGNMTSNQ-TGASSKWENIGEPAKVEKSTEIPTAPAAPNSD 109


>gi|332090680|gb|EGI95774.1| preprotein translocase, SecG subunit [Shigella boydii 3594-74]
          Length = 105

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 47/114 (41%), Gaps = 15/114 (13%)

Query: 6   MVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
           MVV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA  FF 
Sbjct: 1   MVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFFI 60

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
            S+ LG I+   + +  +          ++       + + P   +       +
Sbjct: 61  ISLVLGNINSNKTNKGSE---------WENLSAPAKTEQTQPAAPAKPTSDIPN 105


>gi|253998382|ref|YP_003050445.1| preprotein translocase subunit SecG [Methylovorus sp. SIP3-4]
 gi|253985061|gb|ACT49918.1| preprotein translocase, SecG subunit [Methylovorus sp. SIP3-4]
          Length = 116

 Score = 62.9 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/116 (20%), Positives = 54/116 (46%), Gaps = 11/116 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M+  + +VH++  +G++ ++L+Q    +        G+S +   V  +++ + R TA+  
Sbjct: 1   METLVSIVHVLAALGVIGLVLLQHGKGADMGAAFGSGASGSLFGVSGSSNFMSRATAVFV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FFATS+ L  +S + +        +   +S+   G       S+P   + S+ +
Sbjct: 61  AIFFATSLTLAYMSSHRTQGSSVV--KLPTNSVVAPGK---ASESAPAKPAESSPA 111


>gi|149914502|ref|ZP_01903032.1| adenylosuccinate synthetase [Roseobacter sp. AzwK-3b]
 gi|149811295|gb|EDM71130.1| adenylosuccinate synthetase [Roseobacter sp. AzwK-3b]
          Length = 121

 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 53/111 (47%), Gaps = 4/111 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           M+  ++ VHL++ + L+ V+L+Q S+       G      + R+ A +LG+ T ILA  F
Sbjct: 1   MENVVLTVHLLLALALIGVVLLQRSEGGGLGMGGGGGGAMTGRAAATALGKVTWILAIAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             TS+ L +++   +      + R     ++++  D    G+   L   SA
Sbjct: 61  IITSLTLTVLAAQKA-GGSSVLDRITDAPLREEPADPVLPGTGGDLLPPSA 110


>gi|118589927|ref|ZP_01547331.1| preprotein translocase SecG subunit [Stappia aggregata IAM 12614]
 gi|118437424|gb|EAV44061.1| preprotein translocase SecG subunit [Stappia aggregata IAM 12614]
          Length = 127

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 3/127 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF---TSVRSTAHSLGRFTAILAFFF 57
           M+  ++V+HL+VV+ LV V+L+Q S+  A G         S R TA+ L R TA+LA  F
Sbjct: 1   METVVIVIHLMVVLALVLVVLLQRSEGGALGIGGGGGGLMSSRGTANILTRATAVLAVAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           FATS+ L +I++                       D   +G S  +     + +    +G
Sbjct: 61  FATSLTLSLIAKNQDRPGSILDAVPTATQEVPATTDGTTEGGSGGVLDSLKQLNQQQPSG 120

Query: 118 KRSSSRT 124
            +  +  
Sbjct: 121 PQVPAAQ 127


>gi|302383246|ref|YP_003819069.1| preprotein translocase subunit SecG [Brevundimonas subvibrioides
          ATCC 15264]
 gi|302193874|gb|ADL01446.1| preprotein translocase, SecG subunit [Brevundimonas subvibrioides
          ATCC 15264]
          Length = 137

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 3/79 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS---SNFTSVRSTAHSLGRFTAILAFFF 57
          +Q  L+VV +++ + L  VIL+Q S+  A G     S F + R   + L   T  L   F
Sbjct: 2  LQTILLVVMILISLALTGVILLQRSEGGALGMGGGPSGFMTARGAGNLLTTTTWWLGAGF 61

Query: 58 FATSIALGMISRYTSTRYK 76
             +I+L +I     +   
Sbjct: 62 VICAISLTIIGNVERSNRS 80


>gi|330994541|ref|ZP_08318465.1| preprotein translocase subunit SecG [Gluconacetobacter sp.
          SXCC-1]
 gi|329758395|gb|EGG74915.1| preprotein translocase subunit SecG [Gluconacetobacter sp.
          SXCC-1]
          Length = 101

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS-----SNFTSVRSTAHSLGRFTAILAF 55
          M   L+++HL V + L+  ILIQ S+    G        +F S R TA  L R TA+L  
Sbjct: 1  MITVLLLLHLFVTIALIGTILIQRSEGGGLGIGGSQGMGSFMSGRGTATLLTRSTAVLGT 60

Query: 56 FFFATSIALGMISRYTSTR 74
           F   S+ L +++R  S+ 
Sbjct: 61 VFMVLSLTLAVMNRGASSG 79


>gi|92117283|ref|YP_577012.1| preprotein translocase subunit SecG [Nitrobacter hamburgensis X14]
 gi|91800177|gb|ABE62552.1| protein translocase subunit secG [Nitrobacter hamburgensis X14]
          Length = 130

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           M   ++VVHLI+V  L  ++L+Q S+    G      F S R TA+ L R TA LA  FF
Sbjct: 1   MHTVVIVVHLIIVATLTVIVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTAFLAAGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
           ATS+ L  ++ Y   +    +  +     +  G      G++P     S  
Sbjct: 61  ATSLFLSWLAGYD-HKPGSILDGTPASQSQPAG------GATPVAPPASGG 104


>gi|315499881|ref|YP_004088684.1| preprotein translocase, secg subunit [Asticcacaulis excentricus
          CB 48]
 gi|315417893|gb|ADU14533.1| preprotein translocase, SecG subunit [Asticcacaulis excentricus
          CB 48]
          Length = 180

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSS---SNFTSVRSTAHSLGRFTAILAFFFFAT 60
           L+ + +++ + LV +IL+Q S+  A G     S F S R   + L + T+ILAF FFA 
Sbjct: 5  ILLSIQILIGIALVGLILVQRSEGGALGMGGGPSGFMSARGAGNFLTKATSILAFLFFAN 64

Query: 61 SIALGMISRYTSTRYK 76
           IAL ++S        
Sbjct: 65 CIALTVVSNLDRRGTS 80


>gi|213422395|ref|ZP_03355461.1| hypothetical protein Salmonentericaenterica_33530 [Salmonella
          enterica subsp. enterica serovar Typhi str. E01-6750]
          Length = 82

 Score = 62.5 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 4  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 63

Query: 55 FFFFATSIALGMISRYTST 73
            FF  S+ LG I+   + 
Sbjct: 64 TLFFIISLVLGNINSNKTN 82


>gi|148555264|ref|YP_001262846.1| protein translocase subunit secG [Sphingomonas wittichii RW1]
 gi|148500454|gb|ABQ68708.1| protein translocase subunit secG [Sphingomonas wittichii RW1]
          Length = 124

 Score = 62.1 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAF---GSSSNFTSVRSTAHSLGRFTAILAFFF 57
           FL+VVH+IV   LV +IL+Q S+       GS     S R  A  L R TAILA  F
Sbjct: 4  TFLLVVHIIVATALVAIILVQRSEGGGLTSGGSPGGLMSARGAADFLTRTTAILAGIF 61


>gi|114778953|ref|ZP_01453744.1| Preprotein translocase SecG subunit [Mariprofundus ferrooxydans
           PV-1]
 gi|114550825|gb|EAU53393.1| Preprotein translocase SecG subunit [Mariprofundus ferrooxydans
           PV-1]
          Length = 127

 Score = 62.1 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 45/118 (38%), Gaps = 6/118 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L++VH++V + L+  +L+Q    +        G +      R +   LG+ T  LA
Sbjct: 1   MTTILIIVHVLVALLLIGTVLVQRGQGADMGVSFGGGGAQTLFGSRGSGSFLGKLTGGLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             F  TS+ L   S+  +    D         I+        +G  P      A +S+
Sbjct: 61  AAFMLTSLTLAFFSQQQTGSVVDRSLAGQATPIQQPAGTPQQEGFDPSKLKSDAPASA 118


>gi|313200457|ref|YP_004039115.1| preprotein translocase subunit SecG [Methylovorus sp. MP688]
 gi|312439773|gb|ADQ83879.1| preprotein translocase, SecG subunit [Methylovorus sp. MP688]
          Length = 116

 Score = 62.1 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/116 (20%), Positives = 54/116 (46%), Gaps = 11/116 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M+  + +VH++  +G++ ++L+Q    +        G+S +   V  +++ + R TA+  
Sbjct: 1   METLVSIVHVLAALGVIGLVLLQHGKGADMGAAFGSGASGSLFGVSGSSNFMSRATAVFV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FFATS+ L  +S + +        +   +S+   G       S+P   + S+ +
Sbjct: 61  GIFFATSLTLAYMSSHRTQGSSVV--KLPTNSVVAPGK---ASESAPAKPAESSPA 111


>gi|88797620|ref|ZP_01113209.1| preprotein translocase, SecG subunit [Reinekea sp. MED297]
 gi|88779792|gb|EAR10978.1| preprotein translocase, SecG subunit [Reinekea sp. MED297]
          Length = 115

 Score = 62.1 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 43/83 (51%), Gaps = 6/83 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILAF 55
          +  ++++H+ + +G+V  +L+Q    +    +FG  ++ T      + + L R TAIL  
Sbjct: 4  ENLILLIHVALAIGVVVFVLLQRGKGAEAGASFGGGASQTVFGSSGSGNFLTRTTAILVA 63

Query: 56 FFFATSIALGMISRYTSTRYKDN 78
           FF TS+AL  +++  +    + 
Sbjct: 64 GFFLTSMALAYVAKQRAEDMNNI 86


>gi|85716535|ref|ZP_01047506.1| hypothetical protein NB311A_06321 [Nitrobacter sp. Nb-311A]
 gi|85696724|gb|EAQ34611.1| hypothetical protein NB311A_06321 [Nitrobacter sp. Nb-311A]
          Length = 129

 Score = 62.1 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 34/130 (26%), Positives = 55/130 (42%), Gaps = 8/130 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  ++V+HLI+V  L  ++L+Q S+    G      F S R TA+ L R TA LA  FF
Sbjct: 1   MQTVVIVIHLIIVSVLTVIVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTAFLAAGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND-----NFGDGSSPKLDSVSAKSSSS 113
           ATS+ L  ++     +    +  +     +  G         G G    L      ++ +
Sbjct: 61  ATSLFLSWLAGAH-QKPSSILDGAPASQSQPAGGTAPVAPPGGGGLLDSLKQSERPATPA 119

Query: 114 VVAGKRSSSR 123
               +   S+
Sbjct: 120 PAGPQAPRSQ 129


>gi|134095032|ref|YP_001100107.1| IISP family preprotein translocase auxillary membrane component
           [Herminiimonas arsenicoxydans]
 gi|133738935|emb|CAL61982.1| Preprotein translocase SecG subunit [Herminiimonas arsenicoxydans]
          Length = 132

 Score = 62.1 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/119 (18%), Positives = 49/119 (41%), Gaps = 6/119 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           +   ++VV ++  + ++ ++L+Q    +        G+S +      +++ L +FT + A
Sbjct: 4   LHTIIVVVQVLSALTIIGLVLLQHGKGADMGASFGSGASGSLFGATGSSNFLSKFTGVAA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FFA ++ L  IS   +      M    V ++      +     +P      A +S S
Sbjct: 64  AIFFAATLGLAFISNKPAQTSAGVMENLPVSAVPGAETKSAEVPGAPANVQPVAPASPS 122


>gi|294789673|ref|ZP_06754906.1| homoserine dehydrogenase [Simonsiella muelleri ATCC 29453]
 gi|294482385|gb|EFG30079.1| homoserine dehydrogenase [Simonsiella muelleri ATCC 29453]
          Length = 194

 Score = 62.1 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDS-------SAFGSSSNFTSVRSTAHSLGRFTAILA 54
          +  + ++++   + ++ ++LIQ              GS+         A+ L R T I A
Sbjct: 5  KTVIWIINIFASLAVIGLVLIQHGKGADAGANFGGSGSAQGVFGSGGNANFLTRITGIAA 64

Query: 55 FFFFATSIALGMISRYTSTR 74
            FFA+ +ALG I   ++ +
Sbjct: 65 TIFFASCLALGYIHTKSNNK 84


>gi|319779193|ref|YP_004130106.1| Preprotein translocase subunit SecG [Taylorella equigenitalis MCE9]
 gi|317109217|gb|ADU91963.1| Preprotein translocase subunit SecG [Taylorella equigenitalis MCE9]
          Length = 242

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 52/127 (40%), Gaps = 15/127 (11%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILAFFF 57
            L+V+ +I  + ++ ++L+Q    +  GSS              +A+   R T   A  F
Sbjct: 8   ILVVIQVISSLAIIGLVLLQQGKGADMGSSFGGGSAGSLFGAAGSANFFSRMTKWAAVAF 67

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           FA+++ L  +S     +              D G+   G  ++P +    + + S+VV G
Sbjct: 68  FASTLGLAWVSSGGGIK---------APKPTDGGSVMEGYSATPVVPGAGSVAGSAVVGG 118

Query: 118 KRSSSRT 124
              +S T
Sbjct: 119 DEGNSTT 125


>gi|254361631|ref|ZP_04977769.1| Sec family Type II general secretory pathway preprotein
          translocase SecG [Mannheimia haemolytica PHL213]
 gi|261496381|ref|ZP_05992775.1| Sec family Type II general secretory pathway preprotein
          translocase SecG [Mannheimia haemolytica serotype A2
          str. OVINE]
 gi|153093149|gb|EDN74165.1| Sec family Type II general secretory pathway preprotein
          translocase SecG [Mannheimia haemolytica PHL213]
 gi|261307966|gb|EEY09275.1| Sec family Type II general secretory pathway preprotein
          translocase SecG [Mannheimia haemolytica serotype A2
          str. OVINE]
          Length = 108

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 6/92 (6%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILAFF 56
            L +V+L+V V L+  +L+Q    +    +FG+ ++ T      +A+ L R TA+LA  
Sbjct: 4  NVLTIVYLVVAVLLIAFVLMQQGKGADAGASFGAGASATVFGSAGSANFLSRTTALLATI 63

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
          FFA S+ +G +S +           S V+  +
Sbjct: 64 FFAISLVIGNLSSHNVAPKSQFEDLSQVEQKQ 95


>gi|260753026|ref|YP_003225919.1| preprotein translocase, SecG subunit [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258552389|gb|ACV75335.1| preprotein translocase, SecG subunit [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 119

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 42/113 (37%), Gaps = 3/113 (2%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSAFGSS---SNFTSVRSTAHSLGRFTAILAFFFFA 59
             L+VV  +V   LV VIL+Q S+ S            S    A+ L R T  LA  F  
Sbjct: 4   TILIVVQALVAAALVTVILMQQSEGSGITGGSNPGGLMSASGAANFLTRATGALAVLFVV 63

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
            SIAL  ++   +T  + ++  +     +              +      +++
Sbjct: 64  LSIALAALASVQNTAPQIDISLAHKPVAQQTAPAQPAQPKPSSVPLADQPATT 116


>gi|254427158|ref|ZP_05040865.1| preprotein translocase SecG subunit, putative [Alcanivorax sp.
           DG881]
 gi|196193327|gb|EDX88286.1| preprotein translocase SecG subunit, putative [Alcanivorax sp.
           DG881]
          Length = 147

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 46/123 (37%), Gaps = 15/123 (12%)

Query: 15  GLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMIS 68
           GLV ++LIQ    +  G+S              +A+ L R TA+LA  FF TS+ L  ++
Sbjct: 15  GLVGLVLIQHGKGADAGASFGGGGSQTVFGSAGSANFLTRATAVLAAVFFVTSLVLAWMA 74

Query: 69  RYTSTRYKDNMH-------RSLVDSIKDQGNDNFGDGSSPKLDS--VSAKSSSSVVAGKR 119
           R  +   +  +        + +    + Q +   G    P         K  S V   + 
Sbjct: 75  RQEADSTRSFLPELETVEHQDVPVVDEPQSDVPAGMTEVPVAPEANEGQKEVSDVPQAEV 134

Query: 120 SSS 122
            S 
Sbjct: 135 ESP 137


>gi|119477405|ref|ZP_01617596.1| Preprotein translocase SecG subunit [marine gamma proteobacterium
           HTCC2143]
 gi|119449331|gb|EAW30570.1| Preprotein translocase SecG subunit [marine gamma proteobacterium
           HTCC2143]
          Length = 134

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/127 (18%), Positives = 48/127 (37%), Gaps = 6/127 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M+  +++VH++V + ++ +I+IQ    +        G+S          + L   T+ L 
Sbjct: 1   MEQIVLIVHVLVALAIIGLIMIQQGKGADMGASFGAGASQTLFGSGGGGNVLTSATSWLV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FFATS  L +I++  S    +            +   +  +   P +D+   +     
Sbjct: 61  TLFFATSFGLAVIAKENSMAAGNVDLPMPAVIESFEMPADVRESDIPGVDAAVFEEIPGA 120

Query: 115 VAGKRSS 121
                 S
Sbjct: 121 DVPVEGS 127


>gi|23015301|ref|ZP_00055081.1| COG1314: Preprotein translocase subunit SecG [Magnetospirillum
          magnetotacticum MS-1]
          Length = 112

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV----RSTAHSLGRFTAILAFFFFA 59
           ++V+HLI+ V LV VIL+Q S+  A G            R+  + L R T I+A  FF 
Sbjct: 6  IILVIHLILAVTLVGVILLQRSEGGALGIGGGSGGGLMTGRAAGNLLTRTTGIVAAAFFV 65

Query: 60 TSIALGMISRYTSTRYKD 77
          TS+ L +++   +     
Sbjct: 66 TSLGLALLANSRTGGGSP 83


>gi|320536206|ref|ZP_08036254.1| preprotein translocase, SecG subunit [Treponema phagedenis F0421]
 gi|320146962|gb|EFW38530.1| preprotein translocase, SecG subunit [Treponema phagedenis F0421]
          Length = 128

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 51/123 (41%), Gaps = 7/123 (5%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDS---SAFGSSSNFTSVRS-TAHSLGRFTAILAFFFF 58
           I L+V  +I+   LV ++L+Q+ +        +  + ++  S + + L + T +L   FF
Sbjct: 6   IVLLVFFVIICFLLVGLVLLQNEEGDSLGGLFAGGSNSAFGSRSGNILTKTTYVLLALFF 65

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKD---QGNDNFGDGSSPKLDSVSAKSSSSVV 115
            T+  L  +++  +        +           + ND     ++   +  + K+ +   
Sbjct: 66  VTTFFLAWLNKSPAIDDLQKAAQQQQTETATEWWKDNDTNQPDAAKPAEQTTPKAENEAG 125

Query: 116 AGK 118
           AGK
Sbjct: 126 AGK 128


>gi|110679196|ref|YP_682203.1| preprotein translocase subunit SecG [Roseobacter denitrificans OCh
           114]
 gi|109455312|gb|ABG31517.1| preprotein translocase, SecG subunit, putative [Roseobacter
           denitrificans OCh 114]
          Length = 121

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 52/116 (44%), Gaps = 7/116 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           M+  ++++HLI+ +GL+ V+L+Q S+       G      + R+ A +LG+ T +LA  F
Sbjct: 1   MENVVLIIHLILALGLIAVVLLQRSEGGGLGMGGGGGGAMTGRAAATALGKVTWLLAIAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             TSI L + +   +      + R     +     D     + P  D +   S+  
Sbjct: 61  ICTSITLTIFAA-ENASGSSVIDRL---GVTPPAADRGETPALPDSDLLLPPSADE 112


>gi|134296434|ref|YP_001120169.1| preprotein translocase subunit SecG [Burkholderia vietnamiensis
          G4]
 gi|134139591|gb|ABO55334.1| protein translocase subunit secG [Burkholderia vietnamiensis G4]
          Length = 128

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 42/84 (50%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y +T     +
Sbjct: 65 VFFIATLALTYLGSYKATPSAGVL 88


>gi|302036467|ref|YP_003796789.1| preprotein translocase, membrane subunit SecG [Candidatus
          Nitrospira defluvii]
 gi|300604531|emb|CBK40863.1| Preprotein translocase, membrane subunit SecG [Candidatus
          Nitrospira defluvii]
          Length = 117

 Score = 61.7 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 48/96 (50%), Gaps = 6/96 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS-----VRSTAHSLGRFTAILAF 55
          M   L+++H+IV + ++  IL+QS   +  G++   +S      R  A+ L +FT I AF
Sbjct: 1  MYTLLIIIHVIVCLLMIGAILLQSGKGAEIGAAFGGSSQTVFGSRGPANFLSKFTVITAF 60

Query: 56 FFFATSIALGMISRYTSTRYKDN-MHRSLVDSIKDQ 90
           F  TS++L +I++  +       +++    +    
Sbjct: 61 VFMFTSLSLAIIAKDRNFSSTVIDLNKKPAATTPSS 96


>gi|52424784|ref|YP_087921.1| preprotein translocase subunit SecG [Mannheimia succiniciproducens
           MBEL55E]
 gi|52306836|gb|AAU37336.1| SecG protein [Mannheimia succiniciproducens MBEL55E]
          Length = 113

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 48/113 (42%), Gaps = 8/113 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           M   L++V+L+V + L+  IL+Q    +  G+S              +A+ L R TAILA
Sbjct: 1   MYQVLLIVYLLVSIALIGFILVQQGKGADAGASFGGGASGTVFGSAGSANFLSRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMH--RSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ +G I+ + +   +          + I+ +      +  +  +  
Sbjct: 61  TIFFVISLVIGNINSHKNNVQQGTFDDLSQAAEQIQQKTVPAPVENKNADIPQ 113


>gi|83310919|ref|YP_421183.1| preprotein translocase subunit SecG [Magnetospirillum magneticum
          AMB-1]
 gi|82945760|dbj|BAE50624.1| Preprotein translocase subunit SecG [Magnetospirillum magneticum
          AMB-1]
          Length = 112

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV----RSTAHSLGRFTAILAFFFFA 59
           ++V+HLI+ V LV VIL+Q S+  A G            R+  + L R TAI+A  FF 
Sbjct: 6  IILVIHLILAVALVGVILLQRSEGGALGIGGGSGGGLMTGRAAGNLLTRTTAIVAGSFFL 65

Query: 60 TSIALGMISRYTSTRYKD 77
          TS+ L +++   +     
Sbjct: 66 TSLVLALLANSRTGGGSP 83


>gi|167569421|ref|ZP_02362295.1| preprotein translocase subunit SecG [Burkholderia oklahomensis
          C6786]
          Length = 124

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           ++VV L+  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA  F
Sbjct: 7  LIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLATIF 66

Query: 58 FATSIALGMISRYTSTRYKDNM 79
          F  ++AL  +  Y S      +
Sbjct: 67 FVATLALTYLGSYKSAPSVGVL 88


>gi|167562176|ref|ZP_02355092.1| preprotein translocase subunit SecG [Burkholderia oklahomensis
          EO147]
          Length = 124

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           ++VV L+  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA  F
Sbjct: 7  LIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLATIF 66

Query: 58 FATSIALGMISRYTSTRYKDNM 79
          F  ++AL  +  Y S      +
Sbjct: 67 FVATLALTYLGSYKSAPSVGVL 88


>gi|149909283|ref|ZP_01897939.1| Biopolymer transport protein [Moritella sp. PE36]
 gi|149807600|gb|EDM67548.1| Biopolymer transport protein [Moritella sp. PE36]
          Length = 106

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 6/65 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
          M   ++V++LIV + ++  +L+Q    +    +FGS  + T      + + L R TAILA
Sbjct: 1  MYEVIIVIYLIVALAIIGFVLMQQGKGADMGASFGSGGSNTVFGAGGSGNFLTRVTAILA 60

Query: 55 FFFFA 59
            FFA
Sbjct: 61 VVFFA 65


>gi|261492437|ref|ZP_05988993.1| Sec family Type II general secretory pathway preprotein
          translocase SecG [Mannheimia haemolytica serotype A2
          str. BOVINE]
 gi|261311896|gb|EEY13043.1| Sec family Type II general secretory pathway preprotein
          translocase SecG [Mannheimia haemolytica serotype A2
          str. BOVINE]
          Length = 114

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 6/81 (7%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILAFF 56
            L +V+L+V V L+  +L+Q    +    +FG+ ++ T      +A+ L R TA+LA  
Sbjct: 4  NVLTIVYLVVAVLLIAFVLMQQGKGADAGASFGAGASATVFGSAGSANFLSRTTALLATI 63

Query: 57 FFATSIALGMISRYTSTRYKD 77
          FFA S+ +G +S +       
Sbjct: 64 FFAISLVIGNLSSHNVAPKSQ 84


>gi|254787188|ref|YP_003074617.1| preprotein translocase, SecG subunit [Teredinibacter turnerae
           T7901]
 gi|237685748|gb|ACR13012.1| preprotein translocase, SecG subunit [Teredinibacter turnerae
           T7901]
          Length = 148

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 60/121 (49%), Gaps = 7/121 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M+  L++VHL+  + ++ +IL+Q    +    +FG+ ++ T      + +   R TAI A
Sbjct: 1   MENILLLVHLLTALAIIGLILMQQGKGAEMGASFGAGASQTLFGSVGSGNFFSRLTAIAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKD-QGNDNFGDGSSPKLDSVSAKSSSS 113
             FF TS +L +++++ S    D++    ++ ++D     N  D   P L+   A   ++
Sbjct: 61  TIFFVTSFSLAVVAKHQSNVGDDDLALPELEQLEDASTATNNDDSDVPALEVEGANVDTA 120

Query: 114 V 114
            
Sbjct: 121 A 121


>gi|167836048|ref|ZP_02462931.1| preprotein translocase subunit SecG [Burkholderia thailandensis
          MSMB43]
          Length = 125

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV L+  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL  +  Y S      +
Sbjct: 64 TIFFIATLALTYLGSYKSAPSVGVL 88


>gi|290473444|ref|YP_003466311.1| preprotein translocase membrane protein transport across inner
           membrane [Xenorhabdus bovienii SS-2004]
 gi|289172744|emb|CBJ79515.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Xenorhabdus
           bovienii SS-2004]
          Length = 112

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 52/121 (42%), Gaps = 16/121 (13%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+ V L+  +G++ ++L+Q    +        G+S+       +++ + R TAI A
Sbjct: 1   MYEALLGVFLLAGLGVIALVLLQQGKGADMGASFGAGASATLFGSSGSSNFMTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ LG +S           +R+  DS  +   +        ++ +  AK +S +
Sbjct: 61  TLFFVISLILGNMSS----------NRTGSDSKWENLAEPVKVEKQAEVPASPAKPNSDI 110

Query: 115 V 115
            
Sbjct: 111 P 111


>gi|83719049|ref|YP_441613.1| preprotein translocase subunit SecG [Burkholderia thailandensis
          E264]
 gi|167580421|ref|ZP_02373295.1| preprotein translocase subunit SecG [Burkholderia thailandensis
          TXDOH]
 gi|167618530|ref|ZP_02387161.1| preprotein translocase subunit SecG [Burkholderia thailandensis
          Bt4]
 gi|257139691|ref|ZP_05587953.1| preprotein translocase subunit SecG [Burkholderia thailandensis
          E264]
 gi|83652874|gb|ABC36937.1| Preprotein translocase SecG subunit, putative [Burkholderia
          thailandensis E264]
          Length = 125

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV L+  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL  +  Y S      +
Sbjct: 64 TIFFVATLALTYLGSYKSAPSVGVL 88


>gi|283856264|ref|YP_162199.2| preprotein translocase subunit SecG [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|283775259|gb|AAV89088.2| preprotein translocase, SecG subunit [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 119

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 41/113 (36%), Gaps = 3/113 (2%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSAFGSS---SNFTSVRSTAHSLGRFTAILAFFFFA 59
             L+VV  +V   LV VIL+Q S+ S            S    A+ L R T  LA  F  
Sbjct: 4   TILIVVQALVAAALVTVILMQQSEGSGITGGLNPGGLMSASGAANFLTRATGALAVLFVV 63

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
            SIAL  ++   +T  + +   +     +              +      +++
Sbjct: 64  LSIALAALASVQNTAPQIDTSLAHKPVAQQTAPAQPAQPKPSSVPLADQPATT 116


>gi|53718846|ref|YP_107832.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          K96243]
 gi|53725826|ref|YP_103435.1| preprotein translocase subunit SecG [Burkholderia mallei ATCC
          23344]
 gi|67642193|ref|ZP_00440953.1| preprotein translocase, SecG subunit [Burkholderia mallei GB8
          horse 4]
 gi|76810602|ref|YP_332843.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          1710b]
 gi|121599984|ref|YP_992468.1| preprotein translocase subunit SecG [Burkholderia mallei SAVP1]
 gi|124384029|ref|YP_001026729.1| preprotein translocase subunit SecG [Burkholderia mallei NCTC
          10229]
 gi|126441687|ref|YP_001058337.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          668]
 gi|126448705|ref|YP_001079986.1| preprotein translocase subunit SecG [Burkholderia mallei NCTC
          10247]
 gi|126451944|ref|YP_001065576.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          1106a]
 gi|134283962|ref|ZP_01770658.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          305]
 gi|167000369|ref|ZP_02266187.1| preprotein translocase, SecG subunit [Burkholderia mallei PRL-20]
 gi|167823451|ref|ZP_02454922.1| preprotein translocase subunit SecG [Burkholderia pseudomallei 9]
 gi|167893544|ref|ZP_02480946.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          7894]
 gi|167910226|ref|ZP_02497317.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          112]
 gi|167918259|ref|ZP_02505350.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          BCC215]
 gi|217419953|ref|ZP_03451459.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          576]
 gi|226195388|ref|ZP_03790977.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          Pakistan 9]
 gi|237811581|ref|YP_002896032.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          MSHR346]
 gi|242314803|ref|ZP_04813819.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1106b]
 gi|254175392|ref|ZP_04882052.1| preprotein translocase, SecG subunit [Burkholderia mallei ATCC
          10399]
 gi|254181188|ref|ZP_04887785.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1655]
 gi|254190551|ref|ZP_04897058.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          Pasteur 52237]
 gi|254195092|ref|ZP_04901521.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          S13]
 gi|254202111|ref|ZP_04908474.1| preprotein translocase, SecG subunit [Burkholderia mallei FMH]
 gi|254207441|ref|ZP_04913791.1| preprotein translocase, SecG subunit [Burkholderia mallei JHU]
 gi|254260244|ref|ZP_04951298.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1710a]
 gi|254298532|ref|ZP_04965984.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          406e]
 gi|254359863|ref|ZP_04976133.1| preprotein translocase, SecG subunit [Burkholderia mallei
          2002721280]
 gi|52209260|emb|CAH35205.1| general secretory pathway, protein-export membrane protein
          [Burkholderia pseudomallei K96243]
 gi|52429249|gb|AAU49842.1| preprotein translocase, SecG subunit [Burkholderia mallei ATCC
          23344]
 gi|76580055|gb|ABA49530.1| Preprotein translocase SecG subunit, putative [Burkholderia
          pseudomallei 1710b]
 gi|121228794|gb|ABM51312.1| preprotein translocase, SecG subunit [Burkholderia mallei SAVP1]
 gi|124292049|gb|ABN01318.1| preprotein translocase, SecG subunit [Burkholderia mallei NCTC
          10229]
 gi|126221180|gb|ABN84686.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          668]
 gi|126225586|gb|ABN89126.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1106a]
 gi|126241575|gb|ABO04668.1| preprotein translocase, SecG subunit [Burkholderia mallei NCTC
          10247]
 gi|134244751|gb|EBA44849.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          305]
 gi|147746358|gb|EDK53435.1| preprotein translocase, SecG subunit [Burkholderia mallei FMH]
 gi|147751335|gb|EDK58402.1| preprotein translocase, SecG subunit [Burkholderia mallei JHU]
 gi|148029103|gb|EDK87008.1| preprotein translocase, SecG subunit [Burkholderia mallei
          2002721280]
 gi|157808196|gb|EDO85366.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          406e]
 gi|157938226|gb|EDO93896.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          Pasteur 52237]
 gi|160696436|gb|EDP86406.1| preprotein translocase, SecG subunit [Burkholderia mallei ATCC
          10399]
 gi|169651840|gb|EDS84533.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          S13]
 gi|184211726|gb|EDU08769.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1655]
 gi|217397257|gb|EEC37273.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          576]
 gi|225932590|gb|EEH28588.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          Pakistan 9]
 gi|237503238|gb|ACQ95556.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          MSHR346]
 gi|238523289|gb|EEP86728.1| preprotein translocase, SecG subunit [Burkholderia mallei GB8
          horse 4]
 gi|242138042|gb|EES24444.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1106b]
 gi|243063703|gb|EES45889.1| preprotein translocase, SecG subunit [Burkholderia mallei PRL-20]
 gi|254218933|gb|EET08317.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1710a]
          Length = 125

 Score = 60.9 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV L+  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL  +  Y S      +
Sbjct: 64 TIFFVATLALTYLGSYKSAPSVGVL 88


>gi|240948661|ref|ZP_04753033.1| preprotein translocase subunit SecG [Actinobacillus minor NM305]
 gi|240296877|gb|EER47455.1| preprotein translocase subunit SecG [Actinobacillus minor NM305]
          Length = 108

 Score = 60.9 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 46/107 (42%), Gaps = 6/107 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           M   L +V+L+V + L+  ILIQ    +  G+S              +A+ L R TA+LA
Sbjct: 1   MLNILTIVYLLVAIALIGFILIQQGKGADAGASFGAGAAGTVFGSAGSANFLSRTTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
             FFA S+ +G ++ + +         S V    +Q      +   P
Sbjct: 61  TVFFAISLVIGNLNSHQAKPTSQFDDLSGVQQKVEQPKTQTQNSDIP 107


>gi|241761008|ref|ZP_04759097.1| preprotein translocase, SecG subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241374627|gb|EER64088.1| preprotein translocase, SecG subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 119

 Score = 60.6 bits (145), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 41/113 (36%), Gaps = 3/113 (2%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSAFGSS---SNFTSVRSTAHSLGRFTAILAFFFFA 59
             L+VV  +V   LV VIL+Q S+ S            S    A+ L R T  LA  F  
Sbjct: 4   TILIVVQALVAAALVTVILMQQSEGSGITGGSNPGGLMSASGAANFLTRATGALAVLFVV 63

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
            SIAL  ++   +T  + +   +     +              +      +++
Sbjct: 64  LSIALAALASVQNTAPQIDTSLAHKPVAQQTAPAQPAQPKPSSVPLADQPATT 116


>gi|206560704|ref|YP_002231469.1| preprotein translocase subunit SecG [Burkholderia cenocepacia
          J2315]
 gi|198036746|emb|CAR52646.1| protein-export membrane protein SecG [Burkholderia cenocepacia
          J2315]
          Length = 125

 Score = 60.6 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +        G+S +      +A+ L R T ILA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y ST     +
Sbjct: 65 IFFVATLALTYLGSYKSTPSAGVL 88


>gi|107023189|ref|YP_621516.1| preprotein translocase subunit SecG [Burkholderia cenocepacia AU
          1054]
 gi|116690271|ref|YP_835894.1| preprotein translocase subunit SecG [Burkholderia cenocepacia
          HI2424]
 gi|105893378|gb|ABF76543.1| protein translocase subunit secG [Burkholderia cenocepacia AU
          1054]
 gi|116648360|gb|ABK09001.1| protein translocase subunit secG [Burkholderia cenocepacia
          HI2424]
          Length = 125

 Score = 60.6 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +        G+S +      +A+ L R T ILA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y ST     +
Sbjct: 65 IFFVATLALTYLGSYKSTPSAGVL 88


>gi|223041484|ref|ZP_03611687.1| preprotein translocase subunit SecG [Actinobacillus minor 202]
 gi|223017742|gb|EEF16149.1| preprotein translocase subunit SecG [Actinobacillus minor 202]
          Length = 108

 Score = 60.6 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 46/107 (42%), Gaps = 6/107 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           M   L +V+L+V + L+  ILIQ    +  G+S              +A+ L R TA+LA
Sbjct: 1   MLNILTIVYLLVAIALIGFILIQQGKGADAGASFGAGAAGTVFGSAGSANFLSRTTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
             FFA S+ +G ++ + +         S V    +Q      +   P
Sbjct: 61  TIFFAISLVIGNLNSHQAKPTSQFDDLSGVQQKVEQPKTQTQNSDIP 107


>gi|110833187|ref|YP_692046.1| protein-export membrane protein [Alcanivorax borkumensis SK2]
 gi|110646298|emb|CAL15774.1| Protein-export membrane protein [Alcanivorax borkumensis SK2]
          Length = 147

 Score = 60.6 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 48/121 (39%), Gaps = 20/121 (16%)

Query: 15  GLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMIS 68
           GL+ ++LIQ    +  G+S              +A+ L R TA+LA  FF TS+ L  ++
Sbjct: 15  GLIGLVLIQHGKGADAGASFGGGGSQTVFGSAGSANFLTRATAVLAALFFVTSLVLAWMA 74

Query: 69  RYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV----VAGKRSSSRT 124
           R  +   +  +        +D           P +D   ++  + +    VA   +  + 
Sbjct: 75  RQEADSSRSFLPELETVEHQD----------VPVVDESPSEVPAGMTEVPVAPDANEEQK 124

Query: 125 K 125
           +
Sbjct: 125 E 125


>gi|254464934|ref|ZP_05078345.1| preprotein translocase, SecG subunit [Rhodobacterales bacterium
           Y4I]
 gi|206685842|gb|EDZ46324.1| preprotein translocase, SecG subunit [Rhodobacterales bacterium
           Y4I]
          Length = 121

 Score = 60.6 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 51/121 (42%), Gaps = 8/121 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA---HSLGRFTAILAFFF 57
           M+  ++++HL++ +GL+ V+L+Q S+    G         S      +LG+ T +LA  F
Sbjct: 1   MENVVLIIHLLLALGLIAVVLLQRSEGGGLGMGGGGGGAISGRAAATALGKVTWLLAIAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND----NFGDGSSPKLDSVSAKSSSS 113
             TSI L +++   S        R  V   +D G        G    P  +  +A    S
Sbjct: 61  ICTSITLTIMAAQKSAG-SSVTDRLAVPQSEDGGAPAVPAPLGSDLLPPSEGDNAPLVPS 119

Query: 114 V 114
            
Sbjct: 120 A 120


>gi|78067047|ref|YP_369816.1| preprotein translocase subunit SecG [Burkholderia sp. 383]
 gi|77967792|gb|ABB09172.1| protein translocase subunit secG [Burkholderia sp. 383]
          Length = 125

 Score = 60.6 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +        G+S +      +A+ L R T ILA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y ST     +
Sbjct: 65 IFFVATLALTYLGSYKSTPSAGVL 88


>gi|113461454|ref|YP_719523.1| preprotein translocase subunit SecG [Haemophilus somnus 129PT]
 gi|170718439|ref|YP_001783657.1| preprotein translocase subunit SecG [Haemophilus somnus 2336]
 gi|112823497|gb|ABI25586.1| protein translocase subunit secG [Haemophilus somnus 129PT]
 gi|168826568|gb|ACA31939.1| preprotein translocase, SecG subunit [Haemophilus somnus 2336]
          Length = 114

 Score = 60.6 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 47/115 (40%), Gaps = 8/115 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           M   L++ +L++ + L+  ILIQ    +  G+S                + L R TAILA
Sbjct: 1   MYQVLLIAYLVIAIVLIGFILIQQGKGANAGASFGGGASGTVFGSAGAGNFLSRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FFA S+ +G I+ +++           +  + +Q  +      +P   +    
Sbjct: 61  TAFFAISLLIGNINSHSNNVKSGKFDD--LSKVAEQVQEKQQSIPTPDTKNSDIP 113


>gi|270158115|ref|ZP_06186772.1| preprotein translocase SecG subunit [Legionella longbeachae
          D-4968]
 gi|289163620|ref|YP_003453758.1| Protein-export membrane protein secG (Preprotein translocase
          subunit) [Legionella longbeachae NSW150]
 gi|269990140|gb|EEZ96394.1| preprotein translocase SecG subunit [Legionella longbeachae
          D-4968]
 gi|288856793|emb|CBJ10604.1| Protein-export membrane protein secG (Preprotein translocase
          subunit) [Legionella longbeachae NSW150]
          Length = 109

 Score = 60.6 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFT--SVRSTAHSLGRFTAILA 54
          M   ++++H+IV V L+ ++LIQ        +AFGS ++ T    + T   L + T  LA
Sbjct: 1  MYQLILMIHVIVAVVLIGLVLIQHGKGADVGAAFGSGASNTLFGSQGTGGFLFKLTGGLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF TS+ L  +      + +  +
Sbjct: 61 LTFFVTSLLLSYLVSIQYQKTEQQV 85


>gi|301155604|emb|CBW15072.1| preprotein translocase membrane subunit [Haemophilus
          parainfluenzae T3T1]
          Length = 115

 Score = 60.6 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   L+ V++++ + L+  ILIQ    +  G+S                + L R +AILA
Sbjct: 1  MYNILLFVYVLICIALIGFILIQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  ++ LG I+ +   
Sbjct: 61 TGFFVIALVLGNINSHRGN 79


>gi|291278563|ref|YP_003495398.1| preprotein translocase subunit G [Deferribacter desulfuricans
          SSM1]
 gi|290753265|dbj|BAI79642.1| preprotein translocase subunit G [Deferribacter desulfuricans
          SSM1]
          Length = 105

 Score = 60.6 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 52/98 (53%), Gaps = 7/98 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRST-AHSLGRFTAILAF 55
          M   ++ +H+ V + L+  +L+QS       SAFG  S+ +   +T A+ + + T IL  
Sbjct: 1  MYSIIIAIHVFVSILLILAVLLQSGKESDLGSAFGGGSSDSFGPATPANIMNKITTILVI 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
           FF TSI L ++S+  +   +  ++   V++  +Q N+
Sbjct: 61 VFFFTSITLTIMSKNRT--GESILNNIPVNAPVEQKNN 96


>gi|304391670|ref|ZP_07373612.1| preprotein translocase subunit SecG [Ahrensia sp. R2A130]
 gi|303295899|gb|EFL90257.1| preprotein translocase subunit SecG [Ahrensia sp. R2A130]
          Length = 132

 Score = 60.6 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 31/128 (24%), Positives = 58/128 (45%), Gaps = 7/128 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VVH+++V+ L+ ++L+Q S+          G    F S R  A +L + T I+A
Sbjct: 1   MTTVLIVVHIMLVLALIVLVLLQKSEGGALGIGGGGGGGGGFISARGAADALTKTTTIVA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FFATS+ALG+++     R +D + +          +       +   D+    +    
Sbjct: 61  AGFFATSVALGVVANRD-NRTEDILRQVETAPTGVPTDSGTATPPANVPDAGGLLNDLEN 119

Query: 115 VAGKRSSS 122
           +   + S+
Sbjct: 120 LGTPQPST 127


>gi|114321120|ref|YP_742803.1| preprotein translocase subunit SecG [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114227514|gb|ABI57313.1| protein translocase subunit secG [Alkalilimnicola ehrlichii MLHE-1]
          Length = 118

 Score = 60.6 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 9/116 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSV--RSTAHSLGRFTAILA 54
           M   L+ +H+I+ V LV ++L+Q    +    AFGS ++ T    R     L R T  LA
Sbjct: 1   MFQILLAIHVIIAVVLVVLVLLQQGKGADMGAAFGSGASSTVFGSRGAGSFLTRVTTGLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHR-SLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FFATS+ L +++   +      + R   V+       D+  +  +P++D     
Sbjct: 61  ITFFATSLVLAILAARGTDAPGSLLEREQEVEETVPPAADD--EPEAPEVDDELPP 114


>gi|217970155|ref|YP_002355389.1| preprotein translocase subunit SecG [Thauera sp. MZ1T]
 gi|217507482|gb|ACK54493.1| preprotein translocase, SecG subunit [Thauera sp. MZ1T]
          Length = 116

 Score = 60.2 bits (144), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 6/84 (7%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
            ++ VH++V +G++ ++L+Q    +        G+S +      +A+ L R TA+LA  
Sbjct: 7  SLVLTVHVLVGLGVIGLVLVQHGKGADMGAAFGSGASGSLFGASGSANFLSRTTAVLATV 66

Query: 57 FFATSIALGMISRYTSTRYKDNMH 80
          FF TS+ L  ++          M 
Sbjct: 67 FFLTSLGLSFLASNKPAAPGSVME 90


>gi|253996974|ref|YP_003049038.1| preprotein translocase subunit SecG [Methylotenera mobilis JLW8]
 gi|253983653|gb|ACT48511.1| preprotein translocase, SecG subunit [Methylotenera mobilis JLW8]
          Length = 113

 Score = 60.2 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 42/82 (51%), Gaps = 6/82 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M+  ++V+H++   G++ ++L+Q    +        G+S +   V  +++ + R TA   
Sbjct: 1  MENIVLVIHVLAACGVIGLVLLQHGKGADMGASFGSGASGSLFGVSGSSNFMSRATAGFV 60

Query: 55 FFFFATSIALGMISRYTSTRYK 76
          F FF TS+ L  +S + ++   
Sbjct: 61 FVFFITSLTLAYLSSHKASSGS 82


>gi|167646728|ref|YP_001684391.1| preprotein translocase subunit SecG [Caulobacter sp. K31]
 gi|167349158|gb|ABZ71893.1| preprotein translocase, SecG subunit [Caulobacter sp. K31]
          Length = 169

 Score = 60.2 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 3/76 (3%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFFFAT 60
           L+ +++IV   L+ V+L+Q S+  A G       F + R     L R T IL   F   
Sbjct: 5  VLLTINIIVCFALIGVVLMQRSEGGALGMGGGGGGFMTARGAGDLLTRTTWILFSIFLII 64

Query: 61 SIALGMISRYTSTRYK 76
          S+AL +++   +    
Sbjct: 65 SLALTILTGRMANSNS 80


>gi|325579173|ref|ZP_08149129.1| preprotein translocase subunit SecG [Haemophilus parainfluenzae
          ATCC 33392]
 gi|325159408|gb|EGC71542.1| preprotein translocase subunit SecG [Haemophilus parainfluenzae
          ATCC 33392]
          Length = 115

 Score = 60.2 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYNILLFIYVLVCIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  ++ LG I+ +   
Sbjct: 61 TGFFVIALVLGNINSHRGN 79


>gi|171316302|ref|ZP_02905523.1| preprotein translocase, SecG subunit [Burkholderia ambifaria
          MEX-5]
 gi|171098528|gb|EDT43329.1| preprotein translocase, SecG subunit [Burkholderia ambifaria
          MEX-5]
          Length = 125

 Score = 60.2 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +        G+S +      +A+ L R T +LA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGVLAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y ST     +
Sbjct: 65 IFFVATLALTYLGSYKSTPSAGVL 88


>gi|161524203|ref|YP_001579215.1| preprotein translocase subunit SecG [Burkholderia multivorans
          ATCC 17616]
 gi|189351040|ref|YP_001946668.1| preprotein translocase subunit SecG [Burkholderia multivorans
          ATCC 17616]
 gi|221199655|ref|ZP_03572699.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD2M]
 gi|221205445|ref|ZP_03578460.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD2]
 gi|221211734|ref|ZP_03584713.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD1]
 gi|160341632|gb|ABX14718.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          ATCC 17616]
 gi|189335062|dbj|BAG44132.1| preprotein translocase SecG subunit [Burkholderia multivorans
          ATCC 17616]
 gi|221169095|gb|EEE01563.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD1]
 gi|221174283|gb|EEE06715.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD2]
 gi|221180940|gb|EEE13343.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD2M]
          Length = 125

 Score = 60.2 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  I  Y ST     +
Sbjct: 65 VFFVATLALTYIGSYKSTPSAGVL 88


>gi|170733610|ref|YP_001765557.1| preprotein translocase subunit SecG [Burkholderia cenocepacia
          MC0-3]
 gi|169816852|gb|ACA91435.1| preprotein translocase, SecG subunit [Burkholderia cenocepacia
          MC0-3]
          Length = 120

 Score = 60.2 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +        G+S +      +A+ L R T ILA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y ST     +
Sbjct: 65 IFFVATLALTYLGSYKSTPSAGVL 88


>gi|115352339|ref|YP_774178.1| preprotein translocase subunit SecG [Burkholderia ambifaria AMMD]
 gi|170698108|ref|ZP_02889188.1| preprotein translocase, SecG subunit [Burkholderia ambifaria
          IOP40-10]
 gi|172061210|ref|YP_001808862.1| preprotein translocase subunit SecG [Burkholderia ambifaria
          MC40-6]
 gi|115282327|gb|ABI87844.1| protein translocase subunit secG [Burkholderia ambifaria AMMD]
 gi|170136966|gb|EDT05214.1| preprotein translocase, SecG subunit [Burkholderia ambifaria
          IOP40-10]
 gi|171993727|gb|ACB64646.1| preprotein translocase, SecG subunit [Burkholderia ambifaria
          MC40-6]
          Length = 125

 Score = 60.2 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +        G+S +      +A+ L R T +LA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGVLAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y ST     +
Sbjct: 65 IFFVATLALTYLGSYKSTPSAGVL 88


>gi|145589235|ref|YP_001155832.1| preprotein translocase, SecG subunit [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047641|gb|ABP34268.1| protein translocase subunit secG [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 114

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/110 (17%), Positives = 40/110 (36%), Gaps = 6/110 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           ++  L+V+ +I  + ++ ++L+Q    +        G+S +      +A+ L   TAI A
Sbjct: 4   IKTLLIVLQVISALSVILLVLLQQGKGADMGAAFGSGASGSLFGASGSANFLSHATAIFA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  +I +  +                  +          D S P + 
Sbjct: 64  AVFFMCTIGITWVGNKKEVNPGVLSGTVAPAATPAAPVAPAQDPSKPAVP 113


>gi|309972398|gb|ADO95599.1| Protein-export membrane protein SecG [Haemophilus influenzae
          R2846]
          Length = 113

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  ++ LG ++ +   
Sbjct: 61 TVFFVIALVLGNMNSHKGN 79


>gi|152979365|ref|YP_001344994.1| preprotein translocase subunit SecG [Actinobacillus succinogenes
          130Z]
 gi|150841088|gb|ABR75059.1| preprotein translocase, SecG subunit [Actinobacillus succinogenes
          130Z]
          Length = 117

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+ V+LI+ + ++ +ILIQ    +        G+S        +A+ L R T++LA
Sbjct: 1  MYSVLLFVYLIISIVMIGLILIQQGKGADTGASFGGGASGTVFGSAGSANFLSRSTSLLA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  SI +G I+ + + 
Sbjct: 61 VAFFVISIVIGNINAHRNN 79


>gi|94497169|ref|ZP_01303741.1| preprotein translocase, SecG subunit [Sphingomonas sp. SKA58]
 gi|94423274|gb|EAT08303.1| preprotein translocase, SecG subunit [Sphingomonas sp. SKA58]
          Length = 122

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 41/101 (40%), Gaps = 6/101 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG---SSSNFTSVRSTAHSLGRFTAILAFFF 57
           M  FL+VV  I+   LV VIL+Q S+    G   S + F S R  A  L R T ILA  F
Sbjct: 1   MFTFLLVVQAIIAALLVTVILMQKSEGGGLGVGGSPAGFMSARGAADFLTRSTTILASVF 60

Query: 58  FATSIALGMISRYTSTRY---KDNMHRSLVDSIKDQGNDNF 95
              SI + +I+             + ++          D  
Sbjct: 61  VLLSIVMAVIASVRHAPSDIDTSLVKQAPATQSAPATTDPL 101


>gi|50083626|ref|YP_045136.1| preprotein translocase subunit SecG [Acinetobacter sp. ADP1]
 gi|49529602|emb|CAG67314.1| preprotein translocase IISP family, auxillary membrane component
           [Acinetobacter sp. ADP1]
          Length = 109

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 51/111 (45%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           M  F++VVH+I+ V ++ ++LIQ    +  G+S              + + L R TA+L 
Sbjct: 1   MHTFVLVVHIILAVLIIGLVLIQHGKGADAGASFGGGGAATVFGASGSGNFLTRVTAVLT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS++L + ++  +T       +S+  +     +      ++PK   
Sbjct: 61  ALFFVTSLSLAVFAKKQTTDAYSL--KSVQTTNSAPASTPETSPNAPKSSQ 109


>gi|299136769|ref|ZP_07029952.1| preprotein translocase, SecG subunit [Acidobacterium sp. MP5ACTX8]
 gi|298601284|gb|EFI57439.1| preprotein translocase, SecG subunit [Acidobacterium sp. MP5ACTX8]
          Length = 124

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 6/82 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDS----SAFGSSSNFTSV--RSTAHSLGRFTAILA 54
           M I L+++H++V + L+ V+L+Q   S     AFG   + T+   R  A+ L R T   A
Sbjct: 28  MIILLVILHVVVCLFLIGVVLVQQGKSADLAGAFGGQGSQTAFGPRGAANLLTRLTTWSA 87

Query: 55  FFFFATSIALGMISRYTSTRYK 76
             F  TSI L ++    +  + 
Sbjct: 88  IIFMLTSIGLTVMMSRNAGGHS 109


>gi|217976696|ref|YP_002360843.1| preprotein translocase, SecG subunit [Methylocella silvestris BL2]
 gi|217502072|gb|ACK49481.1| preprotein translocase, SecG subunit [Methylocella silvestris BL2]
          Length = 123

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 53/125 (42%), Gaps = 4/125 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS--TAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++VV LV  +L+Q S+  A G       +     A+ L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVVALVVTVLLQRSEGGALGVGGGGGFMTGRGQANVLTRATAILAALFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ L  +++YT        H        +        G    LD +         A  
Sbjct: 61  ATSLGLTALAKYTQAPSSILQHVPAAAPEPNAPAAPSTGG--GLLDQLKQLEDQRQSAPP 118

Query: 119 RSSSR 123
            S  R
Sbjct: 119 ASPPR 123


>gi|113867069|ref|YP_725558.1| preprotein translocase subunit SecG [Ralstonia eutropha H16]
 gi|113525845|emb|CAJ92190.1| preprotein translocase subunit SecG [Ralstonia eutropha H16]
          Length = 124

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 40/76 (52%), Gaps = 6/76 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  L+V+ ++  +G++ ++LIQ    +        G+S +      +A+ L R TA+LA 
Sbjct: 5  KTLLVVLQVLSALGVIGLVLIQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAVLAT 64

Query: 56 FFFATSIALGMISRYT 71
           FF  ++AL ++  Y 
Sbjct: 65 LFFVCTLALTLLGNYK 80


>gi|238757573|ref|ZP_04618758.1| Protein-export membrane protein secG [Yersinia aldovae ATCC 35236]
 gi|238704335|gb|EEP96867.1| Protein-export membrane protein secG [Yersinia aldovae ATCC 35236]
          Length = 105

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/114 (18%), Positives = 46/114 (40%), Gaps = 15/114 (13%)

Query: 7   VVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           ++ L++ +GLV +I++Q    +        G+S+       + + + R TA+LA  FF  
Sbjct: 1   MIFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLATLFFVI 60

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
           S+ LG +S     +  +          ++ G     + ++  +      S    
Sbjct: 61  SLILGNMSTNQGHKGSE---------WENLGQPAQSEQTTAPVAPAKPSSDIPQ 105


>gi|254247656|ref|ZP_04940977.1| Preprotein translocase subunit SecG [Burkholderia cenocepacia
          PC184]
 gi|124872432|gb|EAY64148.1| Preprotein translocase subunit SecG [Burkholderia cenocepacia
          PC184]
          Length = 128

 Score = 60.2 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +        G+S +      +A+ L R T ILA 
Sbjct: 8  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAT 67

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y ST     +
Sbjct: 68 IFFVATLALTYLGSYKSTPSAGVL 91


>gi|83754004|pdb|2AKH|X Chain X, Normal Mode-Based Flexible Fitted Coordinates Of A Non-
          Translocating Secyeg Protein-Conducting Channel Into
          The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome
          Complex From E. Coli
 gi|83754007|pdb|2AKH|A Chain A, Normal Mode-Based Flexible Fitted Coordinates Of A Non-
          Translocating Secyeg Protein-Conducting Channel Into
          The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome
          Complex From E. Coli
 gi|83754010|pdb|2AKI|X Chain X, Normal Mode-Based Flexible Fitted Coordinates Of A
          Translocating Secyeg Protein-Conducting Channel Into
          The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome
          Complex From E. Coli
 gi|83754013|pdb|2AKI|A Chain A, Normal Mode-Based Flexible Fitted Coordinates Of A
          Translocating Secyeg Protein-Conducting Channel Into
          The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome
          Complex From E. Coli
          Length = 77

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+VV LIV +GLV +I++Q    +        G+S+       + + + R TA+LA
Sbjct: 1  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55 FFFFATSIALGMISRYT 71
            FF  S+ LG I+   
Sbjct: 61 TLFFIISLVLGNINSNK 77


>gi|94309871|ref|YP_583081.1| preprotein translocase subunit SecG [Cupriavidus metallidurans
          CH34]
 gi|93353723|gb|ABF07812.1| preprotein translocase membrane subunit [Cupriavidus
          metallidurans CH34]
          Length = 122

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 40/80 (50%), Gaps = 6/80 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  L++V ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA 
Sbjct: 5  KTLLVIVQVLSALGVIGLVLLQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAVLAA 64

Query: 56 FFFATSIALGMISRYTSTRY 75
           FF  ++ L ++  Y  +  
Sbjct: 65 LFFCCTLGLTLLGNYKPSAS 84


>gi|194289158|ref|YP_002005065.1| preprotein translocase subunit SecG [Cupriavidus taiwanensis LMG
          19424]
 gi|193222993|emb|CAQ68998.1| preprotein translocase membrane subunit [Cupriavidus taiwanensis
          LMG 19424]
          Length = 124

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 40/76 (52%), Gaps = 6/76 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  L+V+ ++  +G++ ++LIQ    +        G+S +      +A+ L R TA+LA 
Sbjct: 5  KTLLVVLQVLSALGVIGLVLIQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAVLAT 64

Query: 56 FFFATSIALGMISRYT 71
           FF  ++AL ++  Y 
Sbjct: 65 LFFVCTLALTLLGNYK 80


>gi|304310504|ref|YP_003810102.1| Protein-export membrane protein [gamma proteobacterium HdN1]
 gi|301796237|emb|CBL44445.1| Protein-export membrane protein [gamma proteobacterium HdN1]
          Length = 169

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 42/95 (44%), Gaps = 6/95 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
          ++  ++++ ++V + +  +ILIQ    +    +FGS ++ T      + + L   TA+LA
Sbjct: 2  LETAVLILLIVVALIINGLILIQQGKGADMGASFGSGASNTVFGSAGSGNFLTHSTAVLA 61

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKD 89
            FF   +ALG  +   S         +     K 
Sbjct: 62 AVFFVCCLALGWFAHNHSASRGSVDFSAPATESKP 96


>gi|167737851|ref|ZP_02410625.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          14]
          Length = 100

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV L+  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL  +  Y S      +
Sbjct: 64 TIFFVATLALTYLGSYKSAPSVGVL 88


>gi|209885422|ref|YP_002289279.1| preprotein translocase SecG subunit [Oligotropha carboxidovorans
           OM5]
 gi|209873618|gb|ACI93414.1| preprotein translocase SecG subunit [Oligotropha carboxidovorans
           OM5]
          Length = 122

 Score = 59.8 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/103 (29%), Positives = 45/103 (43%), Gaps = 6/103 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
           M   ++++HLI+V+ L  V+L+Q S+    G       +  F S R T + L R TAIL 
Sbjct: 1   MHTVIIIIHLIIVIALTGVVLVQRSEGGGLGIGGGGGGAGGFMSSRGTTNLLTRTTAILG 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGD 97
             FF TS+ L  ++ Y               S +     N  D
Sbjct: 61  TAFFITSLILSWLAGYEQAPRSLINTTPATQSGQAAPEKNLLD 103


>gi|307293344|ref|ZP_07573190.1| preprotein translocase, SecG subunit [Sphingobium chlorophenolicum
           L-1]
 gi|306881410|gb|EFN12626.1| preprotein translocase, SecG subunit [Sphingobium chlorophenolicum
           L-1]
          Length = 122

 Score = 59.4 bits (142), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/104 (29%), Positives = 41/104 (39%), Gaps = 3/104 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG---SSSNFTSVRSTAHSLGRFTAILAFFF 57
           M  F++VV  IV   LV VIL+Q S+    G   S + F S R  A  L R T ILA  F
Sbjct: 1   MFTFILVVQAIVAALLVTVILMQKSEGGGLGVGGSPAGFMSARGAADFLTRSTTILAGIF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
              S+ L +I+         +                   G+ P
Sbjct: 61  VTLSVVLAVIASVQHRPSDIDTSLVKQAPQSPASAPAPATGNDP 104


>gi|85712950|ref|ZP_01043990.1| Biopolymer transport protein [Idiomarina baltica OS145]
 gi|85693256|gb|EAQ31214.1| Biopolymer transport protein [Idiomarina baltica OS145]
          Length = 86

 Score = 59.4 bits (142), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 45/85 (52%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
          M   LMV+ LIV + L+  I+IQ    +    +FGS ++ T      + + L R TAILA
Sbjct: 1  MFEVLMVMFLIVAIVLIGFIMIQQGKGADMGASFGSGASNTVFGSSGSGNFLSRTTAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++ LG +S   S   +D++
Sbjct: 61 VIFFVLALVLGNLSTSVSDSSEDSL 85


>gi|82702219|ref|YP_411785.1| preprotein translocase subunit SecG [Nitrosospira multiformis
          ATCC 25196]
 gi|82410284|gb|ABB74393.1| protein translocase subunit secG [Nitrosospira multiformis ATCC
          25196]
          Length = 117

 Score = 59.4 bits (142), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 43/94 (45%), Gaps = 6/94 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          M+  + ++H++   G++ ++L+Q    +        GSS +      +A+ L R T +LA
Sbjct: 1  METLIWILHVLSAAGVIVLVLLQHGKGADMGAAFGSGSSGSLFGASGSANFLSRTTGVLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
            FF TS+ L  +S   S           + S+K
Sbjct: 61 AVFFMTSLGLTYLSTNRSESGGVMDKAVPIQSVK 94


>gi|148827641|ref|YP_001292394.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittGG]
 gi|148718883|gb|ABR00011.1| protein-export membrane protein [Haemophilus influenzae PittGG]
          Length = 113

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  ++ LG ++ +   
Sbjct: 61 TAFFVIALVLGNMNSHKGN 79


>gi|145634558|ref|ZP_01790267.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittAA]
 gi|229844395|ref|ZP_04464535.1| preprotein translocase subunit SecG [Haemophilus influenzae
          6P18H1]
 gi|145268103|gb|EDK08098.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittAA]
 gi|229812644|gb|EEP48333.1| preprotein translocase subunit SecG [Haemophilus influenzae
          6P18H1]
          Length = 113

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  ++ LG ++ +   
Sbjct: 61 TAFFVIALVLGNMNSHKGN 79


>gi|145632690|ref|ZP_01788424.1| protein-export membrane protein [Haemophilus influenzae 3655]
 gi|144986885|gb|EDJ93437.1| protein-export membrane protein [Haemophilus influenzae 3655]
          Length = 113

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGADAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  ++ LG ++ +   
Sbjct: 61 TAFFVIALVLGNMNSHKGN 79


>gi|16272393|ref|NP_438606.1| preprotein translocase subunit SecG [Haemophilus influenzae Rd
          KW20]
 gi|260580492|ref|ZP_05848320.1| preprotein translocase SecG subunit [Haemophilus influenzae RdAW]
 gi|1173417|sp|P44713|SECG_HAEIN RecName: Full=Protein-export membrane protein secG
 gi|1573421|gb|AAC22104.1| protein-export membrane protein (secG) [Haemophilus influenzae Rd
          KW20]
 gi|260092834|gb|EEW76769.1| preprotein translocase SecG subunit [Haemophilus influenzae RdAW]
          Length = 112

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  ++ LG ++ +   
Sbjct: 61 TAFFVIALVLGNMNSHKGN 79


>gi|68249045|ref|YP_248157.1| preprotein translocase subunit SecG [Haemophilus influenzae
          86-028NP]
 gi|145628816|ref|ZP_01784616.1| protein-export membrane protein [Haemophilus influenzae 22.1-21]
 gi|68057244|gb|AAX87497.1| protein-export membrane protein SecG [Haemophilus influenzae
          86-028NP]
 gi|144979286|gb|EDJ88972.1| protein-export membrane protein [Haemophilus influenzae 22.1-21]
 gi|301169145|emb|CBW28742.1| preprotein translocase membrane subunit [Haemophilus influenzae
          10810]
 gi|309750139|gb|ADO80123.1| Protein-export membrane protein SecG [Haemophilus influenzae
          R2866]
          Length = 113

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  ++ LG ++ +   
Sbjct: 61 TAFFVIALVLGNMNSHKGN 79


>gi|84502702|ref|ZP_01000821.1| Preprotein translocase SecG subunit [Oceanicola batsensis HTCC2597]
 gi|84389097|gb|EAQ01895.1| Preprotein translocase SecG subunit [Oceanicola batsensis HTCC2597]
          Length = 122

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 57/125 (45%), Gaps = 8/125 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           M+  ++++HL + + L+ V+L+Q S+       G      S R+ A +LG+ T ILA  F
Sbjct: 1   MENVVLIIHLFLALALIGVVLLQKSEGGGLGMGGGGGGAMSGRAAATALGKVTWILAAAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
             TSIAL +I+   ST     + R        Q  +     + P   S+   + S+   G
Sbjct: 61  IGTSIALTIIAADKSTG-ASVLDRLAPTGAVPQEMEEV--PALPDGGSLLPPAPST--GG 115

Query: 118 KRSSS 122
             + S
Sbjct: 116 DLTPS 120


>gi|260582289|ref|ZP_05850082.1| preprotein translocase SecG subunit [Haemophilus influenzae
          NT127]
 gi|319775628|ref|YP_004138116.1| protein-export membrane protein SecG [Haemophilus influenzae
          F3047]
 gi|329122323|ref|ZP_08250911.1| preprotein translocase subunit SecG [Haemophilus aegyptius ATCC
          11116]
 gi|260094657|gb|EEW78552.1| preprotein translocase SecG subunit [Haemophilus influenzae
          NT127]
 gi|317450219|emb|CBY86435.1| protein-export membrane protein SecG [Haemophilus influenzae
          F3047]
 gi|327473884|gb|EGF19301.1| preprotein translocase subunit SecG [Haemophilus aegyptius ATCC
          11116]
          Length = 113

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  ++ LG ++ +   
Sbjct: 61 TAFFVIALVLGNMNSHKGN 79


>gi|145636286|ref|ZP_01791955.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittHH]
 gi|145270451|gb|EDK10385.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittHH]
          Length = 113

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  ++ LG ++ +   
Sbjct: 61 TAFFVIALVLGNMNSHKGN 79


>gi|114771698|ref|ZP_01449102.1| adenylosuccinate synthetase [alpha proteobacterium HTCC2255]
 gi|114547770|gb|EAU50660.1| adenylosuccinate synthetase [alpha proteobacterium HTCC2255]
          Length = 120

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 52/119 (43%), Gaps = 9/119 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           MQ  ++V+HLI+ V L+ ++L+Q S+       G  +N    R  A  L + T I+A  F
Sbjct: 1   MQNVVLVIHLILSVSLIGIVLLQRSEGGGLGIGGGGNNSGGGRPKAAPLAKVTWIIAIAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKD------QGNDNFGDGSSPKLDSVSAKS 110
             TSI L +I+   S         S +++  D          N    S+    ++  K+
Sbjct: 61  LITSITLTIIAAKNSGGSSVTDGFSTIETDTDTLELPKSLEGNLLPPSAADEPALPPKA 119


>gi|145640413|ref|ZP_01795997.1| protein-export membrane protein [Haemophilus influenzae R3021]
 gi|319898034|ref|YP_004136231.1| protein-export membrane protein secg [Haemophilus influenzae
          F3031]
 gi|145274999|gb|EDK14861.1| protein-export membrane protein [Haemophilus influenzae 22.4-21]
 gi|317433540|emb|CBY81924.1| protein-export membrane protein SecG [Haemophilus influenzae
          F3031]
          Length = 113

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  ++ LG ++ +   
Sbjct: 61 TAFFVIALVLGNMNSHKGN 79


>gi|255319715|ref|ZP_05360923.1| preprotein translocase iisp family, auxillary membrane component
           [Acinetobacter radioresistens SK82]
 gi|262380003|ref|ZP_06073158.1| preprotein translocase, SecG subunit [Acinetobacter radioresistens
           SH164]
 gi|255303244|gb|EET82453.1| preprotein translocase iisp family, auxillary membrane component
           [Acinetobacter radioresistens SK82]
 gi|262298197|gb|EEY86111.1| preprotein translocase, SecG subunit [Acinetobacter radioresistens
           SH164]
          Length = 109

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/109 (24%), Positives = 51/109 (46%), Gaps = 8/109 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           M  F++V+H+I+ V ++ +IL+Q    +  G+S              + + + R TAIL 
Sbjct: 1   MHTFVLVIHIILAVLMIGLILVQHGKGADAGASFGGGGAATVFGASGSGNFMTRLTAILT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKL 103
             FF TS+ L + ++  +T       +S+  S+  Q        ++PK 
Sbjct: 61  ALFFVTSLTLAVFAKKQTTAAYSL--QSVQTSVPAQPVSPETSPTAPKT 107


>gi|163733287|ref|ZP_02140730.1| preprotein translocase, SecG subunit, putative [Roseobacter
           litoralis Och 149]
 gi|161393075|gb|EDQ17401.1| preprotein translocase, SecG subunit, putative [Roseobacter
           litoralis Och 149]
          Length = 121

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 51/116 (43%), Gaps = 7/116 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           M+  ++++HLI+ +GL+ V+L+Q S+       G      + R+ A +LG+ T  LA  F
Sbjct: 1   MENVVLIIHLILALGLIAVVLLQRSEGGGLGMGGGGGGAMTGRAAATALGKVTWALAIAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             TS+ L + +   +      + R     +     D       P+ D +   S+  
Sbjct: 61  ICTSMTLTIFAA-ENASGSSVIDRL---GVTPPAADRSDTPGVPESDLLLPPSADE 112


>gi|149202639|ref|ZP_01879611.1| preprotein translocase, SecG subunit [Roseovarius sp. TM1035]
 gi|149143921|gb|EDM31955.1| preprotein translocase, SecG subunit [Roseovarius sp. TM1035]
          Length = 120

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 47/119 (39%), Gaps = 5/119 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA---HSLGRFTAILAFFF 57
           M+  ++ VHL++ + L+ V+L+Q S+    G         +      +LG+ T ILA  F
Sbjct: 1   MENVVLTVHLLLALALIGVVLLQRSEGGGLGMGGGGGGAMTGRAAATALGKMTWILAAAF 60

Query: 58  FATSIALGMISRYTSTRYK--DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             TSI L +I+   +      D +      +          D   P     +A  + + 
Sbjct: 61  IVTSITLTIIAAQNAAGVSVLDRLTDQPPAAETTTPALPDVDALMPPPAGDTAPLTPTA 119


>gi|270619599|ref|ZP_06221819.1| Protein-export membrane protein secG [Haemophilus influenzae
          HK1212]
 gi|270720306|ref|ZP_06223380.1| Protein-export membrane protein secG [Haemophilus influenzae
          HK1212]
 gi|270315322|gb|EFA27624.1| Protein-export membrane protein secG [Haemophilus influenzae
          HK1212]
 gi|270317831|gb|EFA29186.1| Protein-export membrane protein secG [Haemophilus influenzae
          HK1212]
          Length = 113

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  ++ LG ++ +   
Sbjct: 61 TAFFVIALVLGNMNSHKGN 79


>gi|229846531|ref|ZP_04466639.1| preprotein translocase subunit SecG [Haemophilus influenzae
          7P49H1]
 gi|229810624|gb|EEP46342.1| preprotein translocase subunit SecG [Haemophilus influenzae
          7P49H1]
          Length = 112

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  ++ LG ++ +   
Sbjct: 61 TAFFVIALVLGNMNSHKGN 79


>gi|299771785|ref|YP_003733811.1| preprotein translocase subunit SecG [Acinetobacter sp. DR1]
 gi|298701873|gb|ADI92438.1| preprotein translocase subunit SecG [Acinetobacter sp. DR1]
          Length = 109

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           M  F+++VH+I+ V ++ +IL+Q    +  G+S              +A+ L R TAIL 
Sbjct: 1   MHSFVLIVHIILAVLMIGLILVQHGKGADAGASFGGGGAATVFGASGSANFLTRLTAILT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS+ L + ++  +T       +S+  +   Q        ++PK   
Sbjct: 61  ALFFVTSLTLAVFAKKQTTEAYSL--KSVQTTAPIQTTSPETSPNAPKTGQ 109


>gi|94268755|ref|ZP_01291276.1| Preprotein translocase SecG subunit [delta proteobacterium MLMS-1]
 gi|93451477|gb|EAT02311.1| Preprotein translocase SecG subunit [delta proteobacterium MLMS-1]
          Length = 125

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/130 (20%), Positives = 50/130 (38%), Gaps = 16/130 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS------VRSTAHSLGRFTAILA 54
           MQ  L+V+H++V + LV +IL+Q    ++ G+S    S             + + T   A
Sbjct: 1   MQTILIVIHILVCLFLVVIILLQHGKGASIGASFGSASNQTVFGTEGPMPLMNKITTTAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
            FF ATS++L   S             S+++ ++      + +   P         +  +
Sbjct: 61  IFFMATSVSLAYFSSRVGDG-------SVMEQVRPPAAIEYEE---PLPQEDDEPQAIPL 110

Query: 115 VAGKRSSSRT 124
             G     + 
Sbjct: 111 PGGGDEVPQE 120


>gi|94265674|ref|ZP_01289414.1| Preprotein translocase SecG subunit [delta proteobacterium MLMS-1]
 gi|93453801|gb|EAT04170.1| Preprotein translocase SecG subunit [delta proteobacterium MLMS-1]
          Length = 125

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/130 (20%), Positives = 50/130 (38%), Gaps = 16/130 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS------VRSTAHSLGRFTAILA 54
           MQ  L+V+H++V + LV +IL+Q    ++ G+S    S             + + T   A
Sbjct: 1   MQTILIVIHILVCLFLVVIILLQHGKGASIGASFGSASNQTVFGTEGPMPLMNKITTTAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
            FF ATS++L   S             S+++ ++      + +   P         +  +
Sbjct: 61  IFFMATSVSLAYFSSRVGDG-------SVMEQVRPPAAIEYEE---PLPQEDDEPQAIPL 110

Query: 115 VAGKRSSSRT 124
             G     + 
Sbjct: 111 PGGGDEGPQE 120


>gi|325524620|gb|EGD02634.1| preprotein translocase subunit SecG [Burkholderia sp. TJI49]
          Length = 117

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y ST     +
Sbjct: 65 IFFVATLALTYLGSYKSTPSAGVL 88


>gi|322514511|ref|ZP_08067548.1| preprotein translocase subunit SecG [Actinobacillus ureae ATCC
          25976]
 gi|322119581|gb|EFX91659.1| preprotein translocase subunit SecG [Actinobacillus ureae ATCC
          25976]
          Length = 109

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 6/96 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
          M   L +++L+V + L+  IL+Q    +  G+S              +A+ L R TAILA
Sbjct: 1  MLNVLTIIYLVVAIALIGFILMQQGKGADAGASFGAGAAGTVFGSAGSANFLSRTTAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
            FF  S+ +G ++ +           S V    +Q
Sbjct: 61 VIFFGISLLIGYLNSHQVAPKSQFEDLSGVQQKVEQ 96


>gi|163737682|ref|ZP_02145099.1| adenylosuccinate synthetase [Phaeobacter gallaeciensis BS107]
 gi|163740734|ref|ZP_02148127.1| preprotein translocase, SecG subunit [Phaeobacter gallaeciensis
           2.10]
 gi|161385725|gb|EDQ10101.1| preprotein translocase, SecG subunit [Phaeobacter gallaeciensis
           2.10]
 gi|161389208|gb|EDQ13560.1| adenylosuccinate synthetase [Phaeobacter gallaeciensis BS107]
          Length = 120

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 52/119 (43%), Gaps = 5/119 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           M+  ++++HL++ +GL+ V+L+Q S+       G      S R+ A ++ + T ILA  F
Sbjct: 1   MENVVLIIHLLLALGLIAVVLLQRSEGGGLGMGGGGGGAMSGRAAATAMSKLTWILAVAF 60

Query: 58  FATSIALGMISRYTSTRYK--DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             TSI L +++   S      D +     +   D      G    P +   +A    S 
Sbjct: 61  IGTSITLTILAAQKSAGSSVADRLSAPAAEGAADAPEAPLGSDLLPPVQGDNAPLVPSA 119


>gi|326794267|ref|YP_004312087.1| preprotein translocase, SecG subunit [Marinomonas mediterranea
           MMB-1]
 gi|326545031|gb|ADZ90251.1| preprotein translocase, SecG subunit [Marinomonas mediterranea
           MMB-1]
          Length = 115

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 47/118 (39%), Gaps = 12/118 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M+  ++VVH++  V ++ ++L+Q    +        G+S      +  +   GR TA  A
Sbjct: 1   MEALILVVHVLAAVAIIALVLLQQGKGADAGASFGGGASQTVFGSQGGSSFFGRMTAFFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             FF TS  L  ++   +      +       + +       + S P+LD+    S  
Sbjct: 61  LVFFLTSFGLAYVASEKAKSVSGALDFVPQAPVVES------EDSLPQLDTTEVGSDI 112


>gi|192973069|gb|ACF06968.1| preprotein translocase SecG subunit [uncultured Roseobacter sp.]
          Length = 117

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 54/114 (47%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRSTAHSLGRFTAILAF 55
           MQ  ++++HL++ + L+ ++L+Q S+         G+     S R+ A +L + T  LA 
Sbjct: 1   MQNVVLIIHLLLAISLIGLVLLQRSEGGGLGMGGGGAGGGAMSGRAAASALTKLTWGLAI 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
            F  TS+AL ++ +   +     + + +  + +D   D  GD   P     SA 
Sbjct: 61  AFICTSLALTIL-QVQKSSGSSVLDQLMPATEQDTPVD--GDALLPPSAEDSAP 111


>gi|254419902|ref|ZP_05033626.1| preprotein translocase SecG subunit, putative [Brevundimonas sp.
          BAL3]
 gi|196186079|gb|EDX81055.1| preprotein translocase SecG subunit, putative [Brevundimonas sp.
          BAL3]
          Length = 148

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS---SNFTSVRSTAHSLGRFTAILAFFF 57
          +Q  L+V  ++V V L  V+L+Q S+  A G     S F + R   + L + T +LA   
Sbjct: 6  LQTILLVAIILVAVSLTGVVLLQRSEGGALGMGGGPSGFMTARGAGNLLTKITWVLAALL 65

Query: 58 FATSIALGMISR 69
          F  +I L ++  
Sbjct: 66 FGLTIILTVVGN 77


>gi|330817793|ref|YP_004361498.1| preprotein translocase subunit SecG [Burkholderia gladioli BSR3]
 gi|327370186|gb|AEA61542.1| preprotein translocase subunit SecG [Burkholderia gladioli BSR3]
          Length = 129

 Score = 58.6 bits (140), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 42/81 (51%), Gaps = 6/81 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQILSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRY 75
            FF  ++AL  +  Y S   
Sbjct: 64 TIFFIATLALTYLGSYKSAPS 84


>gi|126735304|ref|ZP_01751050.1| preprotein translocase, SecG subunit, putative [Roseobacter sp.
          CCS2]
 gi|126715859|gb|EBA12724.1| preprotein translocase, SecG subunit, putative [Roseobacter sp.
          CCS2]
          Length = 118

 Score = 58.6 bits (140), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 4/92 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
          M+  ++++HLI+ + L+  +L+Q S+       G     T  R  A ++ +FT  LA  F
Sbjct: 1  MENVVLIIHLILALALIGTVLLQRSEGGGLGMGGGGGGATGSRPAATAMSKFTWALAAAF 60

Query: 58 FATSIALGMISRYTSTRYKDNMHRSLVDSIKD 89
            TSI+L +I+  ++T     + +  +D   D
Sbjct: 61 ICTSISLTLIAA-SNTAGSSVVDQLGIDPGSD 91


>gi|184156667|ref|YP_001845006.1| preprotein translocase subunit SecG [Acinetobacter baumannii ACICU]
 gi|294842031|ref|ZP_06786714.1| preprotein translocase subunit SecG [Acinetobacter sp. 6014059]
 gi|183208261|gb|ACC55659.1| Preprotein translocase subunit SecG [Acinetobacter baumannii ACICU]
 gi|323516433|gb|ADX90814.1| preprotein translocase subunit SecG [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 109

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 51/111 (45%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           M  F++VVH+I+ V ++ +IL+Q    +  G+S              + + L R TAIL 
Sbjct: 1   MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNFLTRVTAILT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS+ L + ++  +T       +++  ++  Q        ++PK   
Sbjct: 61  ALFFVTSLTLAVFAKKQTTEAYSL--KTVQTTVPVQTTSPETSPNAPKTGQ 109


>gi|254455461|ref|ZP_05068890.1| preprotein translocase SecG subunit [Candidatus Pelagibacter sp.
          HTCC7211]
 gi|207082463|gb|EDZ59889.1| preprotein translocase SecG subunit [Candidatus Pelagibacter sp.
          HTCC7211]
          Length = 79

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 3/63 (4%)

Query: 21 LIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKD 77
          ++Q S+  A G   +   F   RS    + + TAI+A  F   S+AL +ISR   T    
Sbjct: 1  MLQKSEGGALGIGVSQENFMLSRSAGSFMTKATAIVATLFIICSLALTIISRAELTPTSS 60

Query: 78 NMH 80
           + 
Sbjct: 61 VLD 63


>gi|148825275|ref|YP_001290028.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittEE]
 gi|148715435|gb|ABQ97645.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittEE]
          Length = 112

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  ++ LG ++ +   
Sbjct: 61 TAFFVIALVLGNMNSHKGN 79


>gi|260556302|ref|ZP_05828521.1| preprotein translocase, SecG subunit [Acinetobacter baumannii ATCC
           19606]
 gi|260410357|gb|EEX03656.1| preprotein translocase, SecG subunit [Acinetobacter baumannii ATCC
           19606]
          Length = 109

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 50/111 (45%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           M  F++VVH+I+ V ++ +IL+Q    +  G+S              + + L R TAIL 
Sbjct: 1   MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNFLTRVTAILT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS+ L + ++  +T       +++  +   Q        ++PK   
Sbjct: 61  ALFFVTSLTLAIFAKKQTTEAYSL--KTVQTTAPAQTTSPETSPNAPKTGQ 109


>gi|254436306|ref|ZP_05049812.1| preprotein translocase, SecG subunit, putative [Nitrosococcus
           oceani AFC27]
 gi|207087996|gb|EDZ65269.1| preprotein translocase, SecG subunit, putative [Nitrosococcus
           oceani AFC27]
          Length = 148

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 36/148 (24%), Positives = 60/148 (40%), Gaps = 25/148 (16%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILA 54
           M   L+V+H++V V LV ++LIQ    +    AFGS ++ T    R +   L R +AILA
Sbjct: 1   MHSVLLVLHIVVAVALVGLVLIQHGKGADAGAAFGSGASATVFGARGSGSFLTRASAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYK--------------DNMHRSLVDSIKDQGN-----DNF 95
             FF TS++L   S                        +     +  ++        D+ 
Sbjct: 61  ATFFITSLSLAYFSVRKPQETSVTQTVEPRVVADENMVIPSLPKEEDEEGAAKKLLEDDQ 120

Query: 96  GDGSSPKLDSVSAKSSSSVVAGKRSSSR 123
           G G     +S++A S    +  + S  +
Sbjct: 121 GKGGEESSESLAAPSEIPALPSEASPEQ 148


>gi|85708715|ref|ZP_01039781.1| hypothetical protein NAP1_05730 [Erythrobacter sp. NAP1]
 gi|85690249|gb|EAQ30252.1| hypothetical protein NAP1_05730 [Erythrobacter sp. NAP1]
          Length = 140

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 45/127 (35%), Gaps = 6/127 (4%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSAFGSS---SNFTSVRSTAHSLGRFTAILAFFFFA 59
           I   V+  IV   LV V+L+Q S+    G     S     R  A  L + T  LA  F A
Sbjct: 5   IIFTVIQAIVAAALVGVVLMQRSEGGGLGIGGNPSGALGARGAADFLTKSTRWLAIAFVA 64

Query: 60  TSIALGMISRYTSTR---YKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
            SI L  ++   S+      D        S  D   +    G SP   +        ++ 
Sbjct: 65  LSIFLAALAVSESSMGDVSTDLERDVNAPSAADLLGEGAPAGVSPDGAASDPADLEDLLG 124

Query: 117 GKRSSSR 123
              +++ 
Sbjct: 125 ENPANTE 131


>gi|294011599|ref|YP_003545059.1| preprotein translocase subunit SecG [Sphingobium japonicum UT26S]
 gi|292674929|dbj|BAI96447.1| preprotein translocase subunit SecG [Sphingobium japonicum UT26S]
          Length = 125

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 37/79 (46%), Gaps = 3/79 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG---SSSNFTSVRSTAHSLGRFTAILAFFF 57
          M  F++VV  IV   LV VIL+Q S+    G   S + F S R  A  L R T +LA  F
Sbjct: 1  MFTFILVVQAIVAALLVTVILMQKSEGGGLGVGGSPAGFMSARGAADFLTRSTTVLAGIF 60

Query: 58 FATSIALGMISRYTSTRYK 76
             S+ L +I+        
Sbjct: 61 VTLSVVLAVIASIQHRPSD 79


>gi|238028144|ref|YP_002912375.1| preprotein translocase subunit SecG [Burkholderia glumae BGR1]
 gi|237877338|gb|ACR29671.1| Protein-export membrane protein [Burkholderia glumae BGR1]
          Length = 125

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQILSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL  +  Y S      +
Sbjct: 64 TVFFVATLALTYLGSYKSAPSIGVL 88


>gi|29654740|ref|NP_820432.1| protein translocase subunit [Coxiella burnetii RSA 493]
 gi|153207275|ref|ZP_01946039.1| preprotein translocase, SecG subunit [Coxiella burnetii 'MSU Goat
          Q177']
 gi|154707766|ref|YP_001423955.1| protein translocase subunit [Coxiella burnetii Dugway 5J108-111]
 gi|161831118|ref|YP_001597294.1| preprotein translocase, SecG subunit [Coxiella burnetii RSA 331]
 gi|165918781|ref|ZP_02218867.1| preprotein translocase, SecG subunit [Coxiella burnetii RSA 334]
 gi|212212181|ref|YP_002303117.1| protein translocase subunit [Coxiella burnetii CbuG_Q212]
 gi|212218211|ref|YP_002304998.1| protein translocase subunit [Coxiella burnetii CbuK_Q154]
 gi|29542008|gb|AAO90946.1| protein translocase subunit [Coxiella burnetii RSA 493]
 gi|120576763|gb|EAX33387.1| preprotein translocase, SecG subunit [Coxiella burnetii 'MSU Goat
          Q177']
 gi|154357052|gb|ABS78514.1| protein translocase subunit [Coxiella burnetii Dugway 5J108-111]
 gi|161762985|gb|ABX78627.1| preprotein translocase, SecG subunit [Coxiella burnetii RSA 331]
 gi|165917505|gb|EDR36109.1| preprotein translocase, SecG subunit [Coxiella burnetii RSA 334]
 gi|212010591|gb|ACJ17972.1| protein translocase subunit [Coxiella burnetii CbuG_Q212]
 gi|212012473|gb|ACJ19853.1| protein translocase subunit [Coxiella burnetii CbuK_Q154]
          Length = 98

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVR--STAHSLGRFTAILA 54
          MQ  ++++H+++ V L+ ++L+Q        +AFGS S+ T          L + T  LA
Sbjct: 1  MQSIILIIHVLIAVCLIALVLLQHGKGADAGAAFGSGSSNTMFGSVGATPFLMKITIFLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRS 82
            FFATSI L  ++          +  +
Sbjct: 61 AAFFATSIGLSYLASRHPGTMAPPLPST 88


>gi|83858358|ref|ZP_00951880.1| hypothetical protein OA2633_02626 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853181|gb|EAP91033.1| hypothetical protein OA2633_02626 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 138

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 31/131 (23%), Positives = 51/131 (38%), Gaps = 10/131 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS----TAHSLGRFTAILAFF 56
           M   L+++H+++   L  VIL+Q S+  A G               A+ L R T IL   
Sbjct: 1   MTAVLLIIHVLIAAALTGVILMQRSEGGALGIGGGGPGGMMSGRGAANLLTRVTMILGAL 60

Query: 57  FFATSIALGMISRYTSTRYK--DNMHRSLVDSIKDQGNDNFGDGSSPKL----DSVSAKS 110
           F   SI L +IS  T++     D +  +  +S    G+    +   P       +  A +
Sbjct: 61  FIGNSILLAIISGVTTSSGSVLDRVGETQTNSDLPFGDLEGLETDVPAPTDEAPADPAPA 120

Query: 111 SSSVVAGKRSS 121
           S    A    +
Sbjct: 121 SDDAPAQDEPA 131


>gi|162286751|ref|YP_001083397.2| preprotein translocase subunit SecG [Acinetobacter baumannii ATCC
           17978]
 gi|169634556|ref|YP_001708292.1| preprotein translocase subunit SecG [Acinetobacter baumannii SDF]
 gi|169797410|ref|YP_001715203.1| preprotein translocase subunit SecG [Acinetobacter baumannii AYE]
 gi|213155776|ref|YP_002317821.1| preprotein translocase iisp family auxillary membrane component
           [Acinetobacter baumannii AB0057]
 gi|215484849|ref|YP_002327086.1| preprotein translocase, SecG subunit [Acinetobacter baumannii
           AB307-0294]
 gi|239500934|ref|ZP_04660244.1| preprotein translocase subunit SecG [Acinetobacter baumannii AB900]
 gi|294837296|ref|ZP_06781979.1| preprotein translocase subunit SecG [Acinetobacter sp. 6013113]
 gi|294859186|ref|ZP_06796955.1| preprotein translocase subunit SecG [Acinetobacter sp. 6013150]
 gi|301345149|ref|ZP_07225890.1| preprotein translocase subunit SecG [Acinetobacter baumannii AB056]
 gi|301510690|ref|ZP_07235927.1| preprotein translocase subunit SecG [Acinetobacter baumannii AB058]
 gi|301594950|ref|ZP_07239958.1| preprotein translocase subunit SecG [Acinetobacter baumannii AB059]
 gi|169150337|emb|CAM88234.1| preprotein translocase IISP family, auxillary membrane component
           [Acinetobacter baumannii AYE]
 gi|169153348|emb|CAP02461.1| preprotein translocase IISP family, auxillary membrane component
           [Acinetobacter baumannii]
 gi|193076180|gb|ABO10795.2| preprotein translocase IISP family auxillary membrane component
           [Acinetobacter baumannii ATCC 17978]
 gi|213054936|gb|ACJ39838.1| preprotein translocase iisp family auxillary membrane component
           [Acinetobacter baumannii AB0057]
 gi|213987662|gb|ACJ57961.1| preprotein translocase, SecG subunit [Acinetobacter baumannii
           AB307-0294]
          Length = 109

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 50/111 (45%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           M  F++VVH+I+ V ++ +IL+Q    +  G+S              + + L R TAIL 
Sbjct: 1   MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNFLTRVTAILT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS+ L + ++  +T       +++  +   Q        ++PK   
Sbjct: 61  ALFFVTSLTLAVFAKKQTTEAYSL--KTVQTTAPAQTTSPETSPNAPKTGQ 109


>gi|312113151|ref|YP_004010747.1| preprotein translocase, SecG subunit [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218280|gb|ADP69648.1| preprotein translocase, SecG subunit [Rhodomicrobium vannielii ATCC
           17100]
          Length = 119

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 49/119 (41%), Gaps = 5/119 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS-----TAHSLGRFTAILAF 55
           M   L+V+H++V V +V +IL+Q S+  A G                A+ + R TAILA 
Sbjct: 1   MANVLLVLHIVVAVTMVVIILLQRSEGGALGMGGGGGGGGFVSGRGAANVMTRTTAILAA 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
            FF TSI LG++ +  +         S                + PKL+     + +  
Sbjct: 61  IFFLTSITLGILGQRKTPTSAIGTPTSTSAPTTAPSQAPADAPALPKLNIPKPAAPAQQ 119


>gi|260914405|ref|ZP_05920874.1| preprotein translocase [Pasteurella dagmatis ATCC 43325]
 gi|260631506|gb|EEX49688.1| preprotein translocase [Pasteurella dagmatis ATCC 43325]
          Length = 113

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 49/113 (43%), Gaps = 8/113 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M   L+  ++I+   L+  IL+Q    +    +FG+ ++ T      + + L + TAILA
Sbjct: 1   MYHALLFGYVIISAVLIGFILLQQGKGADAGASFGAGASGTIFGAAGSGNFLSKTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMH--RSLVDSIKDQGNDNFGDGSSPKLDS 105
             FFA S+ +G I+ +     K       S  + ++ +      +  +  +  
Sbjct: 61  TVFFALSLVIGNINSHRDNVVKGKFDDLSSTAEQVQQKLEVPAVETKNSDIPQ 113


>gi|84516438|ref|ZP_01003797.1| preprotein translocase, SecG subunit [Loktanella vestfoldensis
           SKA53]
 gi|84509474|gb|EAQ05932.1| preprotein translocase, SecG subunit [Loktanella vestfoldensis
           SKA53]
          Length = 117

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 25/111 (22%), Positives = 50/111 (45%), Gaps = 3/111 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV--RSTAHSLGRFTAILAFFFF 58
           M+  ++++HLI+ + L+  +L+Q S+    G      +   R  A ++ +FT +LA  F 
Sbjct: 1   MENVVLIIHLILALSLIGTVLLQRSEGGGLGMGGGGGTANSRPPASAISKFTWMLAAAFI 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ-GNDNFGDGSSPKLDSVSA 108
           ATSI L +I+   +           ++  ++     + GD   P   +   
Sbjct: 61  ATSITLTLIAAGNTAGLSVADRVGGINLNQNDVTVPDLGDSLLPPSAAEEP 111


>gi|325276162|ref|ZP_08141967.1| preprotein translocase subunit SecG [Pseudomonas sp. TJI-51]
 gi|324098699|gb|EGB96740.1| preprotein translocase subunit SecG [Pseudomonas sp. TJI-51]
          Length = 133

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 52/131 (39%), Gaps = 6/131 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           ++  ++V HL+  + LV ++L+Q    +    +FG+ ++ T      +A  L + TAILA
Sbjct: 2   LETVIVVFHLLAALSLVVLVLLQQGKGAEAGASFGAGASNTVFGSQGSATFLSKLTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF T++ LG  ++  + +               +      +   P L       ++  
Sbjct: 62  ATFFLTALGLGYFAKQQAHQLSQAGLPDPAVLEVKEPQKPAVNDDVPVLQQQQKSEATPN 121

Query: 115 VAGKRSSSRTK 125
                  +  +
Sbjct: 122 TGDVPPPAEEQ 132


>gi|118595100|ref|ZP_01552447.1| secretion protein SecG [Methylophilales bacterium HTCC2181]
 gi|118440878|gb|EAV47505.1| secretion protein SecG [Methylophilales bacterium HTCC2181]
          Length = 111

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/112 (22%), Positives = 53/112 (47%), Gaps = 11/112 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M+  +++VH++  +G++ ++LIQ    +  G++       +   V+ +A+ L R T+I  
Sbjct: 1   MENLILIVHILASLGVIGLVLIQHGKGADAGAAFGGGNSGSVFGVQGSANFLSRATSICV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVD----SIKDQGNDNFGDGSSPK 102
             FF TSIAL +++          +  S  +    S+ ++ +   G    P 
Sbjct: 61  TTFFCTSIALAVVASNK-HGNSSVIDISPENDPSLSVSEESDTPLGAQDIPN 111


>gi|262280756|ref|ZP_06058539.1| preprotein translocase subunit SecG [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257656|gb|EEY76391.1| preprotein translocase subunit SecG [Acinetobacter calcoaceticus
           RUH2202]
          Length = 109

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/111 (22%), Positives = 51/111 (45%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           M  F+++VH+I+ V ++ +IL+Q    +  G+S              +A+ L R TA+L 
Sbjct: 1   MHSFVLIVHIILAVLMIGLILVQHGKGADAGASFGGGGAATVFGASGSANFLTRLTAVLT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS+ L + ++  ++       +++  +   Q        ++PK   
Sbjct: 61  ALFFVTSLTLAVFAKKQTSEAYSL--KTVQTTAPIQTTSPETSPNAPKTSQ 109


>gi|73540663|ref|YP_295183.1| preprotein translocase subunit SecG [Ralstonia eutropha JMP134]
 gi|72118076|gb|AAZ60339.1| protein translocase subunit secG [Ralstonia eutropha JMP134]
          Length = 118

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 41/80 (51%), Gaps = 6/80 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  L++V ++  +G++ ++LIQ    +        G+S +      +A+ L R TA+LA 
Sbjct: 5  KTLLVLVQVLSALGVIGLVLIQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAVLAT 64

Query: 56 FFFATSIALGMISRYTSTRY 75
           FF  +++L ++  Y  +  
Sbjct: 65 LFFICTLSLTLMGNYKPSTS 84


>gi|293610132|ref|ZP_06692433.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827364|gb|EFF85728.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325124305|gb|ADY83828.1| preprotein translocase subunit SecG [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 109

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 50/111 (45%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           M  F+++VH+I+ V ++ +IL+Q    +  G+S              + + L R TAIL 
Sbjct: 1   MHSFVLIVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNFLTRLTAILT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS+ L + ++  +T       +++  +   Q        ++PK   
Sbjct: 61  ALFFVTSLTLAVFAKKQTTDAYSL--KTVQTTAPVQTTSPETSPNAPKSSQ 109


>gi|260550519|ref|ZP_05824729.1| preprotein translocase subunit SecG [Acinetobacter sp. RUH2624]
 gi|260406434|gb|EEW99916.1| preprotein translocase subunit SecG [Acinetobacter sp. RUH2624]
          Length = 109

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 50/111 (45%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           M  F++VVH+I+ V ++ +IL+Q    +  G+S              + + L R TA+L 
Sbjct: 1   MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNFLTRLTAVLT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS+ L + ++  +T       +++  +   Q        ++PK   
Sbjct: 61  ALFFVTSLTLAVFAKKQTTEAYSL--KTVQTTAPAQTTSPETSPNAPKTGQ 109


>gi|126664886|ref|ZP_01735870.1| preprotein translocase, SecG subunit [Marinobacter sp. ELB17]
 gi|126631212|gb|EBA01826.1| preprotein translocase, SecG subunit [Marinobacter sp. ELB17]
          Length = 117

 Score = 57.9 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/114 (22%), Positives = 50/114 (43%), Gaps = 7/114 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
           M+  ++V+H+++ V LV ++LIQ    +  G+      S      + +   L RFT  LA
Sbjct: 4   METLIVVLHVVIAVALVGLVLIQQGKGADAGAAFGGGASQTVFGSQGSGSFLTRFTTFLA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND-NFGDGSSPKLDSVS 107
             FF TS +L + ++  +    +     + +S     +  +  DG    L  + 
Sbjct: 64  IAFFVTSFSLAIFAKQRAEVAGEAGIPMVQESAPAATDPVSETDGGQSDLPGLE 117


>gi|83952238|ref|ZP_00960970.1| preprotein translocase, SecG subunit [Roseovarius nubinhibens ISM]
 gi|83837244|gb|EAP76541.1| preprotein translocase, SecG subunit [Roseovarius nubinhibens ISM]
          Length = 121

 Score = 57.9 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 3/122 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD--SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
           M+  ++ +HL+V + L+ V+L+Q S+      G      + RS A +LG+ T +L F  F
Sbjct: 1   MENVVLTIHLLVTLALIGVVLLQRSEGGGLGMGGGGGAVAGRSAATALGKLTWVLGFGLF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATSIAL +I+   S      + R      +    D  GD          A    + +   
Sbjct: 61  ATSIALTVIAAEKSAG-SSVLDRLTDAPAQSAPADAQGDTGLGGSLLPPAAGDDTPLLPS 119

Query: 119 RS 120
             
Sbjct: 120 AE 121


>gi|262377015|ref|ZP_06070241.1| preprotein translocase, SecG subunit [Acinetobacter lwoffii SH145]
 gi|262308053|gb|EEY89190.1| preprotein translocase, SecG subunit [Acinetobacter lwoffii SH145]
          Length = 109

 Score = 57.9 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 46/101 (45%), Gaps = 6/101 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           MQ F++VVH+I+ V ++ +IL+Q    +  G+S              + + + R TAI  
Sbjct: 1   MQTFVLVVHIILAVLMIVLILVQHGKGADAGASFGGGGAATVFGASGSGNFMTRLTAIFT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF 95
             FF TS+ L ++++  ++            +   Q N+  
Sbjct: 61  ALFFVTSLTLAILAKQQTSNAYSLGSVQSAPTTPVQSNETS 101


>gi|255019906|ref|ZP_05291981.1| preprotein translocase, SecG subunit [Acidithiobacillus caldus ATCC
           51756]
 gi|254970686|gb|EET28173.1| preprotein translocase, SecG subunit [Acidithiobacillus caldus ATCC
           51756]
          Length = 135

 Score = 57.5 bits (137), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 29/130 (22%), Positives = 50/130 (38%), Gaps = 7/130 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M  FL+++ +I+ V LV ++LIQ    +        G S      R   + L   TA++ 
Sbjct: 1   MYDFLLILQVIICVVLVGLVLIQKGQGADIGAVFGGGGSQTVFGARGAGNFLSHTTAVVG 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG-SSPKLDSVSAKSSSS 113
             FF  S+ L  +S + S      +      +           G S+    S  A +S++
Sbjct: 61  ALFFLNSLGLAYLSDHASRSVSSGIALPAASAPAAAAPAAAATGSSTQAGASAQAPASAT 120

Query: 114 VVAGKRSSSR 123
             A +  S  
Sbjct: 121 TSASQAPSKE 130


>gi|317050329|ref|YP_004111445.1| preprotein translocase subunit SecG [Desulfurispirillum indicum
          S5]
 gi|316945413|gb|ADU64889.1| preprotein translocase, SecG subunit [Desulfurispirillum indicum
          S5]
          Length = 95

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 41/95 (43%), Gaps = 2/95 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST--AHSLGRFTAILAFFFF 58
          M   L+++H++  + ++  +LIQ    +  G      S+  T  A+ L + TA  A  F 
Sbjct: 1  MTTLLVILHVLAAIAIIAFVLIQKGKGADMGMMGGSDSILGTGGANFLIKITAFAAVIFL 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
          AT + L M+     T     M  + V   + +  D
Sbjct: 61 ATGLILAMVQTRAYTEGGSVMDSAEVPQQQQRAAD 95


>gi|149375758|ref|ZP_01893526.1| preprotein translocase, SecG subunit [Marinobacter algicola DG893]
 gi|149359883|gb|EDM48339.1| preprotein translocase, SecG subunit [Marinobacter algicola DG893]
          Length = 126

 Score = 57.5 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 49/120 (40%), Gaps = 8/120 (6%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAF 55
           +  ++V+H+++ V LV ++L+Q    +  G+      S        ++  L R T +LA 
Sbjct: 5   ETLVVVLHVLIAVALVTLVLLQQGKGANAGAAFGGGASQTVFGSEGSSSFLTRATTLLAI 64

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            FF TS +L + ++  +    +      V       +D          +S + +   + +
Sbjct: 65  VFFVTSFSLAVFAKQRAEVAGEAG--IPVVQESPAASDAGQAEGDSATESEAGRGDENKL 122


>gi|220934161|ref|YP_002513060.1| preprotein translocase, SecG subunit [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995471|gb|ACL72073.1| preprotein translocase, SecG subunit [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 112

 Score = 57.5 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 37/94 (39%), Gaps = 6/94 (6%)

Query: 17  VCVILIQSSDSS----AFGSSSNFTS--VRSTAHSLGRFTAILAFFFFATSIALGMISRY 70
           + +IL+Q    +    AFGS ++ T    R +A+ L R TAILA  FF  S+ L  +   
Sbjct: 18  IALILMQHGKGADAGAAFGSGASSTVFGARGSANFLSRTTAILATVFFVNSMGLAYLVSN 77

Query: 71  TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
                        ++       +    G+   + 
Sbjct: 78  QPAPTSVIDRLPAIEQPAPVRPEPVEPGAPADVP 111


>gi|262370083|ref|ZP_06063410.1| preprotein translocase subunit SecG [Acinetobacter johnsonii SH046]
 gi|262315122|gb|EEY96162.1| preprotein translocase subunit SecG [Acinetobacter johnsonii SH046]
          Length = 109

 Score = 57.5 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 50/111 (45%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           MQ F++VVH+I+ V ++ +IL+Q    +  G+S              + + L R TA+L 
Sbjct: 1   MQTFVLVVHIILAVLMIVLILVQHGKGADAGASFGGGGAATVFGASGSGNFLTRLTAVLT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS++L + ++  +T            S   Q  +     ++PK   
Sbjct: 61  ALFFITSLSLAVFAKKQTTDAYSLKSVQTTSSAPAQSTE--TSPAAPKTSE 109


>gi|218961463|ref|YP_001741238.1| protein-export membrane protein secG, essential membrane protein
           [Candidatus Cloacamonas acidaminovorans]
 gi|167730120|emb|CAO81032.1| protein-export membrane protein secG, essential membrane protein
           [Candidatus Cloacamonas acidaminovorans]
          Length = 136

 Score = 57.1 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 44/108 (40%), Gaps = 5/108 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           +    +++H+I+ V LV VIL Q+S         G++ N       +  L ++T ILA  
Sbjct: 27  LYTIALIIHVIICVALVLVILAQTSKGGLDSNLGGAAMNVFGGSGASKFLKKWTQILAVV 86

Query: 57  FFATSIALGMI-SRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKL 103
           F A+ + L  +     ++   D   R       +Q   +    + P  
Sbjct: 87  FAASCLFLAFLVKNINASALADIQSRQKKIKDTEQTAPSSKPATKPAT 134


>gi|251793005|ref|YP_003007731.1| preprotein translocase subunit SecG [Aggregatibacter aphrophilus
          NJ8700]
 gi|247534398|gb|ACS97644.1| protein-export membrane protein [Aggregatibacter aphrophilus
          NJ8700]
          Length = 116

 Score = 57.1 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
          M   L++++L+V + L+  IL+Q    +  G+S                + L R TA+LA
Sbjct: 1  MYSALLIIYLVVSIALIAFILLQQGKGADAGASFGGGASGTVFGSAGAGNFLSRTTAVLA 60

Query: 55 FFFFATSIALGMISRYTST 73
            FF  SI +G ++ + + 
Sbjct: 61 TIFFIISIVIGNLNSHKNN 79


>gi|114046594|ref|YP_737144.1| preprotein translocase subunit SecG [Shewanella sp. MR-7]
 gi|113888036|gb|ABI42087.1| protein translocase subunit secG [Shewanella sp. MR-7]
          Length = 110

 Score = 57.1 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 44/105 (41%), Gaps = 18/105 (17%)

Query: 17  VCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY 70
           + +ILIQ    +        G+S        + + L R TAILA  FF  S+ +G +S  
Sbjct: 17  IGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILAIAFFTLSLLIGNLSAN 76

Query: 71  TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            +            D+ K+ G+D   +  +  +D  + KS + + 
Sbjct: 77  HAKN---------EDAWKNLGSD---EQVTQPVDQATEKSETKIP 109


>gi|117919476|ref|YP_868668.1| preprotein translocase subunit SecG [Shewanella sp. ANA-3]
 gi|117611808|gb|ABK47262.1| protein translocase subunit secG [Shewanella sp. ANA-3]
          Length = 110

 Score = 56.7 bits (135), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 43/105 (40%), Gaps = 18/105 (17%)

Query: 17  VCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY 70
           + +ILIQ    +        G+S        + + L R TAILA  FF  S+ +G +S  
Sbjct: 17  IGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILAIAFFTLSLLIGNLSAN 76

Query: 71  TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            +            D+ K+ G D   +  +  +D  + KS + + 
Sbjct: 77  HAKN---------EDAWKNLGAD---EQVTQPVDQATEKSETKIP 109


>gi|297180946|gb|ADI17149.1| preprotein translocase subunit secg [uncultured gamma
           proteobacterium HF0070_08D07]
          Length = 114

 Score = 56.7 bits (135), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%), Gaps = 7/94 (7%)

Query: 17  VCVILIQSSDSS----AFGSSSNFTSVRST--AHSLGRFTAILAFFFFATSIALGMISRY 70
           + ++L+Q    +    AFGS S+ T   S+  A+ L R T   A  FF  S  L  +++ 
Sbjct: 20  IGLVLLQQGKGADVGAAFGSGSSGTVFGSSGGANFLTRLTTFFAVLFFVLSFGLAYLAK- 78

Query: 71  TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             T+    +    +   ++Q ++   +  + ++ 
Sbjct: 79  ERTQSSATLPMIELPDRENQDSEITLEVDNEEIP 112


>gi|154253596|ref|YP_001414420.1| preprotein translocase subunit SecG [Parvibaculum lavamentivorans
           DS-1]
 gi|154157546|gb|ABS64763.1| preprotein translocase, SecG subunit [Parvibaculum lavamentivorans
           DS-1]
          Length = 144

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 45/117 (38%), Gaps = 12/117 (10%)

Query: 17  VCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTST 73
           V  +L+Q S+  A G       F S R   ++L R TA+LA  F  TS+ LG+++    +
Sbjct: 17  VATVLLQRSEGGALGIGGGGDGFMSGRGAGNALTRATAVLAALFITTSLVLGILASRGGS 76

Query: 74  ---------RYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSS 121
                            ++ D     G++      +P  +     +  +  A  ++ 
Sbjct: 77  ADGILDRIAPPTAGGDETVPDVPAPLGSEFPDLEQTPAANQPETATDEAPAAPVQAP 133


>gi|94987573|ref|YP_595506.1| preprotein translocase subunit SecG [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731822|emb|CAJ55185.1| Preprotein translocase subunit SecG [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 112

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 41/104 (39%), Gaps = 4/104 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSS-DSSAFGSSSNFTS---VRSTAHSLGRFTAILAFF 56
           M   ++ +HLIV + LV ++L+QS  +          TS          L + TA LA  
Sbjct: 1   MNTLILSLHLIVCILLVIIVLLQSGKEGMGVIFGGGNTSVFGSSGAGGLLTKLTAFLAII 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
           F  TS++  +I+   S      +   + +S          +  S
Sbjct: 61  FIITSLSYNIITNTNSANQSTILDVQIENSSNTTQAHPQSNQES 104


>gi|83644098|ref|YP_432533.1| preprotein translocase subunit SecG [Hahella chejuensis KCTC 2396]
 gi|83632141|gb|ABC28108.1| preprotein translocase, SecG subunit [Hahella chejuensis KCTC 2396]
          Length = 132

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 51/126 (40%), Gaps = 6/126 (4%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVR------STAHSLGRFTAILAF 55
           +  +++VH+IV  G++ ++LIQ    +  G+S    + +       +   L   T  LA 
Sbjct: 5   ETLIVIVHVIVAAGVIGLVLIQQGKGADMGASFGGGASQTVFGSSGSGSFLTNMTTTLAI 64

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            FF +S AL  +++  +++   +    +          +     +   ++   + ++   
Sbjct: 65  VFFLSSFALAYVAKQKASQVTASGVPVIETVSGSSSESDELSIDADSTNAGEVQGAAEAP 124

Query: 116 AGKRSS 121
           +  +  
Sbjct: 125 SDSKPE 130


>gi|113969367|ref|YP_733160.1| preprotein translocase subunit SecG [Shewanella sp. MR-4]
 gi|113884051|gb|ABI38103.1| protein translocase subunit secG [Shewanella sp. MR-4]
          Length = 110

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 39/94 (41%), Gaps = 7/94 (7%)

Query: 17  VCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY 70
           + +ILIQ    +        G+S        + + L R TAILA  FF  S+ +G +S  
Sbjct: 17  IGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILAIAFFTLSLLIGNLSAN 76

Query: 71  TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
            + + +D      VD    Q  D   + S  K+ 
Sbjct: 77  HA-KNEDTWKNLGVDEQVTQPVDQATEKSETKIP 109


>gi|319794669|ref|YP_004156309.1| preprotein translocase, secg subunit [Variovorax paradoxus EPS]
 gi|315597132|gb|ADU38198.1| preprotein translocase, SecG subunit [Variovorax paradoxus EPS]
          Length = 136

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/103 (21%), Positives = 41/103 (39%), Gaps = 6/103 (5%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
             L+ V ++  + ++ +IL+Q    +        GS+ +      +A+ L R TA+LA  
Sbjct: 6   NLLVGVQMLAALAMIGLILVQHGKGADMGAAFGSGSAGSLFGASGSANFLSRTTAVLAAV 65

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
           FFA ++ L   S          + R+ V +         G   
Sbjct: 66  FFACTLLLAYFSHARPAGGGSLLERAAVGTPAAPAKPASGAAG 108


>gi|218885453|ref|YP_002434774.1| preprotein translocase subunit SecG [Desulfovibrio vulgaris str.
          'Miyazaki F']
 gi|218756407|gb|ACL07306.1| preprotein translocase, SecG subunit [Desulfovibrio vulgaris str.
          'Miyazaki F']
          Length = 114

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 38/89 (42%), Gaps = 4/89 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSS-DSSAFGSSSNFTS---VRSTAHSLGRFTAILAFF 56
          MQ  ++ +H++  + L+ ++L+QS  +          TS          L + TA LA  
Sbjct: 1  MQTLILTLHVVACLALIVLVLLQSGKEGMGVIFGGGNTSLFGSTGAGGMLAKLTAFLAVL 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVD 85
          F  TS++  +++    +     +   L D
Sbjct: 61 FIITSLSYNVLTSSRKSDDSTILDVKLED 89


>gi|312796903|ref|YP_004029825.1| protein translocase subunit secG [Burkholderia rhizoxinica HKI 454]
 gi|312168678|emb|CBW75681.1| Protein translocase subunit secG [Burkholderia rhizoxinica HKI 454]
          Length = 133

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 49/122 (40%), Gaps = 6/122 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           ++  ++VV ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 7   LKTLMIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGASGSANFLSRTTAVLA 66

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF +++AL  +  Y        +  +   +       +          S +  +  S 
Sbjct: 67  TVFFVSTLALTALGSYRPKAGGGLLGGAASLAASAPAAGSGVASGVAVPSSAAPSAGVST 126

Query: 115 VA 116
             
Sbjct: 127 PG 128


>gi|87119794|ref|ZP_01075691.1| hypothetical protein MED121_07635 [Marinomonas sp. MED121]
 gi|86165270|gb|EAQ66538.1| hypothetical protein MED121_07635 [Marinomonas sp. MED121]
          Length = 118

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/89 (20%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS------TAHSLGRFTAILA 54
          M+  ++VVH++  + ++ ++L+Q    +  G+S    + ++           G+ TA+ A
Sbjct: 2  MEALVLVVHVLAAIAIIGLVLLQQGKGADAGASFGGGASQTVFGSQGGGSFFGKLTALFA 61

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSL 83
            FF TS AL  ++   + +    +    
Sbjct: 62 LVFFLTSFALAYVASQQAKQVSGQLDYVP 90


>gi|163855936|ref|YP_001630234.1| preprotein translocase subunit SecG [Bordetella petrii DSM 12804]
 gi|163259664|emb|CAP41965.1| secG [Bordetella petrii]
          Length = 178

 Score = 56.3 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/120 (17%), Positives = 45/120 (37%), Gaps = 7/120 (5%)

Query: 13  VVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGM 66
            + ++ ++L+Q    +        GS+ +       A+ L R T   A  FFA+++ L  
Sbjct: 16  ALAIIVLVLLQQGKGADMGSAFGSGSAGSLFGATGAANFLSRTTKWAAVVFFASTLGLAY 75

Query: 67  ISRYTSTRYKDNMHRSLVDSIKDQGNDNF-GDGSSPKLDSVSAKSSSSVVAGKRSSSRTK 125
           +S   S+         + D   D+      G  +S      SA +       +  +++ +
Sbjct: 76  VSHKGSSSAGSVESGVMQDFPADRSVPQVPGAANSGSSVPQSAPAQPDASVPQAPAAQPQ 135


>gi|332185339|ref|ZP_08387088.1| preprotein translocase, SecG subunit [Sphingomonas sp. S17]
 gi|332015063|gb|EGI57119.1| preprotein translocase, SecG subunit [Sphingomonas sp. S17]
          Length = 121

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 46/118 (38%), Gaps = 3/118 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFF 57
           M  FL+V+H I+   LV VIL+Q S+    G   +     S R  A  L R TA+LA  F
Sbjct: 1   MFAFLLVIHAIIAATLVTVILMQRSEGGGLGMGGSPSGLMSARGAADFLSRATAVLATAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
              SI L +++   S    D        +             +    +     +S+V 
Sbjct: 61  VGFSILLAVLAATRSAPTIDTSLARTPATQAPITQPAPAPVPTGAAPATQPADNSAVP 118


>gi|225075901|ref|ZP_03719100.1| hypothetical protein NEIFLAOT_00924 [Neisseria flavescens
           NRL30031/H210]
 gi|241759042|ref|ZP_04757154.1| preprotein translocase subunit SecG [Neisseria flavescens SK114]
 gi|224952757|gb|EEG33966.1| hypothetical protein NEIFLAOT_00924 [Neisseria flavescens
           NRL30031/H210]
 gi|241320863|gb|EER57096.1| preprotein translocase subunit SecG [Neisseria flavescens SK114]
          Length = 119

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 47/115 (40%), Gaps = 9/115 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS--------AFGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + ++ ++L+Q    +          GS+         A+ L R TAI 
Sbjct: 5   KTLIWIINIISALAVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAIA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
           A FFFAT +A+  I    S+++  +           +      + ++P   +   
Sbjct: 65  ATFFFATCMAMVYI-HTHSSKHGLDFSDVKQTQQAPKPATPAQNNTTPVAPNPQQ 118


>gi|206890970|ref|YP_002248969.1| preprotein translocase, SecG subunit [Thermodesulfovibrio
          yellowstonii DSM 11347]
 gi|206742908|gb|ACI21965.1| preprotein translocase, SecG subunit [Thermodesulfovibrio
          yellowstonii DSM 11347]
          Length = 107

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 38/84 (45%), Gaps = 6/84 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSV--RSTAHSLGRFTAILA 54
          M+  L++ H+I+   ++ V+L+     +    AFG  S+ T    R  A  L +   I+A
Sbjct: 1  MKTLLLIFHIILCFVMIAVVLLHRGKGAELGPAFGGGSSQTLFGPRGAATFLNKVATIVA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDN 78
            F  +S  L  I+  + +   D 
Sbjct: 61 VLFMLSSFFLTYITTRSKSVVSDV 84


>gi|126725628|ref|ZP_01741470.1| preprotein translocase, SecG subunit [Rhodobacterales bacterium
          HTCC2150]
 gi|126704832|gb|EBA03923.1| preprotein translocase, SecG subunit [Rhodobacterales bacterium
          HTCC2150]
          Length = 120

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 5/83 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT-----SVRSTAHSLGRFTAILAF 55
          M+  ++++HL++ + L+ ++L+Q S+    G           + RS   ++G+ T ILA 
Sbjct: 1  MENVVLIIHLLLALSLIGIVLLQRSEGGGLGLGGGGGGGAAKTGRSAGTAMGKLTWILAA 60

Query: 56 FFFATSIALGMISRYTSTRYKDN 78
           F  TSI+L +I+   +      
Sbjct: 61 AFIVTSISLTVIAAQKAANESVI 83


>gi|148549782|ref|YP_001269884.1| preprotein translocase subunit SecG [Pseudomonas putida F1]
 gi|148513840|gb|ABQ80700.1| protein translocase subunit secG [Pseudomonas putida F1]
          Length = 132

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 57/131 (43%), Gaps = 7/131 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           ++  ++V HL+  + LV ++L+Q    +    +FG+ ++ T      +A  L + TAILA
Sbjct: 2   LETVIVVFHLLAALSLVVLVLLQQGKGAEAGASFGAGASNTVFGSQGSATFLSKLTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF T++ LG  ++  + +               +      +   P L    ++++S+ 
Sbjct: 62  ATFFLTALGLGYFAKQQAHQLSQAGLPDPAVLEVKEPQKPAVNDDVPVLQQQKSETTSNT 121

Query: 115 VAGKRSSSRTK 125
                  ++ +
Sbjct: 122 -GDVPPPAQEQ 131


>gi|198284347|ref|YP_002220668.1| preprotein translocase subunit SecG [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218666041|ref|YP_002427009.1| preprotein translocase, SecG subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198248868|gb|ACH84461.1| preprotein translocase, SecG subunit [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218518254|gb|ACK78840.1| preprotein translocase, SecG subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 133

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 51/130 (39%), Gaps = 10/130 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV +I+ + LV ++LIQ    +        G S      R   + L   TA++ 
Sbjct: 1   MYTVLLVVQIIICIVLVGLVLIQKGQGADIGAVFGGGGSQTIFGARGAGNFLSHTTAVIG 60

Query: 55  FFFFATSIALGMISRYTSTRYKD--NMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA--KS 110
             FF  S+ L  +S ++S+       +      +            +     + S    +
Sbjct: 61  ALFFLNSLGLAYLSDHSSSSVFSGIALPSKAPVTTSAPVAPIVAAPAQSVASAASPVTSA 120

Query: 111 SSSVVAGKRS 120
           +SSVVAGK  
Sbjct: 121 ASSVVAGKTP 130


>gi|315617258|gb|EFU97867.1| preprotein translocase, SecG subunit [Escherichia coli 3431]
 gi|325498756|gb|EGC96615.1| preprotein translocase IISP family [Escherichia fergusonii ECD227]
 gi|327251266|gb|EGE62955.1| preprotein translocase, SecG subunit [Escherichia coli STEC_7v]
 gi|332086480|gb|EGI91627.1| preprotein translocase, SecG subunit [Shigella dysenteriae 155-74]
          Length = 99

 Score = 55.9 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 42/108 (38%), Gaps = 15/108 (13%)

Query: 12  VVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALG 65
           + +GLV +I++Q    +        G+S+       + + + R TA+LA  FF  S+ LG
Sbjct: 1   MAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFFIISLVLG 60

Query: 66  MISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
            I+   + +  +          ++       + + P   +       +
Sbjct: 61  NINSNKTNKGSE---------WENLSAPAKTEQTQPAAPAKPTSDIPN 99


>gi|297568027|ref|YP_003689371.1| preprotein translocase, SecG subunit [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296923942|gb|ADH84752.1| preprotein translocase, SecG subunit [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 124

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 47/124 (37%), Gaps = 5/124 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS-----VRSTAHSLGRFTAILAF 55
           M   L+V H++V + LV ++L+Q    ++ G+S   +S            + + T + A 
Sbjct: 1   MYTVLIVSHILVCLFLVTIVLLQHGKGASIGASFGGSSQTVFGTEGPLPLMNKITTMAAV 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            F  TSI+L  IS            R+    I++   ++    + P   +       +  
Sbjct: 61  VFMITSISLAYISSRAGDGSVMERVRTTPAPIEEVLPESDEPVTIPLPGATDGDVPRTFP 120

Query: 116 AGKR 119
               
Sbjct: 121 GEAE 124


>gi|310815251|ref|YP_003963215.1| putative preprotein translocase [Ketogulonicigenium vulgare Y25]
 gi|308753986|gb|ADO41915.1| putative preprotein translocase [Ketogulonicigenium vulgare Y25]
          Length = 122

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT------SVRSTAHSLGRFTAILA 54
          M+  +++VHLI+ + L+ V+L+Q S+    G  +         + RS   +L + T  LA
Sbjct: 1  METVVIIVHLILALVLIGVVLLQRSEGGGLGMGAGGGNGGLPSTGRSGTTALAKATWWLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLV 84
            F  TS+ L +++   ++      +  L+
Sbjct: 61 GAFIVTSLVLTILAATGNSGSGLMSNPDLL 90


>gi|288817939|ref|YP_003432286.1| protein export membrane protein [Hydrogenobacter thermophilus TK-6]
 gi|288787338|dbj|BAI69085.1| protein export membrane protein [Hydrogenobacter thermophilus TK-6]
          Length = 112

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/107 (20%), Positives = 37/107 (34%), Gaps = 5/107 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDS----SAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M  FL+VV + +   L+ V+L+Q S      +  G              L + T  L F 
Sbjct: 1   MYYFLLVVFVFIAFLLIVVVLLQRSRGDVGTAFGGMGQGVFGPGGVDTILTKITYWLGFL 60

Query: 57  FFATSIALGMI-SRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
           F   +I L +       +  KD   R+   + +           +P 
Sbjct: 61  FMFIAILLALTHPSKRGSLLKDEGARAPQKTQQSIPERQGAPSGTPP 107


>gi|167855778|ref|ZP_02478532.1| protein-export membrane protein [Haemophilus parasuis 29755]
 gi|219870671|ref|YP_002475046.1| preprotein translocase subunit SecG [Haemophilus parasuis SH0165]
 gi|167853118|gb|EDS24378.1| protein-export membrane protein [Haemophilus parasuis 29755]
 gi|219690875|gb|ACL32098.1| preprotein translocase subunit SecG [Haemophilus parasuis SH0165]
          Length = 109

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 46/105 (43%), Gaps = 6/105 (5%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILAFF 56
             L +V+L+V + LV  IL+Q    +  G+S              +A+ L R TAILA  
Sbjct: 4   NVLTIVYLVVAIFLVGFILMQQGKGADAGASFGAGAAGTVFGSAGSANFLSRTTAILAII 63

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
           FF+ S+ +G ++  T+         S V+  ++       +   P
Sbjct: 64  FFSVSLVIGNLNSQTAAPKSQFEDLSNVEQKQEVTPAKIENSDIP 108


>gi|115378716|ref|ZP_01465863.1| preprotein translocase, SecG subunit [Stigmatella aurantiaca
          DW4/3-1]
 gi|310822473|ref|YP_003954831.1| preprotein translocase subunit SecG [Stigmatella aurantiaca
          DW4/3-1]
 gi|115364266|gb|EAU63354.1| preprotein translocase, SecG subunit [Stigmatella aurantiaca
          DW4/3-1]
 gi|309395545|gb|ADO73004.1| Preprotein translocase, SecG [Stigmatella aurantiaca DW4/3-1]
          Length = 143

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSS--NFTSVRSTAHSLGRFTAILA 54
          M  F  +VH+++ V ++ VIL+Q        SA G  +  +    R     L + T + A
Sbjct: 1  MLTFFTIVHVLLCVFMIFVILLQPGKDAGMGSALGGGAATSAFGGRGAVTFLSKLTGVCA 60

Query: 55 FFFFATSIALGMISRYTS 72
            FF TS+ L  +   +S
Sbjct: 61 ALFFLTSLGLSFVGLRSS 78


>gi|85374120|ref|YP_458182.1| hypothetical protein ELI_06465 [Erythrobacter litoralis HTCC2594]
 gi|84787203|gb|ABC63385.1| hypothetical protein ELI_06465 [Erythrobacter litoralis HTCC2594]
          Length = 122

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 47/111 (42%), Gaps = 5/111 (4%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFFFAT 60
           FL VV  IV   LV V+L+Q S+    G   +     S R  A  L R T  LA  F   
Sbjct: 6   FLTVVQAIVAAALVGVVLMQRSEGGGLGIGGSPSGMMSARGAADFLTRTTKWLAVAFVGL 65

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
           SIAL  ++    T   D +  +L  ++    +D     + P  D+ S  S 
Sbjct: 66  SIALAAVA--VETTGGDAIESTLDRNVTSTESDPLAAPAVPGDDAPSTPSD 114


>gi|298369758|ref|ZP_06981075.1| preprotein translocase, SecG subunit [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298282315|gb|EFI23803.1| preprotein translocase, SecG subunit [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 120

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/116 (20%), Positives = 47/116 (40%), Gaps = 10/116 (8%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS--------AFGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + ++ ++L+Q    +          GS+         A+ L   TAI 
Sbjct: 5   KTVIWIINIISALAVIVLVLLQHGKGADAGATFGSGTGSAQGVFGSGGNANFLSHATAIA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKD--NMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
           A FFFAT +A+  I   T+    D  N+ +SL    +    +     + P      
Sbjct: 65  ATFFFATCMAMVYIHSNTTRHGLDFSNVKQSLPAKTQQAPTNGGKTDTVPAAPKQQ 120


>gi|170719904|ref|YP_001747592.1| preprotein translocase subunit SecG [Pseudomonas putida W619]
 gi|169757907|gb|ACA71223.1| preprotein translocase, SecG subunit [Pseudomonas putida W619]
          Length = 130

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 55/131 (41%), Gaps = 10/131 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           ++  ++V HL+  + LV ++L+Q    +    +FG+ ++ T      +A  L +FTAILA
Sbjct: 2   LETVIVVFHLLAALSLVVLVLLQQGKGAEAGASFGAGASNTVFGSQGSATFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF T++ LG  ++  + +               Q      D     +  +  + S + 
Sbjct: 62  ATFFLTALGLGYFAKQQAHQLGQAGLPDPAVLEVKQPKPAVND----DVPVLQEQKSETT 117

Query: 115 VAGKRSSSRTK 125
            AG       +
Sbjct: 118 PAGDVPPPAEE 128


>gi|162455629|ref|YP_001617996.1| protein-export membrane protein [Sorangium cellulosum 'So ce 56']
 gi|161166211|emb|CAN97516.1| protein-export membrane protein [Sorangium cellulosum 'So ce 56']
          Length = 90

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 5/74 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS-----SDSSAFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  FL +VH+ V + L+ V+L+Q        S+  G+++     R   + + R TA  A 
Sbjct: 2  LHTFLNIVHVFVCLFLILVVLLQQGRGGGMGSAMGGATAQVFGGRGAGNFMTRLTAACAV 61

Query: 56 FFFATSIALGMISR 69
           F ATS++L  +S 
Sbjct: 62 VFMATSVSLAYLSS 75


>gi|54295619|ref|YP_128034.1| preprotein translocase subunit SecG [Legionella pneumophila str.
          Lens]
 gi|54298773|ref|YP_125142.1| preprotein translocase subunit SecG [Legionella pneumophila str.
          Paris]
 gi|53752558|emb|CAH13990.1| Protein-export membrane protein secG (Preprotein translocase
          subunit) [Legionella pneumophila str. Paris]
 gi|53755451|emb|CAH16947.1| Protein-export membrane protein secG (Preprotein translocase
          subunit) [Legionella pneumophila str. Lens]
          Length = 107

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFT--SVRSTAHSLGRFTAILA 54
          M   ++++H+++ V L+ ++LIQ        +AFGS ++ T    + T   L + T  LA
Sbjct: 1  MYQLILMIHVLIAVILIGLVLIQHGKGADIGAAFGSGASNTLFGSQGTGGFLFKLTGGLA 60

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF TS+ L  +    + +
Sbjct: 61 MTFFITSLMLSYMVSTQNQK 80


>gi|289548684|ref|YP_003473672.1| preprotein translocase, SecG subunit [Thermocrinis albus DSM 14484]
 gi|289182301|gb|ADC89545.1| preprotein translocase, SecG subunit [Thermocrinis albus DSM 14484]
          Length = 112

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 44/114 (38%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDS----SAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M  FL+V+ L+V   L+ V+L+Q S      +  G   +          L R T  L F 
Sbjct: 1   MYYFLLVLFLMVAFLLIVVVLLQRSRGDVGTAFGGMGQSVFGPGGVDTILTRITYWLGFL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
           F    +AL ++   T    ++++ +          +    +G +P      + +
Sbjct: 61  F----MALAILLALTHPGRRESLIKDEGAGTSQPASQGKQEGKTPSPSPYPSGN 110


>gi|254491798|ref|ZP_05104977.1| preprotein translocase, SecG subunit [Methylophaga thiooxidans
           DMS010]
 gi|224463276|gb|EEF79546.1| preprotein translocase, SecG subunit [Methylophaga thiooxydans
           DMS010]
          Length = 110

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/108 (21%), Positives = 44/108 (40%), Gaps = 11/108 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV-----------RSTAHSLGRF 49
           M   ++ +H+IV + LV  +LIQ    +  G++                 + +A  L R 
Sbjct: 1   MHALILTIHIIVCLMLVGFVLIQHGKGADAGAAFGGGGGGGGASGSLFGSQGSASFLSRT 60

Query: 50  TAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGD 97
           +AILA  FF TS+ L   S     + +     +  +   ++   +  +
Sbjct: 61  SAILAAIFFMTSLTLAYFSVDRPDKVQSVTQTAPAEQKIEETPADLPE 108


>gi|317486890|ref|ZP_07945701.1| preprotein translocase [Bilophila wadsworthia 3_1_6]
 gi|316921880|gb|EFV43155.1| preprotein translocase [Bilophila wadsworthia 3_1_6]
          Length = 119

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 39/89 (43%), Gaps = 4/89 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFF 56
          MQ  ++ +H+IV V LV ++L+Q+          G +++          L + TA +A  
Sbjct: 1  MQTLILSLHVIVCVTLVILVLLQAGKEGMGVIFGGGNASVFGSSGAGGLLAKMTAFMAVL 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVD 85
          F  TS++   +S     +    +   L D
Sbjct: 61 FIVTSLSYNYVSSSHKAQESTILDVRLED 89


>gi|319638937|ref|ZP_07993695.1| preprotein translocase subunit SecG [Neisseria mucosa C102]
 gi|317399841|gb|EFV80504.1| preprotein translocase subunit SecG [Neisseria mucosa C102]
          Length = 119

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/115 (17%), Positives = 46/115 (40%), Gaps = 9/115 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS--------AFGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5   KTLIWIINIISALFVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
           A FFFAT +A+  I    S ++  +           +      + ++P   +   
Sbjct: 65  ATFFFATCMAMVYI-HTHSNKHGLDFSDVKQTQQAPKPATPAQNDTTPVAPNPQQ 118


>gi|302391121|ref|YP_003826941.1| protein translocase subunit secG [Acetohalobium arabaticum DSM
          5501]
 gi|302203198|gb|ADL11876.1| protein translocase subunit secG [Acetohalobium arabaticum DSM
          5501]
          Length = 99

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 6/70 (8%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAF------GSSSNFTSVRSTAHSLGRFTAILAFFF 57
           L V+HLI+ + L+  +L+QS  S+        G+SS F   R     + + T + A  F
Sbjct: 30 VLKVIHLIISLALIAGVLLQSGKSAGLSGAIDGGASSFFDQGRQAEEKIKKLTTVAAILF 89

Query: 58 FATSIALGMI 67
            +S+ L  +
Sbjct: 90 MISSLVLAAL 99


>gi|116625814|ref|YP_827970.1| protein translocase subunit secG [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116228976|gb|ABJ87685.1| protein translocase subunit secG [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 142

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 46/117 (39%), Gaps = 10/117 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV------RSTAHSLGRFTAILA 54
           M I L +VH+IV + L+ V+L+QS  ++    +            R +A  L + T I A
Sbjct: 1   MYILLWIVHVIVCLFLIIVVLLQSGKAADLAGAFGGMGSQTAFGPRGSATLLSKATTISA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
             F  TS++L +++   +      +  +     K     +    + P        + 
Sbjct: 61  ILFMITSLSLSILATRNAGLGTSVLETAP----KTSAPKSAPTQTVPIPGQAPQGNP 113


>gi|148361103|ref|YP_001252310.1| preprotein translocase subunit SecG [Legionella pneumophila str.
          Corby]
 gi|296108433|ref|YP_003620134.1| preprotein translocase SecG subunit [Legionella pneumophila
          2300/99 Alcoy]
 gi|148282876|gb|ABQ56964.1| preprotein translocase, SecG subunit [Legionella pneumophila str.
          Corby]
 gi|295650335|gb|ADG26182.1| preprotein translocase SecG subunit [Legionella pneumophila
          2300/99 Alcoy]
          Length = 107

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 6/73 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFT--SVRSTAHSLGRFTAILA 54
          M   ++++H+++ V L+ ++LIQ        +AFGS ++ T    + T   L + T  LA
Sbjct: 1  MYQLILMIHVLIAVILIGLVLIQHGKGADIGAAFGSGASNTLFGSQGTGGFLFKLTGGLA 60

Query: 55 FFFFATSIALGMI 67
            FF TS+ L  +
Sbjct: 61 MTFFITSLMLSYM 73


>gi|124266595|ref|YP_001020599.1| protein translocase subunit secG [Methylibium petroleiphilum PM1]
 gi|124259370|gb|ABM94364.1| protein translocase subunit secG [Methylibium petroleiphilum PM1]
          Length = 137

 Score = 55.2 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 36/77 (46%), Gaps = 6/77 (7%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
            ++VV ++  + ++ ++LIQ    +        G+S +      +A+ L R T + A  
Sbjct: 6  TVMVVVQMLSALVMIGLVLIQHGKGADMGASFGSGASGSLFGASGSANFLSRSTGVCAAI 65

Query: 57 FFATSIALGMISRYTST 73
          FFA ++AL       ++
Sbjct: 66 FFACTLALAYFGNLRAS 82


>gi|167035706|ref|YP_001670937.1| preprotein translocase subunit SecG [Pseudomonas putida GB-1]
 gi|166862194|gb|ABZ00602.1| preprotein translocase, SecG subunit [Pseudomonas putida GB-1]
          Length = 132

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 53/131 (40%), Gaps = 7/131 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           ++  ++V HL+  + LV ++L+Q    +    +FG+ ++ T      +A  L + TAILA
Sbjct: 2   LETVIVVFHLLAALSLVVLVLLQQGKGAEAGASFGAGASNTVFGSQGSATFLSKLTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF T++ LG  ++  + +               +      +   P L       +++ 
Sbjct: 62  ATFFLTALGLGYFAKQQAHQLSQAGLPDPAVLEVKEPQKPAVNDDVPVL-QQQKSETTNN 120

Query: 115 VAGKRSSSRTK 125
                  +  +
Sbjct: 121 TGDVPPPAEEQ 131


>gi|92115192|ref|YP_575120.1| protein translocase subunit secG [Chromohalobacter salexigens DSM
          3043]
 gi|91798282|gb|ABE60421.1| protein translocase subunit secG [Chromohalobacter salexigens DSM
          3043]
          Length = 119

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 42/99 (42%), Gaps = 6/99 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          M I +++VH+ + + LV ++L+Q    +  G+      S      + + + L + T +LA
Sbjct: 1  MYIGVLLVHVAIAIALVVLVLLQQGKGAEAGAAFGGGASQTVFGSQGSGNFLAKLTGVLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
            FFATS+ L           ++ +  +     +     
Sbjct: 61 AVFFATSLGLAYFVSQAGDAPQEGIPDAQAVEQQKSAAT 99


>gi|225025168|ref|ZP_03714360.1| hypothetical protein EIKCOROL_02062 [Eikenella corrodens ATCC
           23834]
 gi|224942129|gb|EEG23338.1| hypothetical protein EIKCOROL_02062 [Eikenella corrodens ATCC
           23834]
          Length = 114

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 40/110 (36%), Gaps = 6/110 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
           +  +M++     + ++ ++L+Q    +        GS+        +A+ L R TAI A 
Sbjct: 5   KTLIMIIGGFASIAVIGLVLMQQGKGADAGAAFGTGSAQGVFGSAGSANFLSRSTAIAAT 64

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
            FF   +AL +IS    +  K  +                   S P +  
Sbjct: 65  VFFCCCLALSIISSKQGSGNKLGLDAPAAAQHHAPAASQPATASQPVIPE 114


>gi|260575463|ref|ZP_05843462.1| preprotein translocase, SecG subunit [Rhodobacter sp. SW2]
 gi|259022383|gb|EEW25680.1| preprotein translocase, SecG subunit [Rhodobacter sp. SW2]
          Length = 168

 Score = 54.8 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 30/111 (27%), Positives = 45/111 (40%), Gaps = 2/111 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD--SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
           M+  ++ VHLI+ + L+ V+L+Q S+      G      S R+ A +L R T I A  F 
Sbjct: 1   MENVVLTVHLILALLLIGVVLLQRSEGGGLGMGGGGGAMSGRAAATALTRLTWIFAVAFI 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
            TS+AL +I+   S                   +   G GS        A 
Sbjct: 61  GTSVALTIIAAKNSAGSSVIDQIGGTAPAPKAPDAPLGGGSLLPPAPTDAP 111


>gi|237751370|ref|ZP_04581850.1| export protein secG [Helicobacter bilis ATCC 43879]
 gi|229372736|gb|EEO23127.1| export protein secG [Helicobacter bilis ATCC 43879]
          Length = 142

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 45/120 (37%), Gaps = 5/120 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M   L+V  +I+ + +V  +L+Q S S   G+ S         +  A+ + + T  L   
Sbjct: 1   MTSVLIVFQVILTIAIVIAVLLQKSSSIGLGAYSGSNESLFGAKGPANFMAKITMFLGLL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG-NDNFGDGSSPKLDSVSAKSSSSVV 115
           F   +IALG +    S+R    +    +         D+    SSP L       +    
Sbjct: 61  FIINTIALGYLYNTKSSRSSSVLDGVEIPKALPLTPTDSTLPLSSPLLQGTQPALTPQAP 120


>gi|322435147|ref|YP_004217359.1| preprotein translocase, SecG subunit [Acidobacterium sp. MP5ACTX9]
 gi|321162874|gb|ADW68579.1| preprotein translocase, SecG subunit [Acidobacterium sp. MP5ACTX9]
          Length = 102

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 42/96 (43%), Gaps = 6/96 (6%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDS----SAFGSSSNFTSV--RSTAHSLGRFTAILAFFF 57
            L+ +H+IV + L+ V+L+Q+  S     AFG   + T+   R  A+ L + TA     F
Sbjct: 7   LLVALHVIVSLFLIGVVLLQTGKSADLAGAFGGQGSQTAFGPRGAANVLTKLTAYSTVIF 66

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
              S +L ++   TS+R    +  +           
Sbjct: 67  MILSFSLTIMFSRTSSRDHSVLSGTPTQQSAPASKK 102


>gi|332111149|gb|EGJ11181.1| preprotein translocase subunit SecG [Rubrivivax benzoatilyticus
           JA2]
          Length = 127

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 23/125 (18%), Positives = 49/125 (39%), Gaps = 8/125 (6%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
              ++V+ ++  + ++ ++LIQ    +        GSS +      +A+ L R TA  A 
Sbjct: 5   MNLILVLQILSALAMIGLVLIQHGKGADMGASFGGGSSGSLFGATGSANFLSRSTAACAT 64

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            FF  ++AL  +S   S R       S++D             ++  +      ++ +  
Sbjct: 65  LFFCCTLALAFMSN--SVRGPSQERGSVLDRAAPTAPAEPSAPATGAIPGALTPAAPASG 122

Query: 116 AGKRS 120
           A   +
Sbjct: 123 ATGAN 127


>gi|24372784|ref|NP_716826.1| preprotein translocase subunit SecG [Shewanella oneidensis MR-1]
 gi|24346869|gb|AAN54271.1|AE015564_2 preprotein translocase, SecG subunit [Shewanella oneidensis MR-1]
          Length = 111

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 44/105 (41%), Gaps = 17/105 (16%)

Query: 17  VCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY 70
           + +ILIQ    +        G+S        + + L R TAILA  FF  S+ +G +S  
Sbjct: 17  IGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILAIAFFTLSLLIGNLSAN 76

Query: 71  TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            +            D+ K+ G+D   +  +  ++  + KS + + 
Sbjct: 77  HAKN---------EDAWKNLGSD--TEQVTQPVEQGTEKSETKIP 110


>gi|240127406|ref|ZP_04740067.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268685781|ref|ZP_06152643.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268626065|gb|EEZ58465.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae
           SK-93-1035]
          Length = 116

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 49/113 (43%), Gaps = 12/113 (10%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS--------AFGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5   KTLIWIINIISALAVIVLVLLQHGKGADAGTTFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMH-RSLVDSIKDQGNDNFGDGSSPKLDS 105
           A FFFAT +A+  I  +T+    D  + R    + K   N    + S+P    
Sbjct: 65  ATFFFATCMAMVYIHTHTTKHGLDFSNIRQTQQAPKPVSNT---EPSAPVPQQ 114


>gi|148284062|ref|YP_001248152.1| preprotein translocase subunit SecG [Orientia tsutsugamushi str.
          Boryong]
 gi|146739501|emb|CAM79207.1| protein-export membrane protein [Orientia tsutsugamushi str.
          Boryong]
          Length = 97

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 36/85 (42%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          M   L+ +H+++ V LV  IL+  + + +              + ++    L R   ILA
Sbjct: 1  MMNILLFIHIVISVLLVTAILLHKTGADSLSGLSGRNEGMGIVTSKAATSFLTRIIVILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  +I L  +S   +T   D +
Sbjct: 61 TCFFINAIILANLSSKKNTSITDKL 85


>gi|59800485|ref|YP_207197.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae FA 1090]
 gi|194097611|ref|YP_002000647.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae
           NCCP11945]
 gi|239998147|ref|ZP_04718071.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae 35/02]
 gi|240013329|ref|ZP_04720242.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae DGI18]
 gi|240015774|ref|ZP_04722314.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae FA6140]
 gi|240079910|ref|ZP_04724453.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae FA19]
 gi|240112117|ref|ZP_04726607.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae MS11]
 gi|240114863|ref|ZP_04728925.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID18]
 gi|240117066|ref|ZP_04731128.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID1]
 gi|240120402|ref|ZP_04733364.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID24-1]
 gi|240122704|ref|ZP_04735660.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID332]
 gi|240124894|ref|ZP_04737780.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae
           SK-92-679]
 gi|254492926|ref|ZP_05106097.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae 1291]
 gi|260441322|ref|ZP_05795138.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae DGI2]
 gi|268593999|ref|ZP_06128166.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae 35/02]
 gi|268596053|ref|ZP_06130220.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae FA19]
 gi|268598178|ref|ZP_06132345.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae MS11]
 gi|268600523|ref|ZP_06134690.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID18]
 gi|268602756|ref|ZP_06136923.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID1]
 gi|268681305|ref|ZP_06148167.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID332]
 gi|268683476|ref|ZP_06150338.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae
           SK-92-679]
 gi|291044677|ref|ZP_06570386.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae DGI2]
 gi|293397784|ref|ZP_06641990.1| preprotein translocase SecG subunit [Neisseria gonorrhoeae F62]
 gi|59717380|gb|AAW88785.1| putative protein-export protein [Neisseria gonorrhoeae FA 1090]
 gi|193932901|gb|ACF28725.1| putative protein-export protein [Neisseria gonorrhoeae NCCP11945]
 gi|226511966|gb|EEH61311.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae 1291]
 gi|268547388|gb|EEZ42806.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae 35/02]
 gi|268549841|gb|EEZ44860.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae FA19]
 gi|268582309|gb|EEZ46985.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae MS11]
 gi|268584654|gb|EEZ49330.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID18]
 gi|268586887|gb|EEZ51563.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID1]
 gi|268621589|gb|EEZ53989.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID332]
 gi|268623760|gb|EEZ56160.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae
           SK-92-679]
 gi|291011571|gb|EFE03567.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae DGI2]
 gi|291611730|gb|EFF40799.1| preprotein translocase SecG subunit [Neisseria gonorrhoeae F62]
 gi|317163439|gb|ADV06980.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 116

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 49/113 (43%), Gaps = 12/113 (10%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS--------AFGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5   KTLIWIINIISALAVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMH-RSLVDSIKDQGNDNFGDGSSPKLDS 105
           A FFFAT +A+  I  +T+    D  + R    + K   N    + S+P    
Sbjct: 65  ATFFFATCMAMVYIHTHTTKHGLDFSNIRQTQQAPKPVSNT---EPSAPVPQQ 114


>gi|330722334|gb|EGH00194.1| Preprotein translocase subunit SecG [gamma proteobacterium
           IMCC2047]
          Length = 107

 Score = 54.4 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 22/106 (20%), Positives = 42/106 (39%), Gaps = 8/106 (7%)

Query: 16  LVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISR 69
           ++ ++L+Q    +        G+S        + + + R TA+LA FFF TS AL ++++
Sbjct: 1   MIALVLLQQGKGADMGASFGAGASQTVFGSGGSGNFMTRATAVLATFFFVTSFALAIVAK 60

Query: 70  YTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
             S    D           DQ +       S +       + +S+ 
Sbjct: 61  DKSV--IDANAGIPEAVTVDQVDGETLPEISEEGLLEEQPADASLP 104


>gi|261378217|ref|ZP_05982790.1| preprotein translocase, SecG subunit [Neisseria cinerea ATCC 14685]
 gi|269145689|gb|EEZ72107.1| preprotein translocase, SecG subunit [Neisseria cinerea ATCC 14685]
          Length = 119

 Score = 54.4 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 22/115 (19%), Positives = 46/115 (40%), Gaps = 9/115 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS--------AFGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + ++ ++L+Q    +          GS+         A+ L R TAI 
Sbjct: 5   KTLIWIINIISALAVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAIA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
           A FFFAT +A+  I  +T T++  +           +      + + P       
Sbjct: 65  ATFFFATCMAMVYIHTHT-TKHGLDFSSVQQTQQAPKPAVPVKNNTEPAAPVPQQ 118


>gi|296314574|ref|ZP_06864515.1| preprotein translocase, SecG subunit [Neisseria polysaccharea ATCC
           43768]
 gi|296838667|gb|EFH22605.1| preprotein translocase, SecG subunit [Neisseria polysaccharea ATCC
           43768]
          Length = 116

 Score = 54.4 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 22/108 (20%), Positives = 44/108 (40%), Gaps = 8/108 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS--------AFGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5   KTLIWIINIISALAVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
           A FFFAT +A+  I  +T+    D  +           N+       P
Sbjct: 65  ATFFFATCMAMVYIHTHTTKHGLDFSNVQQTQQAPKPVNNTEPSAPVP 112


>gi|296283877|ref|ZP_06861875.1| hypothetical protein CbatJ_09651 [Citromicrobium bathyomarinum
           JL354]
          Length = 132

 Score = 54.4 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 49/132 (37%), Gaps = 12/132 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
           M +FL V+  I+   LV VIL+Q S+    G           S R  A  L R T  LA 
Sbjct: 1   MFLFLTVLQAIIAAALVGVILMQRSEGGGLGIGGGGSPGGMMSARGAADFLTRATRWLAV 60

Query: 56  FFFATSIALGMIS-------RYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
            F   SI L  ++          ST  ++    +  D +   G        + + D+   
Sbjct: 61  VFVVLSIILASLAVNMTGTDSIESTLDRNVTPAAPADPLAQGGAAAPAAAPAQQGDAADQ 120

Query: 109 KSSSSVVAGKRS 120
             ++  +AG   
Sbjct: 121 GEAADPLAGATE 132


>gi|119897686|ref|YP_932899.1| preprotein translocase subunit SecG [Azoarcus sp. BH72]
 gi|119670099|emb|CAL94012.1| preprotein translocase SecG subunit [Azoarcus sp. BH72]
          Length = 120

 Score = 54.4 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 47/105 (44%), Gaps = 11/105 (10%)

Query: 14  VGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMI 67
           +G++ ++L+Q    +  G++       +      +A+ L R TA+LA  FF TS++L  +
Sbjct: 18  LGVIGLVLVQHGKGADMGAAFGSGASGSLFGSSGSANFLSRTTAVLATVFFVTSLSLSYL 77

Query: 68  SRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
           +   ++     M R++  +  +          +P     ++K+  
Sbjct: 78  ASNKTSAPSSVMERAVPSAPAE-----GAGAVAPATPGDASKAQE 117


>gi|293391395|ref|ZP_06635729.1| protein-export membrane protein [Aggregatibacter
          actinomycetemcomitans D7S-1]
 gi|290951929|gb|EFE02048.1| protein-export membrane protein [Aggregatibacter
          actinomycetemcomitans D7S-1]
          Length = 109

 Score = 54.4 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILAFFFF 58
          +++++L+V + L+  IL+Q    +  G+S                + L R TAILA  FF
Sbjct: 1  MLIIYLVVSIALIAFILLQQGKGADAGASFGGGASGTVFGSAGAGNFLSRTTAILATVFF 60

Query: 59 ATSIALGMISRYTST 73
            SI +G I+ + + 
Sbjct: 61 IISIVIGNINSHRNN 75


>gi|307611660|emb|CBX01351.1| protein-export membrane protein secG [Legionella pneumophila
          130b]
          Length = 108

 Score = 54.0 bits (128), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFT--SVRSTAHSLGRFTAILA 54
          M   ++++H+++ V L+ ++LIQ        +AFGS ++ T    + T   L + T  LA
Sbjct: 1  MYQLILMIHVLIAVILIGLVLIQHGKGADIGAAFGSGASNTLFGSQGTGGFLFKLTGGLA 60

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF TS+ L  +    + +
Sbjct: 61 MTFFITSLMLSYMVSTQNQK 80


>gi|239816484|ref|YP_002945394.1| preprotein translocase subunit SecG [Variovorax paradoxus S110]
 gi|239803061|gb|ACS20128.1| preprotein translocase, SecG subunit [Variovorax paradoxus S110]
          Length = 137

 Score = 54.0 bits (128), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 42/101 (41%), Gaps = 6/101 (5%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
             L+ V ++  + ++ +ILIQ    +        GS+ +      +A+ L R TA+LA  
Sbjct: 6   NLLVGVQMLSALAMIGLILIQHGKGADMGAAFGSGSAGSLFGASGSANFLSRTTAVLAAV 65

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGD 97
           FFA ++ L   S          + R+ V +     +   G 
Sbjct: 66  FFACTLLLAYFSHARPAGGGSLLERAAVGTPATPASGAAGQ 106


>gi|323697870|ref|ZP_08109782.1| preprotein translocase, SecG subunit [Desulfovibrio sp. ND132]
 gi|323457802|gb|EGB13667.1| preprotein translocase, SecG subunit [Desulfovibrio desulfuricans
          ND132]
          Length = 116

 Score = 54.0 bits (128), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 38/86 (44%), Gaps = 4/86 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSS-DSSA--FGSSSNFT-SVRSTAHSLGRFTAILAFF 56
          M+  ++V+H++  + L+  +++QS  +     FG  S+           L + TA LA  
Sbjct: 1  METIVIVIHVLACIFLIGAVMLQSGHEGMGVIFGGGSSTMFGSTGAGGLLVKVTAGLATV 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRS 82
          F  TS+   +++    +     M + 
Sbjct: 61 FLLTSLGYNILTGNKVSNVDSIMLQQ 86


>gi|261379458|ref|ZP_05984031.1| preprotein translocase, SecG subunit [Neisseria subflava NJ9703]
 gi|284797913|gb|EFC53260.1| preprotein translocase, SecG subunit [Neisseria subflava NJ9703]
          Length = 119

 Score = 54.0 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 20/115 (17%), Positives = 47/115 (40%), Gaps = 9/115 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS--------AFGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5   KTLIWIINIISALFVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
           A FFFAT +A+  I    S+++  +           +      + ++P   +   
Sbjct: 65  ATFFFATCMAMVYI-HTHSSKHGLDFSDVKQTQQAPKPATPAQNNTTPVAPNPQQ 118


>gi|320355228|ref|YP_004196567.1| protein translocase subunit SecG [Desulfobulbus propionicus DSM
          2032]
 gi|320123730|gb|ADW19276.1| protein translocase subunit secG [Desulfobulbus propionicus DSM
          2032]
          Length = 124

 Score = 54.0 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA-----FGSSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+VVH+IV + L+C++L+Q    +       GSS +          L + T + A 
Sbjct: 1  MTTILIVVHVIVCLFLICIVLLQHGKGADIGASFGGSSQSLFGTEGPVPLLNKITTLAAI 60

Query: 56 FFFATSIALGMISRYTSTRY 75
           F  TS+ L  +S   S+  
Sbjct: 61 VFMGTSVTLAYLSANKSSGS 80


>gi|108761254|ref|YP_631035.1| preprotein translocase subunit SecG [Myxococcus xanthus DK 1622]
 gi|108465134|gb|ABF90319.1| preprotein translocase, SecG subunit [Myxococcus xanthus DK 1622]
          Length = 132

 Score = 53.6 bits (127), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 50/127 (39%), Gaps = 14/127 (11%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV------RSTAHSLGRFTAILA 54
           M  F+ +VH++V V ++ VIL+Q    +  GS+    +       R     L + T + A
Sbjct: 1   MLTFVTIVHVLVCVFMIFVILLQPGKDAGMGSALGGGAATSAFGGRGAVTFLSKLTGVFA 60

Query: 55  FFFFATSIALGMISRYTS--------TRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSV 106
             FF +S+ L  +   +S        +    +   +  D+         G+ S+P  +  
Sbjct: 61  ALFFFSSLGLSFVGLRSSVAAGGSVASPPAQSAPATSGDAAPGSMEQPRGEQSTPPAEGG 120

Query: 107 SAKSSSS 113
              ++  
Sbjct: 121 GNPATGE 127


>gi|289667381|ref|ZP_06488456.1| preprotein translocase subunit SecG [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 156

 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 20/116 (17%), Positives = 46/116 (39%), Gaps = 6/116 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           + + L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA
Sbjct: 2   LMLILNVVYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FF+ S+ +   + + +     N+      +              PK  + +  +
Sbjct: 62  VVFFSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAGELTQPLPKAPAGAVPT 117


>gi|254524736|ref|ZP_05136791.1| protein-export membrane protein [Stenotrophomonas sp. SKA14]
 gi|219722327|gb|EED40852.1| protein-export membrane protein [Stenotrophomonas sp. SKA14]
          Length = 145

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 6/83 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
          + + L VV+++V V ++ +IL+Q    +A GS             R  ++ L + T  LA
Sbjct: 2  LMLILNVVYVLVAVAMIALILMQRGSGAAAGSGFGAGASGTVFGARGASNFLSKSTKWLA 61

Query: 55 FFFFATSIALGMISRYTSTRYKD 77
            FF  S+ +   + + +    D
Sbjct: 62 VVFFGISLFMAWYAGHGTRPAAD 84


>gi|291288869|ref|YP_003505685.1| preprotein translocase, SecG subunit [Denitrovibrio acetiphilus
          DSM 12809]
 gi|290886029|gb|ADD69729.1| preprotein translocase, SecG subunit [Denitrovibrio acetiphilus
          DSM 12809]
          Length = 107

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 38/94 (40%), Gaps = 5/94 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV-----RSTAHSLGRFTAILAF 55
          M   ++ +HL V   L+  +L+Q+   S+ G++            +  + + R T ++A 
Sbjct: 1  MYTIILALHLFVCFLLILAVLLQAGKGSSLGAAFGGGQGDVFGPGAPVNIMNRITTVVAI 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKD 89
           F  TS+ L ++S   +T    +           
Sbjct: 61 LFMVTSLLLAVLSTQKTTNSVVDQFNVPAQQTVP 94


>gi|187251586|ref|YP_001876068.1| preprotein translocase subunit SecG [Elusimicrobium minutum
          Pei191]
 gi|186971746|gb|ACC98731.1| Pre-protein translocase, SecG subunit [Elusimicrobium minutum
          Pei191]
          Length = 100

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 43/99 (43%), Gaps = 6/99 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
          M   ++V+H +  + L+  +L+QS   SA G            +  +  + L RFTA++A
Sbjct: 1  MYTLILVIHFLACILLILSVLMQSGKGSAAGIFGGGGGSDALFAGPTAFNFLNRFTAVVA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
             F TSI L +++         +  +  V   +   N+
Sbjct: 61 ITLFCTSITLTVLTAKRGASSVVDNVKVPVTQTQPVNNN 99


>gi|261867518|ref|YP_003255440.1| preprotein translocase subunit SecG [Aggregatibacter
          actinomycetemcomitans D11S-1]
 gi|261412850|gb|ACX82221.1| protein-export membrane protein [Aggregatibacter
          actinomycetemcomitans D11S-1]
          Length = 112

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILAFFFF 58
          +++++L+V + L+  IL+Q    +  G+S                + L R TAILA  FF
Sbjct: 1  MLIIYLVVSIALIAFILLQQGKGADAGASFGGGASGTVFGSAGAGNFLSRTTAILATIFF 60

Query: 59 ATSIALGMISRYTST 73
            SI +G I+ + + 
Sbjct: 61 IISIVIGNINSHRNN 75


>gi|189184246|ref|YP_001938031.1| preprotein translocase subunit SecG [Orientia tsutsugamushi str.
          Ikeda]
 gi|189181017|dbj|BAG40797.1| protein-export membrane protein SecG [Orientia tsutsugamushi str.
          Ikeda]
          Length = 97

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 37/85 (43%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          M   L+ +H+++ V LV  IL+  + + +              + +++   L R   ILA
Sbjct: 1  MMNILLFIHIVISVLLVTAILLHKTGADSLSGLSGRNEGIGIVTSKASTSFLTRIIVILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  +I L  +S   +T   D +
Sbjct: 61 TCFFINAIILANLSSKKNTSITDKL 85


>gi|190575279|ref|YP_001973124.1| preprotein translocase subunit SecG [Stenotrophomonas maltophilia
          K279a]
 gi|190013201|emb|CAQ46834.1| putative general secretory pathway protein-export membrane
          protein [Stenotrophomonas maltophilia K279a]
          Length = 145

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 6/83 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
          + + L VV+++V V ++ +IL+Q    +A GS             R  ++ L + T  LA
Sbjct: 2  LMLILNVVYVLVAVAMIALILMQRGSGAAAGSGFGAGASGTVFGARGASNFLSKSTKWLA 61

Query: 55 FFFFATSIALGMISRYTSTRYKD 77
            FF  S+ +   + + S    D
Sbjct: 62 VVFFGISLFMAWYAGHGSRPAAD 84


>gi|285017791|ref|YP_003375502.1| protein-export membrane protein secg (preprotein translocase band
          1 subunit) (p12) [Xanthomonas albilineans GPE PC73]
 gi|283473009|emb|CBA15514.1| probable protein-export membrane protein secg (preprotein
          translocase band 1 subunit) (p12) [Xanthomonas
          albilineans]
          Length = 138

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 6/82 (7%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILAFFF 57
           L VV+++V + ++ +IL+Q    +A GS             R  ++ L + T  LA  F
Sbjct: 5  ILNVVYVLVAIAMIALILMQRGAGAAAGSGFGSGASGTVFGSRGASNFLSKTTKWLAVAF 64

Query: 58 FATSIALGMISRYTSTRYKDNM 79
          FA S+ +   + +++     N+
Sbjct: 65 FAISLFMAWYAAHSAQPADANL 86


>gi|325267827|ref|ZP_08134477.1| preprotein translocase subunit SecG [Kingella denitrificans ATCC
           33394]
 gi|324980708|gb|EGC16370.1| preprotein translocase subunit SecG [Kingella denitrificans ATCC
           33394]
          Length = 124

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 41/96 (42%), Gaps = 7/96 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDS-------SAFGSSSNFTSVRSTAHSLGRFTAILA 54
           +  + +V++   +G++ ++L+Q              GS+         A+ L R T++ A
Sbjct: 5   KNVIWIVNIFSSLGIIILVLMQHGKGADTGASFGGSGSAQGVFGSGGNANFLSRMTSLFA 64

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
             FF++ +ALG I   T  +   +       + + Q
Sbjct: 65  VIFFSSCLALGYIHSRTYGKGGMDFSDVKQSAPQTQ 100


>gi|117618966|ref|YP_857797.1| preprotein translocase, SecG subunit [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117560373|gb|ABK37321.1| preprotein translocase, SecG subunit [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 108

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 6/91 (6%)

Query: 17  VCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILAFFFFATSIALGMISRY 70
           + +++IQ    +    +FG+ ++ T      +   L R TAILA  FF  S+ LG +S  
Sbjct: 17  IGLVMIQQGKGADMGASFGAGASNTVFGSGGSGSFLTRTTAILATLFFLISLVLGSMSSN 76

Query: 71  TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
              +  +  +      ++        D   P
Sbjct: 77  KVKQGSEWENLQQTQQVEQSKAPVKKDTDVP 107


>gi|145638644|ref|ZP_01794253.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittII]
 gi|145272239|gb|EDK12147.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittII]
          Length = 71

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 6/64 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q         S   G+S          + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFF 58
            FF
Sbjct: 61 TAFF 64


>gi|78048410|ref|YP_364585.1| preprotein translocase subunit SecG [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78036840|emb|CAJ24533.1| preprotein translocase subunit SecG [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 157

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/114 (16%), Positives = 45/114 (39%), Gaps = 6/114 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           + + L V++++V + ++ +IL+Q    +A GS             +  ++ L + T  LA
Sbjct: 2   LMLILNVIYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF+ S+ +   + + +     N+      +              P+  +  A
Sbjct: 62  VVFFSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAGELTQPLPQAPAAGA 115


>gi|166712615|ref|ZP_02243822.1| preprotein translocase subunit SecG [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 157

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 45/114 (39%), Gaps = 6/114 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           + + L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA
Sbjct: 2   LMLILNVVYVLVALAMIALILMQRGAGAAAGSGFGAAASGTVFGSQGASNFLSKSTKWLA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF+ S+ +   + + +     N+      +              P+  +  A
Sbjct: 62  VVFFSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAGELTQPLPQAPAAGA 115


>gi|330830891|ref|YP_004393843.1| preprotein translocase subunit SecG [Aeromonas veronii B565]
 gi|328806027|gb|AEB51226.1| Preprotein translocase, SecG subunit [Aeromonas veronii B565]
          Length = 108

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 6/91 (6%)

Query: 17  VCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILAFFFFATSIALGMISRY 70
           + +++IQ    +    +FG+ ++ T      +   L R TAILA  FF  S+ LG +S  
Sbjct: 17  IGLVMIQQGKGADMGASFGAGASNTVFGSGGSGSFLTRTTAILATLFFVISLVLGSMSSN 76

Query: 71  TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
              +  +  +      ++        D   P
Sbjct: 77  KVKQGSEWENLQQTQQVEQTKAPVKKDTDVP 107


>gi|307565930|ref|ZP_07628389.1| preprotein translocase, SecG subunit [Prevotella amnii CRIS 21A-A]
 gi|307345358|gb|EFN90736.1| preprotein translocase, SecG subunit [Prevotella amnii CRIS 21A-A]
          Length = 122

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 44/117 (37%), Gaps = 5/117 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M    +V+ +++ + ++C++LIQ S        F SS+    VR T   + + T   A  
Sbjct: 1   MYTLFIVLIVVIALLMICIVLIQESKGGGLSSNFSSSNAIMGVRKTTDFVEKATWTFAAL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN-DNFGDGSSPKLDSVSAKSSS 112
               SIA   ++   ST        +  D   +  N  NFG     +       +  
Sbjct: 61  MVIISIASAYVAPTASTDESVIEKAATSDQPTNPNNLPNFGASQQKQAAPTKQAAPI 117


>gi|299066332|emb|CBJ37516.1| preprotein translocase membrane subunit [Ralstonia solanacearum
          CMR15]
          Length = 115

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 40/85 (47%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  L+V  ++  +G++ ++L+Q    +        G+S +      +A+ L R TAILA
Sbjct: 4  LKTLLLVAQILSALGVIGLVLLQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAILA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL ++           M
Sbjct: 64 TVFFIATLALTLLGTSKGNVSAGVM 88


>gi|154148365|ref|YP_001405964.1| preprotein translocase, SecG subunit [Campylobacter hominis ATCC
           BAA-381]
 gi|153804374|gb|ABS51381.1| preprotein translocase, SecG subunit [Campylobacter hominis ATCC
           BAA-381]
          Length = 109

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/110 (20%), Positives = 44/110 (40%), Gaps = 6/110 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M    +V+ +I  + +   +L+Q S S   G+ S         +  A  L +FTA++   
Sbjct: 1   MTTLFLVLQVIFTLVITVAVLLQKSTSIGLGAYSGSNESLFGAKGPAGFLAKFTAVMGIL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSV 106
           F   ++ALG    YT       +      +++ + + N  +   P +   
Sbjct: 61  FVLNTLALGYY--YTKDSKSSVLDNVDTGALEIKEDQNKSEPFVPLVPDA 108


>gi|114569957|ref|YP_756637.1| protein translocase subunit SecG [Maricaulis maris MCS10]
 gi|114340419|gb|ABI65699.1| protein translocase subunit secG [Maricaulis maris MCS10]
          Length = 112

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 42/103 (40%), Gaps = 5/103 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRSTAHSLGRFTAILAF 55
           M   L+++ L+V +GL+ VIL+Q S+         G      S R  A+ L R T IL  
Sbjct: 5   MTTVLLIIQLLVALGLIGVILLQRSEGGALGIGGGGGGGGMMSGRGAANILTRTTMILGA 64

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
            F   SI L +++  T+             +I     D  G  
Sbjct: 65  VFIGNSILLAIVTGVTAEGTSVFDTEIDNPAIGVIEQDESGAP 107


>gi|257456480|ref|ZP_05621676.1| preprotein translocase subunit SecG [Treponema vincentii ATCC
           35580]
 gi|257446140|gb|EEV21187.1| preprotein translocase subunit SecG [Treponema vincentii ATCC
           35580]
          Length = 132

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 45/122 (36%), Gaps = 8/122 (6%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDS---SAFGSSSNFTSVRS-TAHSLGRFTAILAFFFF 58
           I L+V  +IV   +V ++L+Q+ +        S  + ++  S + + L R T  L   FF
Sbjct: 6   IALLVFFIIVAFLIVGLVLLQNEEGDSLGGLFSGGSNSAFGSRSGNILTRATYTLITLFF 65

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
             +  L  +    +    D+  +      + +    +    +P  +      ++  V   
Sbjct: 66  VVTFFLAWL----NKTPGDSGLQQDAQLQQAETATEWWKEGTPNSNETGNTENTETVPQS 121

Query: 119 RS 120
             
Sbjct: 122 SE 123


>gi|152980118|ref|YP_001353151.1| preprotein translocase SecG subunit [Janthinobacterium sp.
          Marseille]
 gi|151280195|gb|ABR88605.1| preprotein translocase SecG subunit [Janthinobacterium sp.
          Marseille]
          Length = 128

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 40/92 (43%), Gaps = 6/92 (6%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
             ++VV ++  + ++ ++L+Q    +        G+S +      +++ L +FT + A 
Sbjct: 5  HTIIVVVQVLSALTIIGLVLLQHGKGADMGASFGSGASGSLFGATGSSNFLSKFTGVAAV 64

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSI 87
           FF+ ++ L  I    +T     M      ++
Sbjct: 65 IFFSATLGLAFIGNKPATPSAGVMENLPASAV 96


>gi|296136707|ref|YP_003643949.1| preprotein translocase, SecG subunit [Thiomonas intermedia K12]
 gi|294340862|emb|CAZ89257.1| putative Preprotein translocase SecG subunit [Thiomonas sp. 3As]
 gi|295796829|gb|ADG31619.1| preprotein translocase, SecG subunit [Thiomonas intermedia K12]
          Length = 141

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 46/128 (35%), Gaps = 7/128 (5%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
              +VV ++  + ++ ++L+Q    +        G+S +      +A+ L R TA+ A  
Sbjct: 6   TLTLVVQILSALVMIVLVLMQHGKGADMGASFGSGASGSLFGATGSANFLSRSTAVAATL 65

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           FF T++ +       +      +   L               + P  +     S+ S  +
Sbjct: 66  FFVTTLMMAYFGN-RANSGDGGLMEKLAAPAPVASVAAPAKPAGPISEIPGVPSAVSKAS 124

Query: 117 GKRSSSRT 124
              +  +T
Sbjct: 125 QATTQPKT 132


>gi|224438527|ref|ZP_03659447.1| preprotein translocase subunit SecG [Helicobacter cinaedi CCUG
           18818]
 gi|313144954|ref|ZP_07807147.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
 gi|313129985|gb|EFR47602.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
          Length = 131

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 49/128 (38%), Gaps = 4/128 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M   L VV +++ + +  ++L+Q S S   G+ S         +  A  L +FT  L   
Sbjct: 1   MTTTLFVVQIVLAIFITIMVLLQKSSSIGLGAYSGSNESVFGAKGPAGFLAKFTMFLGLL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           F   +IAL       + +   +   S       Q  D   + ++  +D  +A ++  V  
Sbjct: 61  FVLNTIALSYSYNKQTEKSILDSLPSTQAPTTPQTADTATNPNAFIVDENAAPTAPLVAP 120

Query: 117 GKRSSSRT 124
              S +  
Sbjct: 121 LDSSQNNQ 128


>gi|257424899|ref|ZP_05601326.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 55/2053]
 gi|257427567|ref|ZP_05603966.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 65-1322]
 gi|257430198|ref|ZP_05606582.1| preprotein translocase [Staphylococcus aureus subsp. aureus
          68-397]
 gi|257432899|ref|ZP_05609259.1| preprotein translocase [Staphylococcus aureus subsp. aureus
          E1410]
 gi|257435803|ref|ZP_05611851.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus M876]
 gi|257794900|ref|ZP_05643879.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A9781]
 gi|258418217|ref|ZP_05682482.1| preprotein translocase subunit SecG [Staphylococcus aureus A9763]
 gi|258421514|ref|ZP_05684439.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A9719]
 gi|258423428|ref|ZP_05686319.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A9635]
 gi|258439143|ref|ZP_05690187.1| translocase [Staphylococcus aureus A9299]
 gi|258440929|ref|ZP_05690764.1| translocase [Staphylococcus aureus A8115]
 gi|258445759|ref|ZP_05693936.1| preprotein translocase [Staphylococcus aureus A6300]
 gi|258449571|ref|ZP_05697673.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A6224]
 gi|282895074|ref|ZP_06303295.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A8117]
 gi|282903410|ref|ZP_06311301.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus C160]
 gi|282905189|ref|ZP_06313046.1| preprotein translocase SecG subunit [Staphylococcus aureus subsp.
          aureus Btn1260]
 gi|282908168|ref|ZP_06315999.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus WW2703/97]
 gi|282910426|ref|ZP_06318230.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus WBG10049]
 gi|282913622|ref|ZP_06321411.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus M899]
 gi|282916122|ref|ZP_06323885.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus D139]
 gi|282918573|ref|ZP_06326310.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus C427]
 gi|282922077|ref|ZP_06329774.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A9765]
 gi|282923539|ref|ZP_06331219.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus C101]
 gi|282926646|ref|ZP_06334276.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A10102]
 gi|283769942|ref|ZP_06342834.1| protein-export membrane protein secG [Staphylococcus aureus
          subsp. aureus H19]
 gi|283957612|ref|ZP_06375065.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus A017934/97]
 gi|293500664|ref|ZP_06666515.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 58-424]
 gi|293509613|ref|ZP_06668324.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus M809]
 gi|293524199|ref|ZP_06670886.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus M1015]
 gi|87127136|gb|ABD21650.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus USA300_FPR3757]
 gi|87202119|gb|ABD29929.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus NCTC 8325]
 gi|257272469|gb|EEV04592.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 55/2053]
 gi|257275760|gb|EEV07233.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 65-1322]
 gi|257279395|gb|EEV09996.1| preprotein translocase [Staphylococcus aureus subsp. aureus
          68-397]
 gi|257282314|gb|EEV12449.1| preprotein translocase [Staphylococcus aureus subsp. aureus
          E1410]
 gi|257284994|gb|EEV15113.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus M876]
 gi|257788872|gb|EEV27212.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A9781]
 gi|257839010|gb|EEV63489.1| preprotein translocase subunit SecG [Staphylococcus aureus A9763]
 gi|257842440|gb|EEV66864.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A9719]
 gi|257846489|gb|EEV70512.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A9635]
 gi|257847715|gb|EEV71712.1| translocase [Staphylococcus aureus A9299]
 gi|257852443|gb|EEV76364.1| translocase [Staphylococcus aureus A8115]
 gi|257855335|gb|EEV78273.1| preprotein translocase [Staphylococcus aureus A6300]
 gi|257857079|gb|EEV79978.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A6224]
 gi|282314407|gb|EFB44797.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus C101]
 gi|282317707|gb|EFB48079.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus C427]
 gi|282320070|gb|EFB50417.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus D139]
 gi|282322654|gb|EFB52976.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus M899]
 gi|282325818|gb|EFB56126.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus WBG10049]
 gi|282327833|gb|EFB58115.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus WW2703/97]
 gi|282331596|gb|EFB61108.1| preprotein translocase SecG subunit [Staphylococcus aureus subsp.
          aureus Btn1260]
 gi|282591539|gb|EFB96611.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A10102]
 gi|282593735|gb|EFB98727.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A9765]
 gi|282596365|gb|EFC01326.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus C160]
 gi|282762570|gb|EFC02709.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A8117]
 gi|283460089|gb|EFC07179.1| protein-export membrane protein secG [Staphylococcus aureus
          subsp. aureus H19]
 gi|283791063|gb|EFC29878.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus A017934/97]
 gi|290921162|gb|EFD98223.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus M1015]
 gi|291095669|gb|EFE25930.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 58-424]
 gi|291467710|gb|EFF10225.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus M809]
          Length = 91

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 32/76 (42%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          M  FL+V+ +I  + L+ V+L+Q   SS    + +            R     L R T I
Sbjct: 15 MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII 74

Query: 53 LAFFFFATSIALGMIS 68
          L+  FF   I +  + 
Sbjct: 75 LSILFFVLMICISYLG 90


>gi|121604329|ref|YP_981658.1| preprotein translocase subunit SecG [Polaromonas naphthalenivorans
           CJ2]
 gi|120593298|gb|ABM36737.1| protein translocase subunit secG [Polaromonas naphthalenivorans
           CJ2]
          Length = 136

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 49/131 (37%), Gaps = 8/131 (6%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
             ++ V ++  +G++ +IL+Q    +        G S +      +A+ L R T ILA  
Sbjct: 6   TAVLAVQMLSALGMIGLILVQHGKGADMGAAFGSGGSGSLFGASGSANFLSRTTGILAAL 65

Query: 57  FFATSIALGMISRYTSTRYKDNMH--RSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
           FFA ++ L              +     +  +I   G       ++P   +V A    ++
Sbjct: 66  FFACTLMLAYFGNAQPRTSSSVLEGAAVIAPAIPASGAAQIPGNTAPATTAVEAPVPPAI 125

Query: 115 VAGKRSSSRTK 125
            A       TK
Sbjct: 126 PASGAVQIPTK 136


>gi|212702543|ref|ZP_03310671.1| hypothetical protein DESPIG_00562 [Desulfovibrio piger ATCC
          29098]
 gi|212673984|gb|EEB34467.1| hypothetical protein DESPIG_00562 [Desulfovibrio piger ATCC
          29098]
          Length = 156

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 4/88 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSS-DSSAFGSSSNFTS---VRSTAHSLGRFTAILAFF 56
          MQ  ++ +H+IV V LV +IL+Q+  +          TS          L + TA +A  
Sbjct: 1  MQTLILTLHIIVCVVLVILILLQAGKEGMGVIFGGGNTSVFGSSGAGGMLAKMTAFMAVV 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLV 84
          F  TS++   ++    +     +    +
Sbjct: 61 FVVTSLSYTYVTSSRPSDESAVLKVEPL 88


>gi|121634200|ref|YP_974445.1| preprotein translocase subunit SecG [Neisseria meningitidis FAM18]
 gi|161869327|ref|YP_001598494.1| preprotein translocase subunit SecG [Neisseria meningitidis 053442]
 gi|120865906|emb|CAM09643.1| putative protein-export integral membrane protein [Neisseria
           meningitidis FAM18]
 gi|161594880|gb|ABX72540.1| protein-export integral membrane protein [Neisseria meningitidis
           053442]
 gi|325131529|gb|EGC54236.1| preprotein translocase, SecG subunit [Neisseria meningitidis M6190]
 gi|325139217|gb|EGC61763.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           ES14902]
 gi|325141582|gb|EGC64048.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           961-5945]
 gi|325197614|gb|ADY93070.1| preprotein translocase, SecG subunit [Neisseria meningitidis G2136]
          Length = 116

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/108 (20%), Positives = 44/108 (40%), Gaps = 8/108 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS--------AFGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + +V++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5   KTLIWIVNIISALAVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
           A FFFAT +A+  I  +T+    D  +           ++       P
Sbjct: 65  ATFFFATCMAMVYIHTHTTKYGLDFSNVQQTQQAPKPISNTEPSAPVP 112


>gi|15677723|ref|NP_274884.1| preprotein translocase subunit SecG [Neisseria meningitidis MC58]
 gi|218767534|ref|YP_002342046.1| preprotein translocase subunit SecG [Neisseria meningitidis Z2491]
 gi|254804290|ref|YP_003082511.1| preprotein translocase SecG subunit [Neisseria meningitidis
           alpha14]
 gi|304388432|ref|ZP_07370538.1| preprotein translocase subunit SecG [Neisseria meningitidis ATCC
           13091]
 gi|7227147|gb|AAF42222.1| protein-export membrane protein SecG [Neisseria meningitidis MC58]
 gi|121051542|emb|CAM07840.1| putative protein-export integral membrane protein [Neisseria
           meningitidis Z2491]
 gi|254667832|emb|CBA03834.1| preprotein translocase SecG subunit [Neisseria meningitidis
           alpha14]
 gi|254673861|emb|CBA09641.1| preprotein translocase SecG subunit [Neisseria meningitidis
           alpha275]
 gi|261393225|emb|CAX50844.1| preprotein translocase SecG subunit [Neisseria meningitidis 8013]
 gi|304337549|gb|EFM03712.1| preprotein translocase subunit SecG [Neisseria meningitidis ATCC
           13091]
 gi|308389985|gb|ADO32305.1| preprotein translocase subunit SecG [Neisseria meningitidis
           alpha710]
 gi|316985503|gb|EFV64450.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           H44/76]
 gi|319409798|emb|CBY90106.1| preprotein translocase SecG subunit [Neisseria meningitidis WUE
           2594]
 gi|325127464|gb|EGC50393.1| preprotein translocase, SecG subunit [Neisseria meningitidis N1568]
 gi|325129504|gb|EGC52332.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           OX99.30304]
 gi|325133531|gb|EGC56194.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           M13399]
 gi|325135482|gb|EGC58100.1| preprotein translocase, SecG subunit [Neisseria meningitidis M0579]
 gi|325139545|gb|EGC62085.1| preprotein translocase, SecG subunit [Neisseria meningitidis CU385]
 gi|325143781|gb|EGC66098.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           M01-240013]
 gi|325200943|gb|ADY96398.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           H44/76]
 gi|325201474|gb|ADY96928.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           M01-240149]
 gi|325204842|gb|ADZ00296.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           M01-240355]
 gi|325206798|gb|ADZ02251.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           M04-240196]
 gi|325207454|gb|ADZ02906.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           NZ-05/33]
          Length = 116

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/108 (20%), Positives = 44/108 (40%), Gaps = 8/108 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS--------AFGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + +V++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5   KTLIWIVNIISALAVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
           A FFFAT +A+  I  +T+    D  +           ++       P
Sbjct: 65  ATFFFATCMAMVYIHTHTTKHGLDFSNVQQTQQAPKPVSNTEPSAPVP 112


>gi|332041816|gb|EGI78165.1| preprotein translocase subunit SecG [Hylemonella gracilis ATCC
           19624]
          Length = 138

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 44/115 (38%), Gaps = 6/115 (5%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
             L+ V +I  + ++ ++LIQ    +        GSS +      +A+ L R TA+LA  
Sbjct: 6   TLLVTVQIITALVMIGLVLIQHGKGADMGAAFGSGSSGSLFGASGSANFLSRTTAVLATV 65

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
           FFA ++AL        T     +            N     G +P   + S  + 
Sbjct: 66  FFAVTLALAYFGNARPTSSGSVLEGPAAVVPASSENAAQIPGGAPAASAESQVAP 120


>gi|328543805|ref|YP_004303914.1| hypothetical protein SL003B_2187 [Polymorphum gilvum SL003B-26A1]
 gi|326413549|gb|ADZ70612.1| hypothetical protein SL003B_2187 [Polymorphum gilvum SL003B-26A1]
          Length = 128

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 5/92 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M+  ++V+HL+VV+ LV V+L+Q S+        GS   F S R TA+ L R TA+LA  
Sbjct: 1  METVVIVIHLMVVLALVLVVLLQRSEGGALGMGGGSGGGFMSSRGTANVLTRATAVLAVV 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
          FFATSIAL +I++ T  R    +         
Sbjct: 61 FFATSIALSLIAK-TGDRPSSILDAVPTAGES 91


>gi|85703176|ref|ZP_01034280.1| preprotein translocase, SecG subunit [Roseovarius sp. 217]
 gi|85672104|gb|EAQ26961.1| preprotein translocase, SecG subunit [Roseovarius sp. 217]
          Length = 120

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 52/119 (43%), Gaps = 5/119 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           M+  ++ +HL++ + L+ V+L+Q S+       G      + R+ A +LG+ T ILA  F
Sbjct: 1   MENVVLTIHLLLALALIGVVLLQRSEGGGLGMGGGGGGAMTGRAAATALGKMTWILAASF 60

Query: 58  FATSIALGMISRYTSTRYK--DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             TSI L +I+   +      D +  S   + +        D   P     +A  + + 
Sbjct: 61  IVTSITLTIIAAQNAAGVSVLDRLTDSPPTTEQSVPALPDADSLLPPPSGDTAPLTPTA 119


>gi|329850641|ref|ZP_08265486.1| preprotein translocase, SecG subunit [Asticcacaulis biprosthecum
          C19]
 gi|328840956|gb|EGF90527.1| preprotein translocase, SecG subunit [Asticcacaulis biprosthecum
          C19]
          Length = 221

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 3/87 (3%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT---SVRSTAHSLGRFTAILAFFFFAT 60
           L+ + ++V + L  ++LIQ S+  A G         S R   + L + T++L   FFA 
Sbjct: 5  ILLTIQILVCLALGGLVLIQRSEGGALGMGGGPAGLVSARGAGNLLTKATSVLGILFFAL 64

Query: 61 SIALGMISRYTSTRYKDNMHRSLVDSI 87
          +IA+ ++    S R + +   SL  S 
Sbjct: 65 AIAMTIVGNIESRRERASALESLDTSG 91


>gi|161485710|ref|NP_643015.2| preprotein translocase subunit SecG [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 157

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 45/114 (39%), Gaps = 6/114 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           + + L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA
Sbjct: 2   LMLILNVVYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF+ S+ +   + + +     N+      +              P+  +  A
Sbjct: 62  VVFFSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAGELTQPLPQAPAAGA 115


>gi|33591973|ref|NP_879617.1| preprotein translocase subunit SecG [Bordetella pertussis Tohama I]
 gi|33571617|emb|CAE41107.1| protein-export membrane protein [Bordetella pertussis Tohama I]
          Length = 148

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/111 (16%), Positives = 35/111 (31%), Gaps = 9/111 (8%)

Query: 15  GLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMIS 68
            ++ ++L+Q    +        GS+ +       A+ L R T   A  FF ++  L  ++
Sbjct: 18  AIIVLVLLQQGKGADMGSAFGSGSAGSLFGATGAANFLSRTTKWAAVVFFVSTAGLAYVT 77

Query: 69  RYTSTRY---KDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               +        M     D    Q   +   GS   +         +  A
Sbjct: 78  HKGPSGPAIDSGVMQNFPQDRSVPQAPGSAPAGSGSSVPQAPGSGVPAAPA 128


>gi|187929294|ref|YP_001899781.1| preprotein translocase subunit SecG [Ralstonia pickettii 12J]
 gi|187726184|gb|ACD27349.1| preprotein translocase, SecG subunit [Ralstonia pickettii 12J]
          Length = 120

 Score = 52.5 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  L+V  ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLLLVAQILSALGVIGLVLLQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTS 72
            FF  ++AL +I     
Sbjct: 64 TVFFVATLALTLIGTNKG 81


>gi|145630377|ref|ZP_01786158.1| preprotein translocase subunit SecG [Haemophilus influenzae
          R3021]
 gi|144984112|gb|EDJ91549.1| preprotein translocase subunit SecG [Haemophilus influenzae
          R3021]
          Length = 71

 Score = 52.1 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 6/65 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q         S   G+S          + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFA 59
            FF 
Sbjct: 61 TAFFV 65


>gi|145298041|ref|YP_001140882.1| preprotein translocase subunit SecG [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850813|gb|ABO89134.1| Preprotein translocase subunit SecG [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 108

 Score = 52.1 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 39/91 (42%), Gaps = 6/91 (6%)

Query: 17  VCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILAFFFFATSIALGMISRY 70
           + +++IQ    +    +FG+ ++ T      +   L R TA+LA  FF  S+ LG +S +
Sbjct: 17  IGLVMIQQGKGADMGASFGAGASNTVFGSGGSGSFLTRTTAVLATLFFLVSLVLGSMSSH 76

Query: 71  TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
              +  +  +    + ++        D   P
Sbjct: 77  KVKQGSEWENLQQTEQVEQTKAPVNKDTDVP 107


>gi|152995055|ref|YP_001339890.1| preprotein translocase subunit SecG [Marinomonas sp. MWYL1]
 gi|150835979|gb|ABR69955.1| preprotein translocase, SecG subunit [Marinomonas sp. MWYL1]
          Length = 117

 Score = 52.1 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/89 (19%), Positives = 38/89 (42%), Gaps = 6/89 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS------TAHSLGRFTAILA 54
          M+  ++V+H++  V ++ ++L+Q    +  G+S    + ++           G+ TA+ A
Sbjct: 1  MEALILVLHVLAAVVIIALVLLQQGKGADAGASFGGGASQTVFGSQGGGSFFGKMTAVFA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSL 83
            FF TS  L   +   +      +    
Sbjct: 61 LVFFLTSFGLAYFASEQAKSVSGALDFVP 89


>gi|296274576|ref|YP_003657207.1| preprotein translocase subunit SecG [Arcobacter nitrofigilis DSM
           7299]
 gi|296098750|gb|ADG94700.1| preprotein translocase, SecG subunit [Arcobacter nitrofigilis DSM
           7299]
          Length = 128

 Score = 52.1 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 43/121 (35%), Gaps = 6/121 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M   L+VV  I+ V L   IL+Q S S   G+ S         +   + L + T +L   
Sbjct: 1   MTSTLLVVQFILAVLLTICILLQKSSSMGLGAYSGSNESLFGAKGPGNFLTKATMVLGLI 60

Query: 57  FFATSIALGMISRYTSTRY--KDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
           F   ++ LG        R    +    SL+    ++        +       +A +  +V
Sbjct: 61  FVLNTLVLGYFYNENRQRSAVDNVQTESLIPKTPEKAQAPAAPAAPVAPAEKTAPTVPAV 120

Query: 115 V 115
            
Sbjct: 121 P 121


>gi|325921412|ref|ZP_08183269.1| protein translocase subunit secG [Xanthomonas gardneri ATCC 19865]
 gi|325548170|gb|EGD19167.1| protein translocase subunit secG [Xanthomonas gardneri ATCC 19865]
          Length = 157

 Score = 52.1 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 45/114 (39%), Gaps = 6/114 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           + + L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA
Sbjct: 2   LMLILNVVYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF+ S+ +   + + +     N+      +              P+  +  A
Sbjct: 62  VVFFSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAGELTQPLPQAPAAGA 115


>gi|315919822|ref|ZP_07916062.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313693697|gb|EFS30532.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 130

 Score = 52.1 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/128 (16%), Positives = 47/128 (36%), Gaps = 4/128 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS----SNFTSVRSTAHSLGRFTAILAFF 56
           M +  +++ +I  + +  ++LIQ+S      S     +    VR T   L + T  LA F
Sbjct: 1   MYLLFVILMVIAALLMCFIVLIQNSKGGGLASGFSSSNAIMGVRKTTDFLEKATWGLAIF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               SIA   +   ++      + ++  +   +  N   G  +       +   ++   A
Sbjct: 61  MVVMSIATAYVVPRSAVVKDAVLEQAQKEQQTNPYNLPAGTAAPQTEAPATNAPATETPA 120

Query: 117 GKRSSSRT 124
              + +  
Sbjct: 121 PAETPAPK 128


>gi|15836907|ref|NP_297595.1| preprotein translocase subunit SecG [Xylella fastidiosa 9a5c]
 gi|9105125|gb|AAF83115.1|AE003883_10 protein-export membrane protein [Xylella fastidiosa 9a5c]
          Length = 132

 Score = 52.1 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 51/125 (40%), Gaps = 8/125 (6%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILAFFF 57
            L V++++V + ++ +IL+Q    +A GS             R  ++ L + T  LA  F
Sbjct: 3   LLNVIYVLVAIAMIVLILMQRGTGAAAGSGFGAGASGTVFGSRGASNFLSKSTKWLAVVF 62

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           F  S+ +   +      +      SL+  +           +SP L   +  +S++  AG
Sbjct: 63  FGISLFMAWYASRG--HHAVAQQNSLMTEVPAAPAAGADQAASPVLQVPAVPASTNTPAG 120

Query: 118 KRSSS 122
            +  +
Sbjct: 121 DKEKA 125


>gi|167901990|ref|ZP_02489195.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          NCTC 13177]
          Length = 112

 Score = 52.1 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 11 IVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIAL 64
          +  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA  FF  ++AL
Sbjct: 1  MSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLATIFFVATLAL 60

Query: 65 GMISRYTSTRYKDNM 79
            +  Y S      +
Sbjct: 61 TYLGSYKSAPSVGVL 75


>gi|167718842|ref|ZP_02402078.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          DM98]
 gi|167845003|ref|ZP_02470511.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          B7210]
          Length = 112

 Score = 52.1 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 11 IVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIAL 64
          +  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA  FF  ++AL
Sbjct: 1  MSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLATIFFVATLAL 60

Query: 65 GMISRYTSTRYKDNM 79
            +  Y S      +
Sbjct: 61 TYLGSYKSAPSVGVL 75


>gi|218779204|ref|YP_002430522.1| preprotein translocase, SecG subunit [Desulfatibacillum
          alkenivorans AK-01]
 gi|218760588|gb|ACL03054.1| preprotein translocase, SecG subunit [Desulfatibacillum
          alkenivorans AK-01]
          Length = 155

 Score = 52.1 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 6/92 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRST--AHSLGRFTAILA 54
          M I + V+H++V + L+ ++L+Q+       +AFG  S+ T   S+  A  L + T + A
Sbjct: 7  MTILVTVIHIVVCIALILIVLLQTGKGADMGAAFGGGSSQTVFGSSGPAGFLSKGTTVAA 66

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDS 86
            F  TS+ L + S     R          + 
Sbjct: 67 VLFMCTSLFLAIPSDSAMERRAVAPEPITQEE 98


>gi|319941419|ref|ZP_08015747.1| translocase subunit secG [Sutterella wadsworthensis 3_1_45B]
 gi|319805039|gb|EFW01869.1| translocase subunit secG [Sutterella wadsworthensis 3_1_45B]
          Length = 119

 Score = 52.1 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 44/113 (38%), Gaps = 6/113 (5%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
              +V+ +I  V ++ ++L+Q    +        G+S +      +A+ L R TAI A  
Sbjct: 6   SIALVLQIISAVVVIVLVLMQHGKGADLGAAFGSGASGSVFGATGSANFLSRSTAIAATV 65

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
           FF ++IAL + S   + R        L    +    +    G + K       
Sbjct: 66  FFCSTIALTLASGAFNKRSAQPEGGVLSTIEQPASQEQGMAGDANKSPVNQIP 118


>gi|58582860|ref|YP_201876.1| preprotein translocase subunit SecG [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|162319797|ref|YP_452097.2| preprotein translocase subunit SecG [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|58427454|gb|AAW76491.1| protein-export membrane protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 153

 Score = 52.1 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 46/114 (40%), Gaps = 6/114 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           + + L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA
Sbjct: 2   LMLILNVVYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF+ S+ +   + + +     N+      ++             P+  +  A
Sbjct: 62  VVFFSISLFMAWYATHGARPTDQNLGVMSQSAMPAPAAAGELTQPLPQAPAAGA 115


>gi|254440645|ref|ZP_05054138.1| preprotein translocase, SecG subunit, putative [Octadecabacter
           antarcticus 307]
 gi|198250723|gb|EDY75038.1| preprotein translocase, SecG subunit, putative [Octadecabacter
           antarcticus 307]
          Length = 122

 Score = 52.1 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 43/103 (41%), Gaps = 4/103 (3%)

Query: 17  VCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTS 72
           + V+L+Q S+    G          S RS A +LG+ T +LA  F  TS+AL ++S   +
Sbjct: 17  IGVVLLQRSEGGGLGIGGGGGGGAMSSRSAATALGKVTWVLAVAFICTSLALTILSAQKA 76

Query: 73  TRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
           +        +L+ S +   +   G GS        +     V 
Sbjct: 77  SDASVVGGDALLPSSEQSSDAPSGAGSLLPPVVTPSSDEPLVP 119


>gi|171463525|ref|YP_001797638.1| preprotein translocase, SecG subunit [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171193063|gb|ACB44024.1| preprotein translocase, SecG subunit [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 114

 Score = 52.1 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/109 (16%), Positives = 39/109 (35%), Gaps = 6/109 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAF 55
           +  L+V+ +I  + ++ ++L+Q    +        G+S +      +A+ L R TAI A 
Sbjct: 5   KTLLIVLQVISALAVILLVLLQQGKGADMGAAFGSGASGSLFGASGSANFLSRATAIFAA 64

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
            FF  ++ +  +                  +          D   P + 
Sbjct: 65  VFFICTLGITWLGNKKEVSPGVLSGTVAPAAAPAAPVAPVQDPIKPAVP 113


>gi|325924674|ref|ZP_08186112.1| protein translocase subunit secG [Xanthomonas perforans 91-118]
 gi|325544880|gb|EGD16225.1| protein translocase subunit secG [Xanthomonas perforans 91-118]
          Length = 157

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 45/114 (39%), Gaps = 6/114 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           + + L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA
Sbjct: 2   LMLILNVVYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF+ S+ +   + + +     N+      +              P+  +  A
Sbjct: 62  VVFFSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAGELTQPLPQAPAAGA 115


>gi|254454511|ref|ZP_05067948.1| preprotein translocase, SecG subunit [Octadecabacter antarcticus
           238]
 gi|198268917|gb|EDY93187.1| preprotein translocase, SecG subunit [Octadecabacter antarcticus
           238]
          Length = 122

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 42/103 (40%), Gaps = 4/103 (3%)

Query: 17  VCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTS 72
           + V+L+Q S     G          S RS A +LG+ T +LA  F  TS+AL ++S   +
Sbjct: 17  IGVVLLQRSQGGGLGIGGGGGGGAMSSRSAATALGKITWVLAIAFICTSLALTILSAQKA 76

Query: 73  TRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
           +        +L+ + +   +     GS        A +   V 
Sbjct: 77  SDASVVGGDALLPASEQSTDAPSAAGSLLPPTVAPASNDPLVP 119


>gi|171058184|ref|YP_001790533.1| preprotein translocase subunit SecG [Leptothrix cholodnii SP-6]
 gi|170775629|gb|ACB33768.1| preprotein translocase, SecG subunit [Leptothrix cholodnii SP-6]
          Length = 133

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          +   +++  L+  + ++ ++L+Q    +        G+S +      +A+ L R TAI A
Sbjct: 4  LMNLMLLTQLVSAIAMIGLVLVQHGKGADMGASFGGGASGSLFGATGSANFLSRSTAICA 63

Query: 55 FFFFATSIALGMISRYTST 73
            FF  ++AL   S    T
Sbjct: 64 AVFFTCTLALAYFSNARGT 82


>gi|161485692|ref|NP_637878.2| preprotein translocase subunit SecG [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|162017104|ref|YP_242674.2| preprotein translocase subunit SecG [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188991028|ref|YP_001903038.1| preprotein translocase subunit SecG [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167732788|emb|CAP50982.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 162

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 45/114 (39%), Gaps = 6/114 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           + + L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA
Sbjct: 2   LMLILNVVYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF+ S+ +   + + +     N+      +              P+  +  A
Sbjct: 62  VVFFSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAGELTQPLPQAPAAGA 115


>gi|296113983|ref|YP_003627921.1| protein translocase subunit SecG [Moraxella catarrhalis RH4]
 gi|295921677|gb|ADG62028.1| protein translocase subunit SecG [Moraxella catarrhalis RH4]
 gi|326559305|gb|EGE09732.1| preprotein translocase subunit SecG [Moraxella catarrhalis 7169]
 gi|326564319|gb|EGE14549.1| preprotein translocase subunit SecG [Moraxella catarrhalis
          103P14B1]
 gi|326565084|gb|EGE15277.1| preprotein translocase subunit SecG [Moraxella catarrhalis
          46P47B1]
 gi|326567252|gb|EGE17372.1| preprotein translocase subunit SecG [Moraxella catarrhalis
          12P80B1]
 gi|326568242|gb|EGE18324.1| preprotein translocase subunit SecG [Moraxella catarrhalis BC8]
 gi|326569943|gb|EGE19990.1| preprotein translocase subunit SecG [Moraxella catarrhalis BC1]
 gi|326570021|gb|EGE20067.1| preprotein translocase subunit SecG [Moraxella catarrhalis BC7]
 gi|326572879|gb|EGE22864.1| preprotein translocase subunit SecG [Moraxella catarrhalis CO72]
 gi|326573673|gb|EGE23631.1| preprotein translocase subunit SecG [Moraxella catarrhalis O35E]
 gi|326574704|gb|EGE24640.1| preprotein translocase subunit SecG [Moraxella catarrhalis
          101P30B1]
          Length = 100

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 6/80 (7%)

Query: 16 LVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILAFFFFATSIALGMISR 69
          +V  ILIQ    +    +FGS +  T      +A+ L R TA+LA  FFATS+AL   ++
Sbjct: 16 MVGFILIQHGKGADAGASFGSGAAGTVFGAAGSANFLTRTTAVLATIFFATSLALAHFAQ 75

Query: 70 YTSTRYKDNMHRSLVDSIKD 89
            +         ++V    +
Sbjct: 76 KQAEDQLRLDVPAVVSETPN 95


>gi|117925181|ref|YP_865798.1| protein translocase subunit secG [Magnetococcus sp. MC-1]
 gi|117608937|gb|ABK44392.1| protein translocase subunit secG [Magnetococcus sp. MC-1]
          Length = 124

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 53/128 (41%), Gaps = 12/128 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M + + V+H++  + L+ V+L+Q    +        GSS +          +G+FTA +A
Sbjct: 1   MTLLITVLHVMACLILISVVLLQKGSGTDMGAAFGGGSSQSVFGASGGGSFMGKFTAGVA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             F  +S+ L  IS   S         S++D +K          ++P+L  V  ++    
Sbjct: 61  AIFLLSSMTLTFISTKGSNAS------SVMDGVKAPTAQEQKLPAAPELPLVPKEAKPVE 114

Query: 115 VAGKRSSS 122
             G +   
Sbjct: 115 NTGSKPIP 122


>gi|187479131|ref|YP_787156.1| preprotein translocase subunit SecG [Bordetella avium 197N]
 gi|115423718|emb|CAJ50268.1| protein-export membrane protein [Bordetella avium 197N]
          Length = 142

 Score = 51.7 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 50/133 (37%), Gaps = 11/133 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV +I  + +V ++L+Q    +        GS+ +       A+ L R T   A
Sbjct: 4   MLTILLVVQVISALTIVVLVLLQQGKGADMGSSFGSGSAGSLFGASGAANFLSRSTKWAA 63

Query: 55  FFFFATSIALGMISRYTSTRY--KDNMHRSLVDSIKDQ---GNDNFGDGSSPKLDSVSAK 109
             FFA++  L   S   ++    +  + ++  D    Q        G+ S P +      
Sbjct: 64  VVFFASTAFLAYASHKGNSSPAIESGVMQNFQDRSVPQAPGTPATGGEASVPAVPQAPGG 123

Query: 110 SSSSVVAGKRSSS 122
           +S+         S
Sbjct: 124 ASAVPQVPAAPQS 136


>gi|49483036|ref|YP_040260.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus MRSA252]
 gi|295427358|ref|ZP_06819993.1| preprotein translocase [Staphylococcus aureus subsp. aureus
          EMRSA16]
 gi|81651512|sp|Q6GIL2|SECG_STAAR RecName: Full=Probable protein-export membrane protein secG
 gi|49241165|emb|CAG39843.1| putative protein-export membrane protein [Staphylococcus aureus
          subsp. aureus MRSA252]
 gi|295128746|gb|EFG58377.1| preprotein translocase [Staphylococcus aureus subsp. aureus
          EMRSA16]
          Length = 77

 Score = 51.7 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          M  FL+V+ +I  + L+ V+L+Q   SS F  + +            R     L R T I
Sbjct: 1  MHTFLIVLLIIDCIALITVVLLQEGKSSGFSGAISGGAEQLFGKQKQRGVDLFLNRLTII 60

Query: 53 LAFFFFATSIALGMIS 68
          L+  FF   I +  + 
Sbjct: 61 LSILFFVLMICISYLG 76


>gi|188577697|ref|YP_001914626.1| preprotein translocase subunit SecG [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188522149|gb|ACD60094.1| preprotein translocase subunit SecG [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 153

 Score = 51.7 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 46/114 (40%), Gaps = 6/114 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           + + L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA
Sbjct: 2   LMLILNVVYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF+ S+ +   + + +     N+      ++             P+  +  A
Sbjct: 62  VVFFSISLFMAWYATHGARPTDQNLGVMSQSAMPAPAAAGELTQPLPQAPAAGA 115


>gi|238020291|ref|ZP_04600717.1| hypothetical protein GCWU000324_00169 [Kingella oralis ATCC 51147]
 gi|237867271|gb|EEP68277.1| hypothetical protein GCWU000324_00169 [Kingella oralis ATCC 51147]
          Length = 194

 Score = 51.7 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 51/129 (39%), Gaps = 8/129 (6%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-------NFTSVRSTAHSLGRFTAILA 54
           +  ++V+++   + +VC++L+Q    +  G+                 A+ L R TA+ A
Sbjct: 5   KTLILVINIFSSISVVCLVLMQQGKGADAGAGFGGSGSAQGVFGSAGNANFLSRMTALFA 64

Query: 55  FFFFATSIALGMISRYTSTRYKDNMH-RSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF +S+AL  +      +  D  + +            +    S P L   +A +++S
Sbjct: 65  TIFFISSLALSYVHSGNRNKGIDFSNVQQTASVAASAPASSVSVASQPALPQQTAPAATS 124

Query: 114 VVAGKRSSS 122
                 S +
Sbjct: 125 ASVTSASQT 133


>gi|167815035|ref|ZP_02446715.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          91]
          Length = 82

 Score = 51.7 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/82 (21%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 11 IVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIAL 64
          +  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA  FF  ++AL
Sbjct: 1  MSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLATIFFVATLAL 60

Query: 65 GMISRYTSTRYKDNMHRSLVDS 86
            +  Y S      +  +   +
Sbjct: 61 TYLGSYKSAPSVGVLGAAPAPA 82


>gi|311104463|ref|YP_003977316.1| preprotein translocase, SecG subunit [Achromobacter xylosoxidans
           A8]
 gi|310759152|gb|ADP14601.1| preprotein translocase, SecG subunit [Achromobacter xylosoxidans
           A8]
          Length = 168

 Score = 51.3 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 49/120 (40%), Gaps = 8/120 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+ V +I  + ++ ++L+Q    +        GS+ +       A+ L R T   A
Sbjct: 4   MLKILLAVQVISALAIIVLVLLQQGKGADMGSAFGSGSAGSLFGATGAANFLSRATKWAA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FFA++  L  +S   ++     +   ++ S     +     G++P     S   +SSV
Sbjct: 64  VVFFASTAGLAYVSHKGTSGPA--VDSGVMQSFPADRSVPQVPGAAPAPAGSSVPGASSV 121


>gi|300691024|ref|YP_003752019.1| preprotein translocase membrane subunit [Ralstonia solanacearum
          PSI07]
 gi|299078084|emb|CBJ50727.1| preprotein translocase membrane subunit [Ralstonia solanacearum
          PSI07]
          Length = 116

 Score = 51.3 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 39/85 (45%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  L+V  ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLLLVAQILSALGVIGLVLLQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++ L +I           M
Sbjct: 64 TVFFIATLTLTLIGTSKGNVSAGVM 88


>gi|326798179|ref|YP_004315998.1| preprotein translocase, SecG subunit [Sphingobacterium sp. 21]
 gi|326548943|gb|ADZ77328.1| preprotein translocase, SecG subunit [Sphingobacterium sp. 21]
          Length = 121

 Score = 51.3 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/118 (17%), Positives = 41/118 (34%), Gaps = 5/118 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS----SNFTSVRSTAHSLGRFTAILAFF 56
           M   L+V+ ++  V LV ++LIQ+       S     +N   V+ T   L + T +L   
Sbjct: 1   MYTLLIVLTILACVLLVFIVLIQNPKGGGLASGFAGSNNLMGVQRTGDILEKGTWVLVIA 60

Query: 57  FFATSIALGMISRYTSTRYKDNMH-RSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
               S+ L + +    T     +  +  +              ++P        +S  
Sbjct: 61  IMVFSLLLNITNPGAGTGSNPGLELQKQITPTATPTAPLQKPATTPATPQGQKPASVD 118


>gi|71897765|ref|ZP_00679991.1| Preprotein translocase SecG subunit [Xylella fastidiosa Ann-1]
 gi|71732320|gb|EAO34374.1| Preprotein translocase SecG subunit [Xylella fastidiosa Ann-1]
          Length = 132

 Score = 51.3 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 50/125 (40%), Gaps = 8/125 (6%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILAFFF 57
            L V++++V + ++ +IL+Q    +A GS             R  ++ L + T  LA  F
Sbjct: 3   LLNVIYVLVAIAMIVLILLQRGTGAAAGSGFGAGASGTVFGSRGASNFLSKSTKWLAVVF 62

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           F  S+ +   +      +      SL+  +           +SP L   +  +S++   G
Sbjct: 63  FGISLFMAWYASRG--HHSVAQQNSLMTEVPAAPAAGADQAASPVLQVPAVPTSTNTPVG 120

Query: 118 KRSSS 122
            +  +
Sbjct: 121 DKEKA 125


>gi|157273527|gb|ABV27426.1| preprotein translocase SecG subunit [Candidatus Chloracidobacterium
           thermophilum]
          Length = 170

 Score = 51.3 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 26/136 (19%), Positives = 44/136 (32%), Gaps = 14/136 (10%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDS--SAFGSSS-NFTSVRSTAHSLGRFTAILAFFFFAT 60
            L V+ +IV + L+ V+L+Q      + FG  S      R     L R T +L   F A 
Sbjct: 7   VLFVLFVIVCLLLIGVVLLQPGKGDIALFGGGSQTAFGPRGAQKPLERVTFVLGGLFMAL 66

Query: 61  SIALGM---------ISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG--SSPKLDSVSAK 109
           +    +          +                +  + +     G G  +S      +  
Sbjct: 67  AFTFSIPGILLPRSAAAGIKDEPPPSKKEEKQKEETQPEAKKETGAGEATSESTPDKATP 126

Query: 110 SSSSVVAGKRSSSRTK 125
           S+    A K+  S  K
Sbjct: 127 STGEENAAKQGQSDQK 142


>gi|103486659|ref|YP_616220.1| preprotein translocase, SecG subunit [Sphingopyxis alaskensis
           RB2256]
 gi|98976736|gb|ABF52887.1| protein translocase subunit secG [Sphingopyxis alaskensis RB2256]
          Length = 154

 Score = 50.9 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 5/108 (4%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSAFG---SSSNFTSVRSTAHSLGRFTAILAFFFFA 59
            FL+VV  +V   ++ VIL+Q S+    G   S +   S R  A  + R T +LA  F  
Sbjct: 7   TFLLVVQALVAAAMIGVILMQKSEGGGLGVGGSPAGLLSARGAADFMTRATTVLACLFVG 66

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
            SI L  ++     R    +  SL  S +  G  +    ++P   +  
Sbjct: 67  LSILLAAMASVG--RGGSTIDTSLSKSAQTSGGASTSSITAPAQPAEG 112


>gi|94968929|ref|YP_590977.1| protein translocase subunit secG [Candidatus Koribacter
          versatilis Ellin345]
 gi|94550979|gb|ABF40903.1| protein translocase subunit secG [Candidatus Koribacter
          versatilis Ellin345]
          Length = 99

 Score = 50.9 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 6/95 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSV--RSTAHSLGRFTAILA 54
          M   +  +H+ V   L+ V+L+QS  S+    AFG S + T+   R TA++L + T   A
Sbjct: 1  MIYLITTIHIAVCFFLIVVVLLQSGKSADLAAAFGGSGSQTAFGPRGTANALSKATTWSA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKD 89
            F  TSI L +++   +      ++ +     + 
Sbjct: 61 VIFMLTSIILSVMAARHTGSAGSVLNGTKAAPTQQ 95


>gi|82750486|ref|YP_416227.1| preprotein translocase subunit SecG [Staphylococcus aureus RF122]
 gi|82656017|emb|CAI80422.1| probable protein-export translocase membrane protein
          [Staphylococcus aureus RF122]
          Length = 77

 Score = 50.9 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          M  FL+V+ +I  + L+ V+L+Q   SS    + +            R     L R T I
Sbjct: 1  MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII 60

Query: 53 LAFFFFATSIALGMI 67
          L+  FF   I +  +
Sbjct: 61 LSILFFVLMICISYL 75


>gi|53712376|ref|YP_098368.1| preprotein translocase subunit SecG [Bacteroides fragilis YCH46]
 gi|60680545|ref|YP_210689.1| preprotein translocase subunit SecG [Bacteroides fragilis NCTC
           9343]
 gi|253563587|ref|ZP_04841044.1| preprotein translocase subunit SecG [Bacteroides sp. 3_2_5]
 gi|265762568|ref|ZP_06091136.1| preprotein translocase subunit SecG [Bacteroides sp. 2_1_16]
 gi|52215241|dbj|BAD47834.1| putative protein-export membrane protein [Bacteroides fragilis
           YCH46]
 gi|60491979|emb|CAH06740.1| possible protein-export transmembrane protein [Bacteroides fragilis
           NCTC 9343]
 gi|251947363|gb|EES87645.1| preprotein translocase subunit SecG [Bacteroides sp. 3_2_5]
 gi|263255176|gb|EEZ26522.1| preprotein translocase subunit SecG [Bacteroides sp. 2_1_16]
 gi|301162082|emb|CBW21626.1| possible protein-export transmembrane protein [Bacteroides fragilis
           638R]
          Length = 126

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 52/126 (41%), Gaps = 4/126 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M + L+++ +I  + +  ++LIQ+S      S  +       VR T   L + T  LA F
Sbjct: 1   MYLLLVILMVIAAILMCFIVLIQNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWGLAAF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               SIA   +   +S++ +D +        +    +     ++PK D+ +   + +   
Sbjct: 61  MVVMSIATAYVVPTSSSKTQDVIMEQAQQEEQTNPYNLPVGTTAPKTDAAAPVEAPATET 120

Query: 117 GKRSSS 122
               ++
Sbjct: 121 PATPAN 126


>gi|256751252|ref|ZP_05492132.1| preprotein translocase, SecG subunit [Thermoanaerobacter
          ethanolicus CCSD1]
 gi|256749807|gb|EEU62831.1| preprotein translocase, SecG subunit [Thermoanaerobacter
          ethanolicus CCSD1]
          Length = 79

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFT--SVRSTAHSLGRFTAI 52
          ++  LMV+H++V + L+ VIL+Q   ++        G+ + F     R+   +L + T I
Sbjct: 2  LKTVLMVIHVLVSLFLIAVILLQKGKNAGISGVIEGGAETFFGKNKARTMEGTLEKLTTI 61

Query: 53 LAFFFFATSIALGMI 67
           A  F   S+ L ++
Sbjct: 62 AAALFIILSMVLTVM 76


>gi|325294779|ref|YP_004281293.1| preprotein translocase, SecG subunit [Desulfurobacterium
          thermolithotrophum DSM 11699]
 gi|325065227|gb|ADY73234.1| preprotein translocase, SecG subunit [Desulfurobacterium
          thermolithotrophum DSM 11699]
          Length = 91

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 34/80 (42%), Gaps = 4/80 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDS--SAFGSSSNFTSVRS--TAHSLGRFTAILAFF 56
          M   L++ H I+ + L+ V+LIQ      S+     + +S     T   L + TAIL   
Sbjct: 1  MFTALLIFHAIIALLLIIVVLIQPGKGDTSSLLGGGSASSAFGADTGAVLTKTTAILGAL 60

Query: 57 FFATSIALGMISRYTSTRYK 76
          F   S+ L ++    +    
Sbjct: 61 FMLNSLILSVVGSKLAQENS 80


>gi|300022973|ref|YP_003755584.1| preprotein translocase subunit SecG [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299524794|gb|ADJ23263.1| preprotein translocase, SecG subunit [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 125

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 52/120 (43%), Gaps = 8/120 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS------TAHSLGRFTAILA 54
           M   L+V+HL++   LV V+L+Q S+  A G   +            TA+ L R TA LA
Sbjct: 1   MATVLLVIHLMISTALVGVVLLQKSEGGALGIGGSAGGGGGFLTGRGTANLLTRTTAALA 60

Query: 55  FFFFATSIALGMISRYTSTRYK--DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             FF TSI+L +++R++       D+ H +               G    LD +     +
Sbjct: 61  AAFFVTSISLTLLARHSVNAGSVFDSTHPAGAPVTGPATPGESAPGRGGILDKLQPSGPA 120


>gi|254670972|emb|CBA07674.1| protein-export integral membrane protein [Neisseria meningitidis
          alpha153]
          Length = 94

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 8/76 (10%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS--------AFGSSSNFTSVRSTAHSLGRFTAIL 53
          +  + +V++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5  KTLIWIVNIISALAVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54 AFFFFATSIALGMISR 69
          A FFFAT    G+ S 
Sbjct: 65 ATFFFATWHGYGVYSH 80


>gi|27467481|ref|NP_764118.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          ATCC 12228]
 gi|57866442|ref|YP_188041.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          RP62A]
 gi|242242150|ref|ZP_04796595.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          W23144]
 gi|251810214|ref|ZP_04824687.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          BCM-HMP0060]
 gi|282875639|ref|ZP_06284510.1| preprotein translocase, SecG subunit [Staphylococcus epidermidis
          SK135]
 gi|293368242|ref|ZP_06614871.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          M23864:W2(grey)]
 gi|81675180|sp|Q5HQU8|SECG_STAEQ RecName: Full=Probable protein-export membrane protein secG
 gi|81843020|sp|Q8CPY2|SECG_STAES RecName: Full=Probable protein-export membrane protein secG
 gi|27315024|gb|AAO04160.1|AE016745_259 preprotein translocase SecG subunit [Staphylococcus epidermidis
          ATCC 12228]
 gi|57637100|gb|AAW53888.1| preprotein translocase, SecG subunit [Staphylococcus epidermidis
          RP62A]
 gi|242234405|gb|EES36717.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          W23144]
 gi|251806266|gb|EES58923.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          BCM-HMP0060]
 gi|281295666|gb|EFA88189.1| preprotein translocase, SecG subunit [Staphylococcus epidermidis
          SK135]
 gi|291317665|gb|EFE58082.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          M23864:W2(grey)]
 gi|319401143|gb|EFV89358.1| preprotein translocase, SecG subunit [Staphylococcus epidermidis
          FRI909]
 gi|329723295|gb|EGG59825.1| preprotein translocase, SecG subunit [Staphylococcus epidermidis
          VCU144]
 gi|329736861|gb|EGG73126.1| preprotein translocase, SecG subunit [Staphylococcus epidermidis
          VCU028]
 gi|329737930|gb|EGG74154.1| preprotein translocase, SecG subunit [Staphylococcus epidermidis
          VCU045]
          Length = 77

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 30/76 (39%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          M   ++V+ +I  + LV V+L+Q   S+    + +            R     L R T I
Sbjct: 1  MHTLIIVLLIIDCIALVTVVLLQEGKSNGLSGAISGGAEQLFGKQKQRGVDLFLHRLTII 60

Query: 53 LAFFFFATSIALGMIS 68
          LA  FF     +  + 
Sbjct: 61 LAILFFVLMFCISYLG 76


>gi|15923768|ref|NP_371302.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus Mu50]
 gi|15926455|ref|NP_373988.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus N315]
 gi|21282469|ref|NP_645557.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus MW2]
 gi|49485650|ref|YP_042871.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus MSSA476]
 gi|57650120|ref|YP_185718.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus COL]
 gi|148267238|ref|YP_001246181.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus JH9]
 gi|150393287|ref|YP_001315962.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus JH1]
 gi|151220959|ref|YP_001331781.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus str. Newman]
 gi|156979106|ref|YP_001441365.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus Mu3]
 gi|161353529|ref|YP_499357.2| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus NCTC 8325]
 gi|161509049|ref|YP_001574708.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus USA300_TCH1516]
 gi|162138563|ref|YP_493463.2| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus USA300_FPR3757]
 gi|221142193|ref|ZP_03566686.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus str. JKD6009]
 gi|253317248|ref|ZP_04840461.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus str. CF-Marseille]
 gi|253731408|ref|ZP_04865573.1| Sec family type I general secretory protein SecG [Staphylococcus
          aureus subsp. aureus USA300_TCH959]
 gi|253732772|ref|ZP_04866937.1| Sec family type I general secretory protein SecG [Staphylococcus
          aureus subsp. aureus TCH130]
 gi|255005569|ref|ZP_05144170.2| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus Mu50-omega]
 gi|258452174|ref|ZP_05700190.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A5948]
 gi|258453971|ref|ZP_05701943.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A5937]
 gi|262050044|ref|ZP_06022901.1| protein-export membrane protein [Staphylococcus aureus D30]
 gi|262052705|ref|ZP_06024896.1| protein-export membrane protein [Staphylococcus aureus 930918-3]
 gi|284023801|ref|ZP_06378199.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus 132]
 gi|294850507|ref|ZP_06791236.1| preprotein translocase [Staphylococcus aureus A9754]
 gi|295406502|ref|ZP_06816308.1| preprotein translocase [Staphylococcus aureus A8819]
 gi|296276293|ref|ZP_06858800.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus MR1]
 gi|297208493|ref|ZP_06924922.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus ATCC 51811]
 gi|297245228|ref|ZP_06929102.1| preprotein translocase [Staphylococcus aureus A8796]
 gi|297590286|ref|ZP_06948925.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus MN8]
 gi|300912585|ref|ZP_07130028.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus TCH70]
 gi|304381598|ref|ZP_07364248.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus ATCC BAA-39]
 gi|81649728|sp|Q6GB52|SECG_STAAS RecName: Full=Probable protein-export membrane protein secG
 gi|81694962|sp|Q5HHN9|SECG_STAAC RecName: Full=Probable protein-export membrane protein secG
 gi|81704588|sp|Q7A1F4|SECG_STAAW RecName: Full=Probable protein-export membrane protein secG
 gi|81706012|sp|Q7A6Q1|SECG_STAAN RecName: Full=Probable protein-export membrane protein secG
 gi|81781928|sp|Q99VK3|SECG_STAAM RecName: Full=Probable protein-export membrane protein secG
 gi|13700669|dbj|BAB41966.1| probable protein-export membrane protein [Staphylococcus aureus
          subsp. aureus N315]
 gi|14246547|dbj|BAB56940.1| probable protein-export membrane protein [Staphylococcus aureus
          subsp. aureus Mu50]
 gi|21203906|dbj|BAB94605.1| probable protein-export membrane protein [Staphylococcus aureus
          subsp. aureus MW2]
 gi|49244093|emb|CAG42519.1| putative protein-export membrane protein [Staphylococcus aureus
          subsp. aureus MSSA476]
 gi|57284306|gb|AAW36400.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus COL]
 gi|147740307|gb|ABQ48605.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus JH9]
 gi|149945739|gb|ABR51675.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus JH1]
 gi|150373759|dbj|BAF67019.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus str. Newman]
 gi|156721241|dbj|BAF77658.1| probable protein-export membrane protein [Staphylococcus aureus
          subsp. aureus Mu3]
 gi|160367858|gb|ABX28829.1| possible Sec family Type I general secretory protein SecG
          [Staphylococcus aureus subsp. aureus USA300_TCH1516]
 gi|253724858|gb|EES93587.1| Sec family type I general secretory protein SecG [Staphylococcus
          aureus subsp. aureus USA300_TCH959]
 gi|253729246|gb|EES97975.1| Sec family type I general secretory protein SecG [Staphylococcus
          aureus subsp. aureus TCH130]
 gi|257860389|gb|EEV83221.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A5948]
 gi|257863836|gb|EEV86592.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A5937]
 gi|259159402|gb|EEW44455.1| protein-export membrane protein [Staphylococcus aureus 930918-3]
 gi|259161840|gb|EEW46425.1| protein-export membrane protein [Staphylococcus aureus D30]
 gi|269940355|emb|CBI48732.1| putative protein-export membrane protein [Staphylococcus aureus
          subsp. aureus TW20]
 gi|283470073|emb|CAQ49284.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus ST398]
 gi|285816480|gb|ADC36967.1| Preprotein translocase subunit SecG [Staphylococcus aureus
          04-02981]
 gi|294822645|gb|EFG39085.1| preprotein translocase [Staphylococcus aureus A9754]
 gi|294968647|gb|EFG44670.1| preprotein translocase [Staphylococcus aureus A8819]
 gi|296886748|gb|EFH25652.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus ATCC 51811]
 gi|297177899|gb|EFH37148.1| preprotein translocase [Staphylococcus aureus A8796]
 gi|297576585|gb|EFH95300.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus MN8]
 gi|298694114|gb|ADI97336.1| probable protein-export translocase membrane protein
          [Staphylococcus aureus subsp. aureus ED133]
 gi|300886831|gb|EFK82033.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus TCH70]
 gi|302332489|gb|ADL22682.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus JKD6159]
 gi|302750675|gb|ADL64852.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus str. JKD6008]
 gi|304339961|gb|EFM05905.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus ATCC BAA-39]
 gi|312438791|gb|ADQ77862.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus TCH60]
 gi|312829270|emb|CBX34112.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus ECT-R 2]
 gi|315129014|gb|EFT85011.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus CGS03]
 gi|315194399|gb|EFU24791.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus CGS00]
 gi|315196257|gb|EFU26611.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus CGS01]
 gi|320139885|gb|EFW31746.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus MRSA131]
 gi|320142024|gb|EFW33852.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus MRSA177]
 gi|323438635|gb|EGA96379.1| preprotein translocase subunit SecG [Staphylococcus aureus O11]
 gi|323441960|gb|EGA99597.1| preprotein translocase subunit SecG [Staphylococcus aureus O46]
 gi|329313499|gb|AEB87912.1| Probable protein-export membrane protein secG [Staphylococcus
          aureus subsp. aureus T0131]
 gi|329723787|gb|EGG60315.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 21189]
 gi|329724625|gb|EGG61132.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 21172]
 gi|329729750|gb|EGG66151.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 21193]
          Length = 77

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 32/76 (42%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          M  FL+V+ +I  + L+ V+L+Q   SS    + +            R     L R T I
Sbjct: 1  MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII 60

Query: 53 LAFFFFATSIALGMIS 68
          L+  FF   I +  + 
Sbjct: 61 LSILFFVLMICISYLG 76


>gi|194366605|ref|YP_002029215.1| preprotein translocase subunit SecG [Stenotrophomonas maltophilia
          R551-3]
 gi|194349409|gb|ACF52532.1| preprotein translocase, SecG subunit [Stenotrophomonas
          maltophilia R551-3]
          Length = 145

 Score = 50.5 bits (119), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 38/83 (45%), Gaps = 6/83 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
          + + L VV+++V V ++ +IL+Q    +A GS             R  ++ L + T  LA
Sbjct: 2  LMLILNVVYVLVAVAMIALILMQRGSGAAAGSGFGAGASGTVFGARGASNFLSKSTKWLA 61

Query: 55 FFFFATSIALGMISRYTSTRYKD 77
            FF  S+ +   + + +    +
Sbjct: 62 VVFFGISLFMAWYAGHGTRPAAE 84


>gi|302390380|ref|YP_003826201.1| protein translocase subunit secG [Thermosediminibacter oceani DSM
          16646]
 gi|302201008|gb|ADL08578.1| protein translocase subunit secG [Thermosediminibacter oceani DSM
          16646]
          Length = 78

 Score = 50.5 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 6/73 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAF------GSSSNFTSVRSTAHSLGRFTAILA 54
          + I L VV+++V +GL+  +L+QS  S+        G+ + F   +     L + T I A
Sbjct: 4  LHIVLTVVYILVCIGLIATVLLQSGKSAGLSGTIAGGAETFFGKKKGIDDKLAKITEIFA 63

Query: 55 FFFFATSIALGMI 67
            F A SI + ++
Sbjct: 64 VAFLALSILMMIV 76


>gi|261400562|ref|ZP_05986687.1| preprotein translocase, SecG subunit [Neisseria lactamica ATCC
          23970]
 gi|313669104|ref|YP_004049388.1| protein-export integral membrane protein [Neisseria lactamica
          ST-640]
 gi|269209632|gb|EEZ76087.1| preprotein translocase, SecG subunit [Neisseria lactamica ATCC
          23970]
 gi|309379498|emb|CBX21864.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313006566|emb|CBN88030.1| putative protein-export integral membrane protein [Neisseria
          lactamica 020-06]
          Length = 120

 Score = 50.5 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 41/87 (47%), Gaps = 8/87 (9%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSS--------AFGSSSNFTSVRSTAHSLGRFTAIL 53
          +  + ++++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5  KTLIWIINIISALAVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54 AFFFFATSIALGMISRYTSTRYKDNMH 80
          A FFFA+ +A+  I  +T+    D  +
Sbjct: 65 ATFFFASCMAMVYIHTHTTKHGLDFSN 91


>gi|319787444|ref|YP_004146919.1| preprotein translocase subunit SecG [Pseudoxanthomonas suwonensis
          11-1]
 gi|317465956|gb|ADV27688.1| preprotein translocase, SecG subunit [Pseudoxanthomonas
          suwonensis 11-1]
          Length = 142

 Score = 50.5 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 38/80 (47%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
          + + L VV+++V + ++ +IL+Q    +A GS             R  ++ L + T  LA
Sbjct: 2  LMLILNVVYVLVAIAMIVLILLQRGAGAAAGSGFGAGASGTVFGARGASNFLSKSTKWLA 61

Query: 55 FFFFATSIALGMISRYTSTR 74
            FF  S+ +   + +++  
Sbjct: 62 VVFFGISLFMAWYATHSARP 81


>gi|167037154|ref|YP_001664732.1| preprotein translocase subunit SecG [Thermoanaerobacter
          pseudethanolicus ATCC 33223]
 gi|167039954|ref|YP_001662939.1| preprotein translocase subunit SecG [Thermoanaerobacter sp. X514]
 gi|300915492|ref|ZP_07132804.1| preprotein translocase, SecG subunit [Thermoanaerobacter sp.
          X561]
 gi|307724722|ref|YP_003904473.1| preprotein translocase subunit SecG [Thermoanaerobacter sp. X513]
 gi|320115573|ref|YP_004185732.1| preprotein translocase subunit SecG [Thermoanaerobacter brockii
          subsp. finnii Ako-1]
 gi|166854194|gb|ABY92603.1| preprotein translocase, SecG subunit [Thermoanaerobacter sp.
          X514]
 gi|166855988|gb|ABY94396.1| preprotein translocase, SecG subunit [Thermoanaerobacter
          pseudethanolicus ATCC 33223]
 gi|300888444|gb|EFK83594.1| preprotein translocase, SecG subunit [Thermoanaerobacter sp.
          X561]
 gi|307581783|gb|ADN55182.1| preprotein translocase, SecG subunit [Thermoanaerobacter sp.
          X513]
 gi|319928664|gb|ADV79349.1| preprotein translocase, SecG subunit [Thermoanaerobacter brockii
          subsp. finnii Ako-1]
          Length = 79

 Score = 50.5 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFT--SVRSTAHSLGRFTAI 52
          ++  LMV+H++V + L+ VIL+Q   S+        G+ + F     R+   +L + T I
Sbjct: 2  LKTVLMVIHVLVSLFLIAVILLQKGKSAGISGVIEGGAETFFGKNKARTMEGTLEKLTTI 61

Query: 53 LAFFFFATSIALGMI 67
           A  F   S+ L ++
Sbjct: 62 AAALFIILSMVLTVM 76


>gi|16080416|ref|NP_391243.1| preprotein translocase subunit SecG [Bacillus subtilis subsp.
          subtilis str. 168]
 gi|221311313|ref|ZP_03593160.1| hypothetical protein Bsubs1_18251 [Bacillus subtilis subsp.
          subtilis str. 168]
 gi|221315640|ref|ZP_03597445.1| hypothetical protein BsubsN3_18167 [Bacillus subtilis subsp.
          subtilis str. NCIB 3610]
 gi|221320556|ref|ZP_03601850.1| hypothetical protein BsubsJ_18135 [Bacillus subtilis subsp.
          subtilis str. JH642]
 gi|221324840|ref|ZP_03606134.1| hypothetical protein BsubsS_18286 [Bacillus subtilis subsp.
          subtilis str. SMY]
 gi|296330423|ref|ZP_06872903.1| hypothetical protein BSU6633_04944 [Bacillus subtilis subsp.
          spizizenii ATCC 6633]
 gi|305675969|ref|YP_003867641.1| preprotein translocase subunit [Bacillus subtilis subsp.
          spizizenii str. W23]
 gi|321312913|ref|YP_004205200.1| hypothetical protein BSn5_07735 [Bacillus subtilis BSn5]
 gi|6226126|sp|O32233|SECG_BACSU RecName: Full=Probable protein-export membrane protein secG
 gi|2635876|emb|CAB15368.1| preprotein translocase subunit [Bacillus subtilis subsp. subtilis
          str. 168]
 gi|291485895|dbj|BAI86970.1| preprotein translocase subunit SecG [Bacillus subtilis subsp.
          natto BEST195]
 gi|296152426|gb|EFG93295.1| hypothetical protein BSU6633_04944 [Bacillus subtilis subsp.
          spizizenii ATCC 6633]
 gi|305414213|gb|ADM39332.1| preprotein translocase subunit [Bacillus subtilis subsp.
          spizizenii str. W23]
 gi|320019187|gb|ADV94173.1| hypothetical protein BSn5_07735 [Bacillus subtilis BSn5]
          Length = 76

 Score = 50.5 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          M   L+ + +IV + L+ V+L+QSS S+    + +            R     L R T +
Sbjct: 1  MHAVLITLLVIVSIALIIVVLLQSSKSAGLSGAISGGAEQLFGKQKARGLDLILHRITVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +IAL  I
Sbjct: 61 LAVLFFVLTIALAYI 75


>gi|308175109|ref|YP_003921814.1| protein-export membrane protein secG [Bacillus amyloliquefaciens
          DSM 7]
 gi|307607973|emb|CBI44344.1| probable protein-export membrane protein secG [Bacillus
          amyloliquefaciens DSM 7]
 gi|328555078|gb|AEB25570.1| hypothetical protein BAMTA208_17090 [Bacillus amyloliquefaciens
          TA208]
 gi|328913433|gb|AEB65029.1| putative protein-export membrane protein secG [Bacillus
          amyloliquefaciens LL3]
          Length = 76

 Score = 50.5 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          M   L+ + +IV + L+ V+L+QSS S+    + +            R     L R T +
Sbjct: 1  MHTLLITLLVIVSIALIIVVLLQSSKSAGLSGAISGGAEQLFGKQKARGLDLILHRTTVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +I+L  I
Sbjct: 61 LAVLFFVLTISLAYI 75


>gi|83746296|ref|ZP_00943349.1| Protein translocase subunit secG [Ralstonia solanacearum UW551]
 gi|207723872|ref|YP_002254270.1| protein-export membrane protein secg (translocase) [Ralstonia
          solanacearum MolK2]
 gi|207742734|ref|YP_002259126.1| protein-export membrane protein secg (translocase) [Ralstonia
          solanacearum IPO1609]
 gi|300703641|ref|YP_003745243.1| preprotein translocase membrane subunit [Ralstonia solanacearum
          CFBP2957]
 gi|83727046|gb|EAP74171.1| Protein translocase subunit secG [Ralstonia solanacearum UW551]
 gi|206589077|emb|CAQ36039.1| protein-export membrane protein secg (translocase) [Ralstonia
          solanacearum MolK2]
 gi|206594128|emb|CAQ61055.1| protein-export membrane protein secg (translocase) [Ralstonia
          solanacearum IPO1609]
 gi|299071304|emb|CBJ42622.1| preprotein translocase membrane subunit [Ralstonia solanacearum
          CFBP2957]
          Length = 116

 Score = 50.5 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  L+V  ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLLLVAQILSALGVIGLVLLQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL +I     +     M
Sbjct: 64 TVFFVATLALTLIGTSKGSVSAGVM 88


>gi|160887194|ref|ZP_02068197.1| hypothetical protein BACOVA_05210 [Bacteroides ovatus ATCC 8483]
 gi|237715682|ref|ZP_04546163.1| preprotein translocase subunit SecG [Bacteroides sp. D1]
 gi|237721464|ref|ZP_04551945.1| preprotein translocase subunit SecG [Bacteroides sp. 2_2_4]
 gi|262408690|ref|ZP_06085236.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|293370811|ref|ZP_06617356.1| preprotein translocase, SecG subunit [Bacteroides ovatus SD CMC 3f]
 gi|294646660|ref|ZP_06724286.1| preprotein translocase, SecG subunit [Bacteroides ovatus SD CC 2a]
 gi|294807287|ref|ZP_06766101.1| preprotein translocase, SecG subunit [Bacteroides xylanisolvens SD
           CC 1b]
 gi|298481519|ref|ZP_06999711.1| preprotein translocase SecG subunit [Bacteroides sp. D22]
 gi|156107605|gb|EDO09350.1| hypothetical protein BACOVA_05210 [Bacteroides ovatus ATCC 8483]
 gi|229444391|gb|EEO50182.1| preprotein translocase subunit SecG [Bacteroides sp. D1]
 gi|229449260|gb|EEO55051.1| preprotein translocase subunit SecG [Bacteroides sp. 2_2_4]
 gi|262353555|gb|EEZ02649.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|292634027|gb|EFF52571.1| preprotein translocase, SecG subunit [Bacteroides ovatus SD CMC 3f]
 gi|292637999|gb|EFF56391.1| preprotein translocase, SecG subunit [Bacteroides ovatus SD CC 2a]
 gi|294445585|gb|EFG14238.1| preprotein translocase, SecG subunit [Bacteroides xylanisolvens SD
           CC 1b]
 gi|298272383|gb|EFI13952.1| preprotein translocase SecG subunit [Bacteroides sp. D22]
          Length = 131

 Score = 50.5 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 46/126 (36%), Gaps = 4/126 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS----SNFTSVRSTAHSLGRFTAILAFF 56
           M +  +++ +I  + +  ++LIQ+S      S     +    VR T   L + T  LA F
Sbjct: 1   MYLLFVILMVIAALLMCFIVLIQNSKGGGLASGFSSSNAIMGVRKTTDFLEKATWGLAIF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               SIA   +   ++      + ++  +   +  N   G  +       +   ++   A
Sbjct: 61  MVVMSIATAYVVPRSAVAKDAVLEQAQKEQQTNPYNLPAGTAAPQTEAPATNAPATETPA 120

Query: 117 GKRSSS 122
               + 
Sbjct: 121 PATETP 126


>gi|28198170|ref|NP_778484.1| preprotein translocase subunit SecG [Xylella fastidiosa Temecula1]
 gi|182680804|ref|YP_001828964.1| preprotein translocase subunit SecG [Xylella fastidiosa M23]
 gi|28056240|gb|AAO28133.1| protein-export membrane protein SecG [Xylella fastidiosa Temecula1]
 gi|182630914|gb|ACB91690.1| preprotein translocase, SecG subunit [Xylella fastidiosa M23]
 gi|307579272|gb|ADN63241.1| preprotein translocase subunit SecG [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 132

 Score = 50.5 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 50/125 (40%), Gaps = 8/125 (6%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILAFFF 57
            L V++++V + ++ +IL+Q    +A GS             R  ++ L + T  LA  F
Sbjct: 3   LLNVIYVLVAIAMIVLILMQRGTGAAAGSGFGAGASGTVFGSRGASNFLSKSTKWLAVVF 62

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           F  S+ +   +      +      SL+  +           +SP L   +  +S++   G
Sbjct: 63  FGISLFMAWYASRG--HHSVAQQNSLMTEVPAAPAAGADQAASPVLQVPAVPTSTNTPVG 120

Query: 118 KRSSS 122
            +  +
Sbjct: 121 DKEKA 125


>gi|329119695|ref|ZP_08248376.1| preprotein translocase subunit SecG [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464292|gb|EGF10596.1| preprotein translocase subunit SecG [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 112

 Score = 50.5 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 43/105 (40%), Gaps = 8/105 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS--------AFGSSSNFTSVRSTAHSLGRFTAIL 53
           +  +M+++    + ++ ++L+Q    +          GS+        + + L R T I 
Sbjct: 5   KTLIMILNGFAGLAIILLVLMQHGKGADAGASFASGSGSAQGVFGSAGSGNFLSRSTYIA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
           A  FFAT +AL  I  ++     D  +      +K Q     G+G
Sbjct: 65  ATVFFATCLALTYIYSHSGKGKLDFSNVQQSAPVKTQPAAPAGNG 109


>gi|254496120|ref|ZP_05109019.1| hypothetical protein LDG_0849 [Legionella drancourtii LLAP12]
 gi|254354661|gb|EET13297.1| hypothetical protein LDG_0849 [Legionella drancourtii LLAP12]
          Length = 105

 Score = 50.5 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 39/90 (43%), Gaps = 6/90 (6%)

Query: 7  VVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFFAT 60
          ++H++V V L+ ++LIQ    +    AFGS ++ T    + T   L + T  LA  FF T
Sbjct: 1  MIHVVVAVVLIGLVLIQHGKGADIGAAFGSGASNTLFGSQGTGSFLFKLTGGLALTFFVT 60

Query: 61 SIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
          S+ L  +      + +            + 
Sbjct: 61 SLLLSYLVSIQYQKAEQQAAPQQTSVPVNS 90


>gi|42526747|ref|NP_971845.1| preprotein translocase subunit SecG [Treponema denticola ATCC
           35405]
 gi|41817062|gb|AAS11756.1| preprotein translocase, SecG subunit [Treponema denticola ATCC
           35405]
 gi|325473807|gb|EGC76995.1| preprotein translocase [Treponema denticola F0402]
          Length = 116

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 21/104 (20%), Positives = 50/104 (48%), Gaps = 6/104 (5%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDS---SAFGSSSNFTSVRS-TAHSLGRFTAILAFFFF 58
           I L+V+ +I+   ++ ++L+Q+ +        S  + ++  S +++ L R T ++   FF
Sbjct: 6   IALLVLFVIICAIIIFLVLLQNEEGDSLGGLFSGGSNSAFGSKSSNVLTRATYVVVALFF 65

Query: 59  ATSIALGMISRYTSTR--YKDNMHRSLVDSIKDQGNDNFGDGSS 100
            T+  L +I++  S     ++ M +    S     +D+  D  +
Sbjct: 66  VTTFLLALITKTPSDSGLSEEAMKKQTETSTDWWKSDDGTDSGT 109


>gi|95930089|ref|ZP_01312828.1| preprotein translocase, SecG subunit [Desulfuromonas acetoxidans
          DSM 684]
 gi|95133783|gb|EAT15443.1| preprotein translocase, SecG subunit [Desulfuromonas acetoxidans
          DSM 684]
          Length = 99

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 40/81 (49%), Gaps = 6/81 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTA--HSLGRFTAILA 54
          M  FL+ VH++V + L+ ++L+Q+   +    +FG+ ++ T   ++     + + T   A
Sbjct: 1  MIPFLLTVHVLVCIALIVIVLLQAGKGAEAGASFGAGASQTVFGASGGRSFMSKMTTFAA 60

Query: 55 FFFFATSIALGMISRYTSTRY 75
            F  TS++L  +     +  
Sbjct: 61 CLFMLTSLSLAYLYGKPGSDS 81


>gi|256823566|ref|YP_003147529.1| preprotein translocase subunit SecG [Kangiella koreensis DSM 16069]
 gi|256797105|gb|ACV27761.1| preprotein translocase, SecG subunit [Kangiella koreensis DSM
           16069]
          Length = 152

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 53/131 (40%), Gaps = 6/131 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           M++FLM+  L+V + LV +ILIQ    +    +FG+ ++ T        + L + T ILA
Sbjct: 1   MELFLMISLLVVALLLVGIILIQQGKGAEIGASFGAGASNTLFGAPGAGNFLTKSTTILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FFA ++ +  I +   T                  +         ++ S     +   
Sbjct: 61  IIFFALALTIHAIGQEEVTESGLLDDPESQVEEIGVQSSEIPTEVQDEIPSEIPTDTQEE 120

Query: 115 VAGKRSSSRTK 125
           ++ +  ++  +
Sbjct: 121 ISTEIPTADEQ 131


>gi|307824618|ref|ZP_07654842.1| preprotein translocase, SecG subunit [Methylobacter tundripaludum
           SV96]
 gi|307734272|gb|EFO05125.1| preprotein translocase, SecG subunit [Methylobacter tundripaludum
           SV96]
          Length = 136

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 54/125 (43%), Gaps = 7/125 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   ++VVH+++ +G+V ++L+Q    +        GSS +    +  A  L R TAILA
Sbjct: 1   MYQVIIVVHVLLGLGVVGLVLMQQGKGADAGAAFGTGSSGSVFGAQGAASFLSRATAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ L +++      Y D M+   V+       D  G   S     V+   S  V
Sbjct: 61  TLFFMTSLGLAVLNGKQGAAY-DLMNAPKVEQDTLGIPDVSGAKGSGSAAPVTDPKSEEV 119

Query: 115 VAGKR 119
                
Sbjct: 120 PVAAP 124


>gi|302343399|ref|YP_003807928.1| preprotein translocase, SecG subunit [Desulfarculus baarsii DSM
          2075]
 gi|301640012|gb|ADK85334.1| preprotein translocase, SecG subunit [Desulfarculus baarsii DSM
          2075]
          Length = 137

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 5/80 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS-----VRSTAHSLGRFTAILAF 55
          MQI L+++HL+    LV V+L+Q+   ++ G++    S            LG+ T I+A 
Sbjct: 1  MQIALILLHLVACAILVLVVLLQTGKGASLGAAFGGASQTVFGSSGAQTFLGKMTTIVAV 60

Query: 56 FFFATSIALGMISRYTSTRY 75
           F  TS+ L + +    ++ 
Sbjct: 61 IFMVTSLTLAITAGGKGSKS 80


>gi|241663485|ref|YP_002981845.1| preprotein translocase subunit SecG [Ralstonia pickettii 12D]
 gi|309781851|ref|ZP_07676584.1| homoserine dehydrogenase [Ralstonia sp. 5_7_47FAA]
 gi|240865512|gb|ACS63173.1| preprotein translocase, SecG subunit [Ralstonia pickettii 12D]
 gi|308919492|gb|EFP65156.1| homoserine dehydrogenase [Ralstonia sp. 5_7_47FAA]
          Length = 120

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  L+V  ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLLLVAQILSALGVIGLVLLQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL +I     +     M
Sbjct: 64 TVFFIATLALTLIGTSKGSVSAGVM 88


>gi|260223143|emb|CBA33412.1| Protein-export membrane protein secG [Curvibacter putative symbiont
           of Hydra magnipapillata]
          Length = 119

 Score = 50.2 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 21/114 (18%), Positives = 43/114 (37%), Gaps = 7/114 (6%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
             ++ V L+  V ++ +IL+Q    +        G S +      +A+ L R TA+LA  
Sbjct: 6   TIILTVQLLAAVAMIGLILVQHGKGADMGAAFGSGGSGSLFGASGSANFLSRTTAVLATV 65

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
           FF +++AL              +  + V +            ++P   +    +
Sbjct: 66  FFVSTLALAYFGNLRPASSGSVLEGAAVVAPAVAPVAETA-PATPASGAAQIPA 118


>gi|154687493|ref|YP_001422654.1| preprotein translocase subunit SecG [Bacillus amyloliquefaciens
          FZB42]
 gi|154353344|gb|ABS75423.1| hypothetical protein RBAM_030920 [Bacillus amyloliquefaciens
          FZB42]
          Length = 76

 Score = 50.2 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          M   L+ + +IV + L+ V+L+Q+S S+    + +            R     L R T +
Sbjct: 1  MHTLLITLLVIVSIALIIVVLLQTSKSAGLSGAISGGAEQLFGKQKARGLDLILHRTTVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +I+L  I
Sbjct: 61 LAVLFFVLTISLAYI 75


>gi|299148695|ref|ZP_07041757.1| preprotein translocase, SecG subunit [Bacteroides sp. 3_1_23]
 gi|298513456|gb|EFI37343.1| preprotein translocase, SecG subunit [Bacteroides sp. 3_1_23]
          Length = 131

 Score = 50.2 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 46/126 (36%), Gaps = 4/126 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS----SNFTSVRSTAHSLGRFTAILAFF 56
           M +  +++ +I  + +  ++LIQ+S      S     +    VR T   L + T  LA F
Sbjct: 1   MYLLFVILMVIAALLMCFIVLIQNSKGGGLASGFSSSNAIMGVRKTTDFLEKATWGLAIF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               SIA   +   ++      + ++  +   +  N   G  +       +   ++   A
Sbjct: 61  MVVMSIATAYVVPRSAVVKDAVLEQAQKEQQTNPYNLPAGTAAPQTEAPATNAPATETPA 120

Query: 117 GKRSSS 122
               + 
Sbjct: 121 PATETP 126


>gi|295689358|ref|YP_003593051.1| preprotein translocase subunit SecG [Caulobacter segnis ATCC 21756]
 gi|295431261|gb|ADG10433.1| preprotein translocase, SecG subunit [Caulobacter segnis ATCC
           21756]
          Length = 171

 Score = 50.2 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 48/125 (38%), Gaps = 6/125 (4%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFFFAT 60
            L+ ++++V +GL+ V+L+Q S+  A G       F + R     L R T IL   F   
Sbjct: 5   VLLAINIVVCLGLIGVVLLQRSEGGALGMGGGSSSFMTARGAGDLLTRITWILFSIFLLI 64

Query: 61  SIALGMISRYTSTRYK--DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS-SSVVAG 117
           S+ L +++   ++     D +    +DS            +      + A +   +  A 
Sbjct: 65  SLTLTILTGRLNSGGSVVDRLDIQNLDSKALNAAPAAPAPADAAPGPIQAPAPQLNTPAP 124

Query: 118 KRSSS 122
                
Sbjct: 125 TAPQP 129


>gi|223043051|ref|ZP_03613099.1| preprotein translocase, SecG subunit [Staphylococcus capitis
          SK14]
 gi|314933090|ref|ZP_07840456.1| preprotein translocase, SecG subunit [Staphylococcus caprae C87]
 gi|222443905|gb|EEE50002.1| preprotein translocase, SecG subunit [Staphylococcus capitis
          SK14]
 gi|313654409|gb|EFS18165.1| preprotein translocase, SecG subunit [Staphylococcus caprae C87]
          Length = 77

 Score = 50.2 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 30/76 (39%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          M   ++V+ +I  + LV V+L+Q   S+    + +            R     L R T I
Sbjct: 1  MHTLIIVLLIIDCIALVTVVLLQEGKSNGLSGAISGGAEQLFGKQKQRGVDLFLHRLTII 60

Query: 53 LAFFFFATSIALGMIS 68
          LA  FF     +  + 
Sbjct: 61 LAIIFFVLMFCISYLG 76


>gi|325915538|ref|ZP_08177849.1| protein translocase subunit secG [Xanthomonas vesicatoria ATCC
           35937]
 gi|325538254|gb|EGD09939.1| protein translocase subunit secG [Xanthomonas vesicatoria ATCC
           35937]
          Length = 157

 Score = 50.2 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 45/114 (39%), Gaps = 6/114 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           + + L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA
Sbjct: 2   LMLILNVVYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF+ S+ +   + + +     N+      +              P+  +  A
Sbjct: 62  VVFFSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAGELTQPLPQAPAAGA 115


>gi|296447234|ref|ZP_06889164.1| preprotein translocase, SecG subunit [Methylosinus trichosporium
          OB3b]
 gi|296255293|gb|EFH02390.1| preprotein translocase, SecG subunit [Methylosinus trichosporium
          OB3b]
          Length = 174

 Score = 50.2 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS-TAHSLGRFTAILAFFFFA 59
          MQ  ++V+HL+VVV LV +IL Q S+  A G            A+++ R T IL   FF 
Sbjct: 1  MQQVVIVIHLMVVVALVVLILYQKSEGGALGIGGGGLFTGRGQANAMTRATGILGAIFFV 60

Query: 60 TSIALGMISRYT 71
          TSI L ++  + 
Sbjct: 61 TSIILTVLPAWE 72


>gi|67458496|ref|YP_246120.1| preprotein translocase subunit SecG [Rickettsia felis URRWXCal2]
 gi|75537035|sp|Q4UNA3|SECG_RICFE RecName: Full=Protein-export membrane protein secG
 gi|67004029|gb|AAY60955.1| Protein-export membrane protein SecG [Rickettsia felis URRWXCal2]
          Length = 100

 Score = 50.2 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 40/95 (42%), Gaps = 5/95 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-----NFTSVRSTAHSLGRFTAILAF 55
          M   L+ VH+ + V L+ VIL+Q S S    S S        S ++  + L + T IL  
Sbjct: 1  MIEILLFVHITIAVLLIIVILMQRSGSDGISSISGGNNMGVVSAKTVGNFLTKSTIILTT 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
           F   +I L  +S    +     ++    +  ++ 
Sbjct: 61 LFLINAIVLANLSSKKKSDLVSKINEIEENQAENS 95


>gi|148264115|ref|YP_001230821.1| preprotein translocase subunit SecG [Geobacter uraniireducens Rf4]
 gi|146397615|gb|ABQ26248.1| protein translocase subunit secG [Geobacter uraniireducens Rf4]
          Length = 134

 Score = 50.2 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 45/129 (34%), Gaps = 14/129 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+++H+ V + L+ ++L+QS   +        G S +          L + T   A
Sbjct: 1   MTTLLIILHIFVSLALIVIVLLQSGKGAEMGASFGAGGSQSVFGAGGGTTFLSKLTTSAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             F  TS+ L  +S    +          + S KD         ++P       K  S+ 
Sbjct: 61  VIFMLTSLTLAFVSGKGGSSS--------IMSSKDATKAVQKKSAAPMQPPAQGKPLSTE 112

Query: 115 VAGKRSSSR 123
               +   +
Sbjct: 113 PVQTKPVQQ 121


>gi|70727108|ref|YP_254022.1| preprotein translocase subunit SecG [Staphylococcus haemolyticus
          JCSC1435]
 gi|84029490|sp|Q4L4K9|SECG_STAHJ RecName: Full=Probable protein-export membrane protein secG
 gi|68447832|dbj|BAE05416.1| secG [Staphylococcus haemolyticus JCSC1435]
          Length = 77

 Score = 50.2 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 29/76 (38%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          M    +V+ +I  + L+ V+L+Q   S+    + +            R     L R T I
Sbjct: 1  MHTLFIVLLIIDCIALITVVLLQEGKSNGLSGAISGGAEQLFGKQKQRGVDLFLHRLTII 60

Query: 53 LAFFFFATSIALGMIS 68
          LA  FF   I +    
Sbjct: 61 LAVIFFLIMIGISYFG 76


>gi|71275691|ref|ZP_00651976.1| Preprotein translocase SecG subunit [Xylella fastidiosa Dixon]
 gi|71897853|ref|ZP_00680079.1| Preprotein translocase SecG subunit [Xylella fastidiosa Ann-1]
 gi|170729488|ref|YP_001774921.1| preprotein translocase subunit SecG [Xylella fastidiosa M12]
 gi|71163582|gb|EAO13299.1| Preprotein translocase SecG subunit [Xylella fastidiosa Dixon]
 gi|71732408|gb|EAO34462.1| Preprotein translocase SecG subunit [Xylella fastidiosa Ann-1]
 gi|167964281|gb|ACA11291.1| protein-export membrane protein SecG [Xylella fastidiosa M12]
          Length = 132

 Score = 50.2 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 49/125 (39%), Gaps = 8/125 (6%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILAFFF 57
            L V++++V + ++ +IL+Q    +A GS             R  ++ L + T  LA  F
Sbjct: 3   LLNVIYVLVAIAMIVLILMQRGTGAAAGSGFGAGASGTVFGARGASNFLSKSTKWLAVVF 62

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           F  S+ +   +      +      SL+  +            SP L   +  +S++   G
Sbjct: 63  FGISLFMAWYASRG--HHSVAQQNSLMTEVPAAPAAGADQAVSPVLQVPAVPTSTNTPVG 120

Query: 118 KRSSS 122
            +  +
Sbjct: 121 DKEKA 125


>gi|52842988|ref|YP_096787.1| preprotein translocase subunit SecG [Legionella pneumophila
          subsp. pneumophila str. Philadelphia 1]
 gi|52630099|gb|AAU28840.1| preprotein translocase, SecG subunit [Legionella pneumophila
          subsp. pneumophila str. Philadelphia 1]
          Length = 101

 Score = 50.2 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 6/74 (8%)

Query: 7  VVHLIVVVGLVCVILIQSSDSS----AFGSSSNFT--SVRSTAHSLGRFTAILAFFFFAT 60
          ++H+++ V L+ ++LIQ    +    AFGS ++ T    + T   L + T  LA  FF T
Sbjct: 1  MIHVLIAVILIGLVLIQHGKGADIGAAFGSGASNTLFGSQGTGGFLFKLTGGLAITFFIT 60

Query: 61 SIALGMISRYTSTR 74
          S+ L  +    + +
Sbjct: 61 SLMLSYMVSTQNQK 74


>gi|149194779|ref|ZP_01871874.1| hypothetical protein CMTB2_05342 [Caminibacter mediatlanticus TB-2]
 gi|149135202|gb|EDM23683.1| hypothetical protein CMTB2_05342 [Caminibacter mediatlanticus TB-2]
          Length = 107

 Score = 50.2 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/114 (16%), Positives = 44/114 (38%), Gaps = 12/114 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG----SSSNFTSVRSTAHSLGRFTAILAFF 56
           M   LM++ +++V+ +  ++L+Q S+S   G    S+++        + L + T  L   
Sbjct: 1   MTGILMIIQIVLVIAITILVLLQRSESMGLGAYSSSNNSVFGAGGPMNFLTKATMTLGLL 60

Query: 57  FFATSIALGMISRYTSTRYK-DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
           F   ++ L  +    +     DN++   ++               P +     K
Sbjct: 61  FVLNTLTLVYLYNKQANTSALDNVNIKKIEKTTP-------TPQVPTVPQTPTK 107


>gi|56478175|ref|YP_159764.1| preprotein translocase subunit SecG [Aromatoleum aromaticum EbN1]
 gi|56314218|emb|CAI08863.1| Protein-export membrane protein SecG [Aromatoleum aromaticum EbN1]
          Length = 119

 Score = 50.2 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/113 (18%), Positives = 50/113 (44%), Gaps = 7/113 (6%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAFF 56
             ++ +H++V + ++ ++L+Q    +  G++    +  S       A+ L R T +LA  
Sbjct: 7   SIVLTIHVLVGLFIIGLVLMQHGKGADAGAAFGGGASGSVFGSSGSANFLSRTTGVLATV 66

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
           FF TS++L  ++    ++    M  +   S     + +  DG +    + +  
Sbjct: 67  FFITSLSLSYLASNKPSQPSSVMEGASALS-APATDASPADGGAEDSKAKAIP 118


>gi|15616117|ref|NP_244422.1| preprotein translocase subunit SecG [Bacillus halodurans C-125]
 gi|10176179|dbj|BAB07274.1| protein translocation protein [Bacillus halodurans C-125]
          Length = 76

 Score = 50.2 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          MQ    V+ +IV + L+ V+L+QS  S+    + +            R     L R T +
Sbjct: 1  MQTVAFVLLIIVSISLIAVVLLQSGRSAGLSGAISGGAEQLVGKQKARGIDAFLARATVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +IA+   
Sbjct: 61 LAVLFFVLTIAVAYF 75


>gi|303246610|ref|ZP_07332888.1| preprotein translocase, SecG subunit [Desulfovibrio fructosovorans
           JJ]
 gi|302491950|gb|EFL51828.1| preprotein translocase, SecG subunit [Desulfovibrio fructosovorans
           JJ]
          Length = 130

 Score = 50.2 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 48/129 (37%), Gaps = 10/129 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS-----AFGSSSNFTSVRSTAHSLGRFTAILAF 55
           M   ++ VH++  V ++ ++L+QS           GS S F S       L + TA+   
Sbjct: 1   MTTLIITVHVLACVAVIVLVLLQSGKEGMGVIFGGGSQSVFGST-GAGGLLVKLTALFGA 59

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            F  TS+A  + +      ++ N    ++D+         G       D+   K  +   
Sbjct: 60  IFLITSLAYNVYTG----SHERNAKSVMIDASGAPIAPPAGVAPEATKDAQPKKGVTFED 115

Query: 116 AGKRSSSRT 124
              + + + 
Sbjct: 116 VPAKQAPQK 124


>gi|29349786|ref|NP_813289.1| preprotein translocase subunit SecG [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29341697|gb|AAO79483.1| putative protein-export membrane protein [Bacteroides
           thetaiotaomicron VPI-5482]
          Length = 131

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 49/126 (38%), Gaps = 4/126 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS----SNFTSVRSTAHSLGRFTAILAFF 56
           M +  +++ +I  + +  ++LIQ+S      S     +    VR T   L + T  LA F
Sbjct: 1   MYLLFIILMVIAALLMCFIVLIQNSKGGGLASGFSSSNAIMGVRKTTDFLEKATWGLAIF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               S+A   +   +S      + ++  +   +  N   G  +     +  A+S+ +  A
Sbjct: 61  MVVMSVATAYVVPSSSAAKDVLLEQAQKEQQTNPYNMPTGTAAPQTDATAPAESAPATEA 120

Query: 117 GKRSSS 122
               + 
Sbjct: 121 PATETP 126


>gi|193084251|gb|ACF09913.1| preprotein translocase subunit SecG [uncultured marine group III
          euryarchaeote KM3-28-E8]
          Length = 109

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 37 TSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
           SVR TA+ L R TA++A  F  TSI L +++       +  + R      ++Q
Sbjct: 46 MSVRGTANFLTRATAVIAACFMVTSITLAILAGNRG-GSESILDRPGTSVPQNQ 98


>gi|317153267|ref|YP_004121315.1| preprotein translocase subunit SecG [Desulfovibrio aespoeensis
          Aspo-2]
 gi|316943518|gb|ADU62569.1| preprotein translocase, SecG subunit [Desulfovibrio aespoeensis
          Aspo-2]
          Length = 115

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 36/83 (43%), Gaps = 4/83 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSS-DSSA--FGSSSNFT-SVRSTAHSLGRFTAILAFF 56
          M   ++V+H++  + L+  +++QS  +     FG  S+           L + TA LA  
Sbjct: 1  MDNLVIVIHVLACIFLIGAVMLQSGHEGMGVIFGGGSSTMFGSTGAGGILVKITAGLATV 60

Query: 57 FFATSIALGMISRYTSTRYKDNM 79
          F  TS+   +I+    +     M
Sbjct: 61 FLITSLTYNVITGNKVSTQDSLM 83


>gi|288554072|ref|YP_003426007.1| preprotein translocase subunit SecG [Bacillus pseudofirmus OF4]
 gi|288545232|gb|ADC49115.1| preprotein translocase subunit SecG [Bacillus pseudofirmus OF4]
          Length = 76

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          MQ    V+ +IV + L+ V+L+QS  S+    + +            R     L R T +
Sbjct: 1  MQTVAFVMLIIVSIALIAVVLLQSGRSAGLSGAISGGAEQLVGKQKARGIDAVLSRATVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +IA+   
Sbjct: 61 LAVLFFVLTIAVAYF 75


>gi|253569850|ref|ZP_04847259.1| preprotein translocase subunit SecG [Bacteroides sp. 1_1_6]
 gi|298384055|ref|ZP_06993616.1| preprotein translocase SecG subunit [Bacteroides sp. 1_1_14]
 gi|251840231|gb|EES68313.1| preprotein translocase subunit SecG [Bacteroides sp. 1_1_6]
 gi|298263659|gb|EFI06522.1| preprotein translocase SecG subunit [Bacteroides sp. 1_1_14]
          Length = 131

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 49/126 (38%), Gaps = 4/126 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS----SNFTSVRSTAHSLGRFTAILAFF 56
           M +  +++ +I  + +  ++LIQ+S      S     +    VR T   L + T  LA F
Sbjct: 1   MYLLFIILMVIAALLMCFIVLIQNSKGGGLASGFSSSNAIMGVRKTTDFLEKATWGLAIF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               S+A   +   +S      + ++  +   +  N   G  +     +  A+S+ +  A
Sbjct: 61  MVVMSVATAYVVPSSSAAKDVLLEQAQKEQQTNPYNMPTGTAAPQTDATAPAESAPATEA 120

Query: 117 GKRSSS 122
               + 
Sbjct: 121 PATETP 126


>gi|313145591|ref|ZP_07807784.1| preprotein translocase subunit SecG [Bacteroides fragilis 3_1_12]
 gi|313134358|gb|EFR51718.1| preprotein translocase subunit SecG [Bacteroides fragilis 3_1_12]
          Length = 126

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 46/108 (42%), Gaps = 4/108 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M + L+++ +I  + +  ++LIQ+S      S  +       VR T   L + T  LA F
Sbjct: 1   MYLLLVILMVIAAILMCFIVLIQNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWGLAAF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
               SIA   +   +S++ +D +        +    +     ++PK D
Sbjct: 61  MVVMSIATAYVVPTSSSKTQDVIMEQAQQEEQTNPYNLPVGTTAPKTD 108


>gi|255693927|ref|ZP_05417602.1| putative Preprotein translocase SecG subunit [Bacteroides
           finegoldii DSM 17565]
 gi|260620238|gb|EEX43109.1| putative Preprotein translocase SecG subunit [Bacteroides
           finegoldii DSM 17565]
          Length = 131

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 46/126 (36%), Gaps = 4/126 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS----SNFTSVRSTAHSLGRFTAILAFF 56
           M +  +++ +I  + +  ++LIQ+S      S     +    VR T   L + T  LA F
Sbjct: 1   MYLLFVILMVIAALLMCFIVLIQNSKGGGLASGFSSSNAIMGVRKTTDFLEKTTWGLAIF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               SIA   +   ++      + ++  +   +  N   G  +       +   ++   A
Sbjct: 61  MVVMSIATAYVVPSSAVATDAVLEQAQKEQQTNPYNLPAGTAAPQTEAPAADAPATETPA 120

Query: 117 GKRSSS 122
               + 
Sbjct: 121 PATETP 126


>gi|320107118|ref|YP_004182708.1| preprotein translocase subunit SecG [Terriglobus saanensis
          SP1PR4]
 gi|319925639|gb|ADV82714.1| preprotein translocase, SecG subunit [Terriglobus saanensis
          SP1PR4]
          Length = 99

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 6/75 (8%)

Query: 16 LVCVILIQSSDS----SAFGSSSNFTSV--RSTAHSLGRFTAILAFFFFATSIALGMISR 69
          L+ V+L+Q   S     AFG   + T+   R  A+ L + T   A  F  TSI L ++  
Sbjct: 19 LIGVVLLQQGKSADLAGAFGGQGSQTAFGPRGAANLLTKLTTWSAVLFMVTSIGLTVLLA 78

Query: 70 YTSTRYKDNMHRSLV 84
           TS     +  ++  
Sbjct: 79 KTSDHSVLSGEKTTQ 93


>gi|242310136|ref|ZP_04809291.1| preprotein translocase subunit SecG [Helicobacter pullorum MIT
          98-5489]
 gi|239523433|gb|EEQ63299.1| preprotein translocase subunit SecG [Helicobacter pullorum MIT
          98-5489]
          Length = 114

 Score = 49.8 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 6/92 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
          M   L+VV  ++ + +  V+L+Q S S   G+ S         +  A  L + T +L F 
Sbjct: 1  MSGILLVVQFVLAIIITIVVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKTTFVLGFL 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
          F   +IALG    YT    K  +    + + +
Sbjct: 61 FVVNTIALGYF--YTKDSQKSIVDNVEIPATQ 90


>gi|91789117|ref|YP_550069.1| preprotein translocase subunit SecG [Polaromonas sp. JS666]
 gi|91698342|gb|ABE45171.1| protein translocase subunit secG [Polaromonas sp. JS666]
          Length = 140

 Score = 49.4 bits (116), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 34/84 (40%), Gaps = 6/84 (7%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
            ++ + ++  +G++ +IL+Q    +        G S +      +A+ L R T +LA  
Sbjct: 6  TIVLALQMLAALGMIGLILVQHGKGADMGAAFGSGGSGSLFGASGSANFLSRTTGVLAAV 65

Query: 57 FFATSIALGMISRYTSTRYKDNMH 80
          FFA ++ L              + 
Sbjct: 66 FFACTLLLAYFGNAQPRTSSSVLD 89


>gi|319761761|ref|YP_004125698.1| preprotein translocase, secg subunit [Alicycliphilus
          denitrificans BC]
 gi|317116322|gb|ADU98810.1| preprotein translocase, SecG subunit [Alicycliphilus
          denitrificans BC]
          Length = 121

 Score = 49.4 bits (116), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 6/84 (7%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
            ++ + ++  +G++ +ILIQ    +        GSS +      +A+ L R TA+LA  
Sbjct: 6  NVILAIQMLAALGMIGLILIQHGKGADMGAAFGSGSSGSLFGASGSANFLSRTTAVLATI 65

Query: 57 FFATSIALGMISRYTSTRYKDNMH 80
          FF  ++AL              + 
Sbjct: 66 FFVATLALAYFGNQRPASSGSVLE 89


>gi|288801259|ref|ZP_06406714.1| preprotein translocase, SecG subunit [Prevotella sp. oral taxon 299
           str. F0039]
 gi|288331870|gb|EFC70353.1| preprotein translocase, SecG subunit [Prevotella sp. oral taxon 299
           str. F0039]
          Length = 129

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/129 (16%), Positives = 42/129 (32%), Gaps = 5/129 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M    +++ L+    ++ ++LIQ S        F SS++   VR T   + + T  LA  
Sbjct: 1   MYTLFIILILLASFFMIAIVLIQESKGGGLASNFSSSNSIMGVRKTTDVVEKTTWTLAAS 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSL-VDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
               S+    ++   +T        S    +        FG  S+      +   +    
Sbjct: 61  MVVLSVICAYVAPKAATEESAVERMSTEAPATNPNTTPGFGATSTANTKPTTGDVAPQAT 120

Query: 116 AGKRSSSRT 124
                +   
Sbjct: 121 QQTPKTPEK 129


>gi|157693785|ref|YP_001488247.1| preprotein translocase subunit SecG [Bacillus pumilus SAFR-032]
 gi|194015216|ref|ZP_03053832.1| preprotein translocase, SecG subunit [Bacillus pumilus ATCC 7061]
 gi|157682543|gb|ABV63687.1| preprotein translocase subunit SecG [Bacillus pumilus SAFR-032]
 gi|194012620|gb|EDW22186.1| preprotein translocase, SecG subunit [Bacillus pumilus ATCC 7061]
          Length = 77

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          M  F++ + +IV + L+ V+L+QSS S+    + +            R     L R T I
Sbjct: 1  MHAFVITLLVIVSIALIIVVLLQSSKSAGLSGAISGGAEQLFGKQKARGLDLILHRLTVI 60

Query: 53 LAFFFFATSIALGMIS 68
          L+  FF  ++AL  + 
Sbjct: 61 LSVLFFILTLALAYLG 76


>gi|296134186|ref|YP_003641433.1| preprotein translocase, SecG subunit [Thermincola sp. JR]
 gi|296032764|gb|ADG83532.1| preprotein translocase, SecG subunit [Thermincola potens JR]
          Length = 74

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 6/73 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAF------GSSSNFTSVRSTAHSLGRFTAILA 54
          M+I +++VH+++ +G++  +L+QS  S+        G+ + F   +     L + +   A
Sbjct: 1  MKIAVIIVHILLALGVIVTVLLQSGKSAGLSGAIAGGADAIFGKKKGMDEFLSKLSTTFA 60

Query: 55 FFFFATSIALGMI 67
            F  TS+AL +I
Sbjct: 61 IGFLITSLALSII 73


>gi|213581062|ref|ZP_03362888.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 92

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/100 (16%), Positives = 36/100 (36%), Gaps = 15/100 (15%)

Query: 19  VILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTS 72
           +I++Q    +        G+S+       + + + R TA+LA  FF  S+ LG I+   +
Sbjct: 1   MIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLATLFFIISLVLGNINSNKT 60

Query: 73  TRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
            +  +          ++       + + P   +       
Sbjct: 61  NKGSE---------WENLSAPAKTEQTQPAAPAQPTSDIP 91


>gi|226939455|ref|YP_002794528.1| SecG [Laribacter hongkongensis HLHK9]
 gi|226714381|gb|ACO73519.1| SecG [Laribacter hongkongensis HLHK9]
          Length = 120

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/116 (16%), Positives = 52/116 (44%), Gaps = 9/116 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILA 54
           ++  + +V+++  + ++ ++L+Q    +  G++    S  S       A+ L R TA+ +
Sbjct: 4   LKTLVWIVNIVSAIAVIVLVLMQHGKGADMGAAFGSGSSGSLFGASGSANFLSRTTAVCS 63

Query: 55  FFFFATSIALGMI---SRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             FFAT +A+ ++    +  +     +         ++ G++     S+P  + + 
Sbjct: 64  TVFFATCLAMALMFGVPKKENALGVMSGQAVPQKVQQNAGDNLANQNSNPSGNKIP 119


>gi|34496395|ref|NP_900610.1| protein-export integral membrane protein [Chromobacterium violaceum
           ATCC 12472]
 gi|34102248|gb|AAQ58614.1| protein-export integral membrane protein [Chromobacterium violaceum
           ATCC 12472]
          Length = 118

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 51/111 (45%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
           ++  + +V+L+    ++ ++L+Q    +        GSS +      +A+ L R TA++A
Sbjct: 4   LKTLIWIVNLLSAASIIVLVLMQHGKGADMGAAFGSGSSGSLFGASGSANFLSRTTAVVA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF+TS+AL  +S    +      + S ++ +  Q      + ++    S
Sbjct: 64  VVFFSTSMALVFLSGGGKSDLGVMGNGSKIEQVAPQIPAGAPNKNASGTAS 114


>gi|228474360|ref|ZP_04059095.1| preprotein translocase, SecG subunit [Staphylococcus hominis
          SK119]
 gi|314936919|ref|ZP_07844266.1| preprotein translocase, SecG subunit [Staphylococcus hominis
          subsp. hominis C80]
 gi|228271719|gb|EEK13066.1| preprotein translocase, SecG subunit [Staphylococcus hominis
          SK119]
 gi|313655538|gb|EFS19283.1| preprotein translocase, SecG subunit [Staphylococcus hominis
          subsp. hominis C80]
          Length = 77

 Score = 49.4 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 30/76 (39%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          M    MV+ +I  + L+ V+L+Q S S+    + +            R     L R T +
Sbjct: 1  MHTLFMVLLIIDCIALITVVLLQESKSNGLSGAISGGAEQLFGKQKQRGVDLFLHRLTIV 60

Query: 53 LAFFFFATSIALGMIS 68
          LA  FF   I +    
Sbjct: 61 LAIIFFLIMIGISYFG 76


>gi|295401520|ref|ZP_06811489.1| preprotein translocase, SecG subunit [Geobacillus
          thermoglucosidasius C56-YS93]
 gi|312109555|ref|YP_003987871.1| preprotein translocase subunit SecG [Geobacillus sp. Y4.1MC1]
 gi|294976432|gb|EFG52041.1| preprotein translocase, SecG subunit [Geobacillus
          thermoglucosidasius C56-YS93]
 gi|311214656|gb|ADP73260.1| preprotein translocase, SecG subunit [Geobacillus sp. Y4.1MC1]
          Length = 77

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          M   L+ + +IV + L+ V+L+QS  S+    +              R     L R T +
Sbjct: 1  MHTLLVTLLVIVSIALIVVVLLQSGRSAGLSGAITGGAEQLFGKQKARGLDAVLQRITVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  SIA+  +
Sbjct: 61 LAVLFFVLSIAVTYM 75


>gi|224418729|ref|ZP_03656735.1| preprotein translocase subunit SecG [Helicobacter canadensis MIT
           98-5491]
 gi|253826743|ref|ZP_04869628.1| protein-export membrane protein secG [Helicobacter canadensis MIT
           98-5491]
 gi|313142246|ref|ZP_07804439.1| preprotein translocase subunit SecG [Helicobacter canadensis MIT
           98-5491]
 gi|253510149|gb|EES88808.1| protein-export membrane protein secG [Helicobacter canadensis MIT
           98-5491]
 gi|313131277|gb|EFR48894.1| preprotein translocase subunit SecG [Helicobacter canadensis MIT
           98-5491]
          Length = 115

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 44/113 (38%), Gaps = 11/113 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M   L+++  ++ V +  ++L+Q S S   G+ S         +  A  L + T +L F 
Sbjct: 1   MSGILLIIQFVLAVIITIIVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKTTFVLGFL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
           F   +IALG      S         S++D+++   N      + P        
Sbjct: 61  FVVNTIALGYFYTKDSQS-------SILDNVEIPANPTPATPAVPTAPVAPQS 106


>gi|330431160|gb|AEC16219.1| conserved hypothetical protein [Gallibacterium anatis UMN179]
          Length = 118

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 27 SSAFGSSSNFTSVR--STAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKD 77
           ++FG+ ++ T        + L R T ILA  FFA S+ LG ++ ++S    +
Sbjct: 31 GASFGAGASGTVFGASGAGNFLTRTTTILAIVFFAISLLLGNLTAHSSKPKGN 83


>gi|152991580|ref|YP_001357302.1| preprotein translocase subunit G [Nitratiruptor sp. SB155-2]
 gi|151423441|dbj|BAF70945.1| preprotein translocase subunit G [Nitratiruptor sp. SB155-2]
          Length = 113

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 41/122 (33%), Gaps = 13/122 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M   L ++ +++ + L  VIL+Q S S   G+ S         +     L R T  LA  
Sbjct: 1   MIKVLFILQIVLAIILTIVILLQKSSSIGLGAYSGSNESVFGAKGPQGFLARLTFFLATV 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           F   +I LG +  Y     K  +    V              + P   +    +     A
Sbjct: 61  FVFNTILLGYL--YNKNYTKSVVDTIKVQKTVPI-------PTVPTPITEQKSNVPEAPA 111

Query: 117 GK 118
            K
Sbjct: 112 AK 113


>gi|153809264|ref|ZP_01961932.1| hypothetical protein BACCAC_03576 [Bacteroides caccae ATCC 43185]
 gi|149128034|gb|EDM19255.1| hypothetical protein BACCAC_03576 [Bacteroides caccae ATCC 43185]
          Length = 132

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 46/114 (40%), Gaps = 4/114 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS----SNFTSVRSTAHSLGRFTAILAFF 56
           M +  +++ +I  + +  ++LIQ+S      S     +    VR T   L + T  LA F
Sbjct: 1   MYLLFVILMVIAALLMCFIVLIQNSKGGGLASGFSSSNAIMGVRKTTDFLEKATWGLAIF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
               SIA   +  ++S      + ++  +   +  N   G  +     +  A+S
Sbjct: 61  MVIMSIATAYVVPHSSAVKDAVLEQAQKEQQTNPYNLPAGTAAPQTDATAPAES 114


>gi|88705682|ref|ZP_01103392.1| Preprotein translocase SecG subunit [Congregibacter litoralis KT71]
 gi|88700195|gb|EAQ97304.1| Preprotein translocase SecG subunit [Congregibacter litoralis KT71]
          Length = 148

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 58/138 (42%), Gaps = 14/138 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILA 54
           ++  ++V HL++ + ++ +I+IQ    +    +FG+ ++ T      + + L R TA + 
Sbjct: 6   IEQLVLVTHLLLSLAIIGLIIIQQGKGADAGASFGAGASQTVFGSTGSGNVLTRATAWMV 65

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF--------GDGSSPKLDSV 106
             FF TS  L +I++  +    +       +S     + +          +G  P +D  
Sbjct: 66  TLFFITSFGLAVIAKNKTAAVDEFAIPLPTNSAPATLDSDMQAVDDMRPAEGDLPVVDDS 125

Query: 107 SAKSSSSVVAGKRSSSRT 124
               S+  +     S++ 
Sbjct: 126 MPSMSADGMDDTVDSAQE 143


>gi|87200034|ref|YP_497291.1| protein translocase subunit secG [Novosphingobium aromaticivorans
          DSM 12444]
 gi|87135715|gb|ABD26457.1| protein translocase subunit secG [Novosphingobium aromaticivorans
          DSM 12444]
          Length = 131

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFG---SSSNFTSVRSTAHSLGRFTAILAFFFFA 59
          IFL VV  I+   LV VIL+Q S+    G   S + F S R  A  + R T +LA  F  
Sbjct: 5  IFLTVVQAIIAALLVVVILMQKSEGGGLGVGGSPAGFMSARGAADFMTRATTVLASLFVL 64

Query: 60 TSIALGMIS 68
           SI L  ++
Sbjct: 65 LSIILAALA 73


>gi|330826541|ref|YP_004389844.1| preprotein translocase subunit SecG [Alicycliphilus denitrificans
          K601]
 gi|329311913|gb|AEB86328.1| preprotein translocase, SecG subunit [Alicycliphilus
          denitrificans K601]
          Length = 121

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 6/84 (7%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
            ++ + ++  +G++ +ILIQ    +        GSS +      +A+ L R TA+LA  
Sbjct: 6  NIILAIQMLAALGMIGLILIQHGKGADMGAAFGSGSSGSLFGASGSANFLSRTTAVLATI 65

Query: 57 FFATSIALGMISRYTSTRYKDNMH 80
          FF  ++AL              + 
Sbjct: 66 FFVATLALAYFGNQRPASSGSVLE 89


>gi|319901407|ref|YP_004161135.1| protein translocase subunit secG [Bacteroides helcogenes P 36-108]
 gi|319416438|gb|ADV43549.1| protein translocase subunit secG [Bacteroides helcogenes P 36-108]
          Length = 120

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 45/121 (37%), Gaps = 6/121 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M + L+++ +I  V +  ++LIQ+S      S  +       VR T   L + T  LA  
Sbjct: 1   MYLLLIILMVIASVLMCFIVLIQNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWTLAAV 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               SIA       +S +  D +        +++ N       +    + +  + +    
Sbjct: 61  MVVFSIASAYTIPSSSAKSGDVIMEQA--QQEEKTNPYNMPVGTAAPQTEAPAAPTEQPV 118

Query: 117 G 117
           G
Sbjct: 119 G 119


>gi|258591138|emb|CBE67433.1| putative Protein-export membrane protein, secG-like [NC10
          bacterium 'Dutch sediment']
          Length = 123

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 6/81 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSV--RSTAHSLGRFTAILA 54
          M I L V+HL++ + L+ ++L+QS   +    AFG  S+ T    R  A  L + T   A
Sbjct: 1  MVIALSVIHLLIALVLIVIVLLQSGKGADIGAAFGGGSSQTVFGGRGAATFLSKLTLAAA 60

Query: 55 FFFFATSIALGMISRYTSTRY 75
            F  +SI L + S    +  
Sbjct: 61 VLFMVSSIILTIWSERRGSSS 81


>gi|254488395|ref|ZP_05101600.1| preprotein translocase, SecG subunit [Roseobacter sp. GAI101]
 gi|214045264|gb|EEB85902.1| preprotein translocase, SecG subunit [Roseobacter sp. GAI101]
          Length = 119

 Score = 48.6 bits (114), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 30/116 (25%), Positives = 54/116 (46%), Gaps = 9/116 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           M+  +++VHLI+ +GL+ V+L+Q S+       G      S R+ A ++G+ T +LA  F
Sbjct: 1   MENVVLIVHLILALGLIAVVLLQRSEGGGLGMGGGGGGAVSGRAAATAMGKITWVLATLF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             TSI L +I+   S           + +     N+     + P  DS+   + + 
Sbjct: 61  IITSITLTIIAAEKSAGSSVIDR---LGATPPALNE---APAMPDADSLLPPTPAD 110


>gi|239906469|ref|YP_002953210.1| protein-export membrane protein SecG [Desulfovibrio magneticus
           RS-1]
 gi|239796335|dbj|BAH75324.1| protein-export membrane protein SecG [Desulfovibrio magneticus
           RS-1]
          Length = 127

 Score = 48.6 bits (114), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 41/107 (38%), Gaps = 6/107 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS-----AFGSSSNFTSVRSTAHSLGRFTAILAF 55
           M   ++ VH++  V ++ ++L+QS           GS S F S       L + TA+   
Sbjct: 1   MTTLIITVHVLACVAVIILVLLQSGKEGMGVIFGGGSQSVFGST-GAGGLLVKLTALFGA 59

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
            F  TS+A  + S       K  M  +    ++          + PK
Sbjct: 60  IFLITSLAYNVYSGSHKRSAKSVMMDASGAPVQIPAAVEGAKDAEPK 106


>gi|238783518|ref|ZP_04627540.1| Protein-export membrane protein secG [Yersinia bercovieri ATCC
           43970]
 gi|238715573|gb|EEQ07563.1| Protein-export membrane protein secG [Yersinia bercovieri ATCC
           43970]
          Length = 91

 Score = 48.6 bits (114), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/95 (16%), Positives = 34/95 (35%), Gaps = 11/95 (11%)

Query: 21  LIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTR 74
           ++Q    +        G+S+       + + + R TA+LA  FF  S+ LG +S     +
Sbjct: 1   MLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLAALFFVISLILGNMSTNQGHK 60

Query: 75  YKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             +       +  +    +     ++P   S    
Sbjct: 61  GSE-----WENLGQPAKTEQTTAPAAPVTPSSDIP 90


>gi|238755153|ref|ZP_04616499.1| Protein-export membrane protein secG [Yersinia ruckeri ATCC 29473]
 gi|238706600|gb|EEP98971.1| Protein-export membrane protein secG [Yersinia ruckeri ATCC 29473]
          Length = 95

 Score = 48.6 bits (114), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/104 (16%), Positives = 37/104 (35%), Gaps = 15/104 (14%)

Query: 17  VCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY 70
           + +I++Q    +        G+S+       + + + R TA+LA  FF  S+ LG +S  
Sbjct: 1   MALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLATLFFVISLILGNMSTN 60

Query: 71  TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
              +  +          ++ G       ++  +      S    
Sbjct: 61  QGRQGSE---------WENLGQPAKAVQTTAPVAPAKPSSDIPQ 95


>gi|77359823|ref|YP_339398.1| preprotein translocase subunit SecG [Pseudoalteromonas
          haloplanktis TAC125]
 gi|76874734|emb|CAI85955.1| protein-export membrane protein secG(General Secretory Pathway)
          [Pseudoalteromonas haloplanktis TAC125]
          Length = 117

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 15/66 (22%), Positives = 30/66 (45%), Gaps = 6/66 (9%)

Query: 18 CVILIQSSDSS----AFGSSSNFTSVR--STAHSLGRFTAILAFFFFATSIALGMISRYT 71
           ++LIQ    +    +FG+ ++ T        + + + T +LA  FF  SI LG ++   
Sbjct: 18 GMVLIQQGKGADMGSSFGAGASSTVFGSSGAGNFMTKTTTVLASVFFILSIVLGNLTASH 77

Query: 72 STRYKD 77
            +  +
Sbjct: 78 IKKTDE 83


>gi|193215566|ref|YP_001996765.1| preprotein translocase subunit SecG [Chloroherpeton thalassium ATCC
           35110]
 gi|193089043|gb|ACF14318.1| preprotein translocase, SecG subunit [Chloroherpeton thalassium
           ATCC 35110]
          Length = 120

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 11/120 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
           M  F++V+ +IV + LV VIL+Q+S  +   S  +         VR TA  L + T++LA
Sbjct: 1   MHTFIVVLAIIVAILLVIVILLQNSKGAGLASGLSAAGSVQTLGVRQTADFLSKATSVLA 60

Query: 55  FFFFATSIA--LGMISRYTSTRYKDNMHRSLVDSIKDQG---NDNFGDGSSPKLDSVSAK 109
             F    I   L M S   + + +  + +++            D  G+ ++P      A+
Sbjct: 61  TAFMVLCIIAELTMPSSSDTVQKESVIQKNVPGVPSSSIPLPGDASGEVNTPSETGTPAE 120


>gi|239828272|ref|YP_002950896.1| preprotein translocase subunit SecG [Geobacillus sp. WCH70]
 gi|239808565|gb|ACS25630.1| preprotein translocase, SecG subunit [Geobacillus sp. WCH70]
          Length = 77

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          M   L+ + +IV +GL+ ++L+QS  S+    +              R     L R T +
Sbjct: 1  MHTLLVTLLVIVSIGLIVIVLLQSGRSAGLSGAITGGAEQLFGKQKARGLDAVLQRITVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  SIA+  +
Sbjct: 61 LAVLFFVLSIAVTYM 75


>gi|242373016|ref|ZP_04818590.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          M23864:W1]
 gi|242349170|gb|EES40771.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          M23864:W1]
          Length = 77

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 29/76 (38%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT--------SVRSTAHSLGRFTAI 52
          M   ++V+ +I  + LV V+L+Q   S+    + +            R     L R T  
Sbjct: 1  MHTLIIVLLIIDCIALVTVVLLQEGKSNGLSGAISGGAEQLFGKQKQRGVDLFLHRLTIF 60

Query: 53 LAFFFFATSIALGMIS 68
          LA  FF     +  + 
Sbjct: 61 LAIIFFVLMFCISYLG 76


>gi|258405668|ref|YP_003198410.1| preprotein translocase, SecG subunit [Desulfohalobium retbaense DSM
           5692]
 gi|257797895|gb|ACV68832.1| preprotein translocase, SecG subunit [Desulfohalobium retbaense DSM
           5692]
          Length = 118

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 46/117 (39%), Gaps = 9/117 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   ++ VH+IV V LV ++L+QS          GSS            L + TA  A  
Sbjct: 1   MNALILTVHIIVCVSLVTLVLLQSGKEGMGVIFGGSSGTVFGSSGAGGLLSKLTAGAATI 60

Query: 57  FFATSIALGMISRYTSTRYKDNM-----HRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
           F  TS+A   +S       ++++      +    +       + G   S  ++S SA
Sbjct: 61  FIITSLAFTYMSAQERQAPRESVVLEQPAQQQAPATAPGTEKSAGQEGSKAVNSSSA 117


>gi|313904160|ref|ZP_07837539.1| preprotein translocase, SecG subunit [Eubacterium cellulosolvens
          6]
 gi|313470962|gb|EFR66285.1| preprotein translocase, SecG subunit [Eubacterium cellulosolvens
          6]
          Length = 81

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 10/76 (13%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT----------SVRSTAHSLGRFT 50
          ++  L V+  +  +G++ VIL+Q       G+ +  +            RS   +L R T
Sbjct: 4  LRTVLTVLFALDCIGMIIVILMQQGKDRGLGAIAGVSNNTETYWSKNKGRSKEGNLIRIT 63

Query: 51 AILAFFFFATSIALGM 66
           ILA  FFA S+ L +
Sbjct: 64 RILAILFFALSVVLNI 79


>gi|146329507|ref|YP_001209712.1| preprotein translocase, SecG subunit [Dichelobacter nodosus
           VCS1703A]
 gi|146232977|gb|ABQ13955.1| preprotein translocase, SecG subunit [Dichelobacter nodosus
           VCS1703A]
          Length = 125

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/131 (16%), Positives = 50/131 (38%), Gaps = 13/131 (9%)

Query: 1   MQIFLM-VVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS------VRSTAHSLGRFTAIL 53
           M   ++ ++ +   + L  +IL+Q S  +  G+S    +       +     L + T  L
Sbjct: 1   MTTLIVQIIFITTAIALSILILLQQSKGAGLGASFGAGASATVFGAKGAGSFLYKLTRFL 60

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
           AF FF +++ +  +   + T        S