BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780196|ref|YP_003064609.1| hypothetical protein
CLIBASIA_00405 [Candidatus Liberibacter asiaticus str. psy62]
         (125 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|254780196|ref|YP_003064609.1| hypothetical protein CLIBASIA_00405 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039873|gb|ACT56669.1| hypothetical protein CLIBASIA_00405 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 125

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 125/125 (100%), Positives = 125/125 (100%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT
Sbjct: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120
           SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS
Sbjct: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120

Query: 121 SSRTK 125
           SSRTK
Sbjct: 121 SSRTK 125


>gi|240850255|ref|YP_002971648.1| preprotein translocase SecG subunit [Bartonella grahamii as4aup]
 gi|240267378|gb|ACS50966.1| preprotein translocase SecG subunit [Bartonella grahamii as4aup]
          Length = 150

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/127 (36%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG--SSSNFTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV VILIQ S+    G  +SS     R + + L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVITLVGVILIQPSEGGGLGVSNSSGLMKTRGSRNPLTRLTAILACCFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
             SI L ++    S    D + R  V+S  +Q + N G  S P  D  S+ S    + G 
Sbjct: 61  VVSIGLTVV-GNISNSSSDILKRIPVNS--EQNSTNKGSESVPSSDGESSPSILEQLGGN 117

Query: 119 RSSSRTK 125
            +S + +
Sbjct: 118 SNSPQEQ 124


>gi|163868050|ref|YP_001609254.1| preprotein translocase subunit SecG [Bartonella tribocorum CIP
           105476]
 gi|161017701|emb|CAK01259.1| preprotein translocase SecG subunit [Bartonella tribocorum CIP
           105476]
          Length = 150

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 45/127 (35%), Positives = 63/127 (49%), Gaps = 5/127 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG--SSSNFTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV VILIQ S+    G  +SS     R + + L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVITLVGVILIQPSEGGGLGVSNSSGLMKTRGSRNPLTRLTAILACCFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
             SIAL ++    S    D + R  V+S  +Q + N    S P  D  S  S    + G 
Sbjct: 61  VVSIALTVVGSI-SNSGFDILKRIPVNS--EQNSTNKNSESVPSSDGESQPSILEQLGGT 117

Query: 119 RSSSRTK 125
               + +
Sbjct: 118 SDFQQER 124


>gi|254448886|ref|ZP_05062342.1| preprotein translocase, SecG subunit [gamma proteobacterium
           HTCC5015]
 gi|198261576|gb|EDY85865.1| preprotein translocase, SecG subunit [gamma proteobacterium
           HTCC5015]
          Length = 124

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 57/127 (44%), Gaps = 9/127 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M+  L+VVH+++ +GL+ +ILIQ    +        G+S            + + T  +A
Sbjct: 1   METALLVVHVLLSIGLIALILIQHGKGADAGAAFGSGASGTVFGASGAGSFMTKLTTWIA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FFATS+AL   +  TS+     + R++    ++Q  +   + S+  +    A S S V
Sbjct: 61  VSFFATSLALAYTAANTSSEPTSVIERTMQ---QEQSGEEAAEQSTGDVPVAPASSDSDV 117

Query: 115 VAGKRSS 121
                + 
Sbjct: 118 PTAPAAE 124


>gi|319408343|emb|CBI81996.1| Protein-export membrane protein [Bartonella schoenbuchensis R1]
          Length = 151

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 3/127 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+H ++V+ L+ V+LIQ S+    G+SS   F S R T + L R T ILA  FF
Sbjct: 1   MQTVLIVIHFLIVITLIGVVLIQPSEGGGLGTSSGSGFMSARGTKNMLTRLTTILAICFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
             SI L ++    S    D ++R  ++S ++  N N  +   P  +  S  S    + G 
Sbjct: 61  TMSIVLVVV-GNISNSDSDILNRIPINSEQNPVNKNTTEEGKPSSNQSSKPSILEQLGGA 119

Query: 119 RSSSRTK 125
            + S+ +
Sbjct: 120 STPSQKQ 126


>gi|237730092|ref|ZP_04560573.1| preprotein translocase IISP family [Citrobacter sp. 30_2]
 gi|226908698|gb|EEH94616.1| preprotein translocase IISP family [Citrobacter sp. 30_2]
          Length = 155

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/110 (21%), Positives = 44/110 (40%), Gaps = 7/110 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S              + + + R TA+L 
Sbjct: 46  MHEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAVLG 105

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG ++   + +           +  +Q         +  + 
Sbjct: 106 TLFFIISLVLGNMNSNKTNK-GSEWENLSAPAKTEQTQPAAPAQPTSDIP 154


>gi|62129435|gb|AAX67138.1| preprotein translocase IISP family, auxillary membrane component
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
          Length = 175

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 46/110 (41%), Gaps = 7/110 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 66  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 125

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG I+   + +           +  +Q         +  + 
Sbjct: 126 TLFFIISLVLGNINSNKTNK-GSEWENLSAPAKTEQTQPAAPAQPASDIP 174


>gi|161616299|ref|YP_001590264.1| hypothetical protein SPAB_04107 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161365663|gb|ABX69431.1| hypothetical protein SPAB_04107 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|267995488|gb|ACY90373.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
          Length = 175

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 46/110 (41%), Gaps = 7/110 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 66  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 125

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG I+   + +           +  +Q         +  + 
Sbjct: 126 TLFFIISLVLGNINSNKTNK-GSEWENLSAPAKTEQTQPAAPAQPTSDIP 174


>gi|319407093|emb|CBI80730.1| Preprotein translocase, SecG subunit [Bartonella sp. 1-1C]
          Length = 146

 Score = 83.9 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 67/126 (53%), Gaps = 3/126 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF-TSVRSTAHSLGRFTAILAFFFFA 59
           MQ  L+V+H +VV+ L+ V+L+Q S+   FG   +   S R T ++L R T ILA  FF 
Sbjct: 1   MQTVLIVIHFLVVIALIGVVLLQPSEGGGFGGGGSSFMSARGTKNALTRLTTILAACFFM 60

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
            SI L ++    S    D ++R  V++ ++   +N   GS+P ++  +  S    + G  
Sbjct: 61  ISIGL-IVVGNLSNSGSDILNRIPVNAGQNSTKENAS-GSTPSVEGEAQPSIIDQLGGGP 118

Query: 120 SSSRTK 125
            SS+ +
Sbjct: 119 ESSQQQ 124


>gi|290511552|ref|ZP_06550921.1| preprotein translocase SecG subunit [Klebsiella sp. 1_1_55]
 gi|289776545|gb|EFD84544.1| preprotein translocase SecG subunit [Klebsiella sp. 1_1_55]
          Length = 121

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 6/105 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV ++++Q    +  G+S              + + + R T ILA
Sbjct: 13  MYEALLVVFLIVAIGLVGLVMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTGILA 72

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
             FF  S+ALG I+   +++  +  + S   + + Q        S
Sbjct: 73  ALFFIISLALGNINSNKTSKGSEWDNLSAPKTEQTQPTAPAQPTS 117


>gi|238896682|ref|YP_002921427.1| preprotein translocase subunit SecG [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238549009|dbj|BAH65360.1| preprotein translocase inner membrane secretion subunit [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 121

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 6/105 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV ++++Q    +  G+S              + + + R T ILA
Sbjct: 13  MYEALLVVFLIVAIGLVGLVMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTGILA 72

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
             FF  S+ALG I+   +++  +  + S   + + Q        S
Sbjct: 73  ALFFIISLALGNINSNKTSKGSEWDNLSAPKTEQTQPTAPAQPTS 117


>gi|319898757|ref|YP_004158850.1| Preprotein translocase, SecG subunit [Bartonella clarridgeiae 73]
 gi|319402721|emb|CBI76268.1| Preprotein translocase, SecG subunit [Bartonella clarridgeiae 73]
          Length = 149

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 46/125 (36%), Positives = 66/125 (52%), Gaps = 2/125 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           MQ  L+V+H +VV+ LV V+L+Q S+   FG  S+F S R T  +L R T ILA  FFA 
Sbjct: 1   MQTVLIVIHFLVVIALVGVVLLQPSEGGGFGGGSSFMSTRGTKSALTRLTTILAICFFAI 60

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120
           SI L ++    S    D ++R  V S K+   +N  + S P   S    S    + G  +
Sbjct: 61  SIGL-IVVGNLSNSGSDILNRIPVSSGKNSTKENASE-SMPLSGSEDQPSIIDQLGGVPA 118

Query: 121 SSRTK 125
           SS+ +
Sbjct: 119 SSQQQ 123


>gi|319404081|emb|CBI77669.1| Preprotein translocase, SecG subunit [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 146

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 41/126 (32%), Positives = 67/126 (53%), Gaps = 3/126 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS-SNFTSVRSTAHSLGRFTAILAFFFFA 59
           MQ  L+V+H +VV+ L+ V+L+Q S+    G   S+F S R    +L R T ILA  FF 
Sbjct: 1   MQTVLIVIHFLVVIALIGVVLLQPSEGGGLGGGGSSFMSTRGAKSALTRLTTILAACFFM 60

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           TSI L ++    S    D ++R  V+S ++   +N   GS+P ++  +  S    +    
Sbjct: 61  TSIGL-IVIGNLSNSSSDILNRIPVNSGQNSTKENES-GSAPSVEGEAQPSIIDQLGSGP 118

Query: 120 SSSRTK 125
           +SS+ +
Sbjct: 119 ASSQQQ 124


>gi|237706074|ref|ZP_04536555.1| LOW QUALITY PROTEIN: preprotein translocase IISP family
           [Escherichia sp. 3_2_53FAA]
 gi|254038340|ref|ZP_04872398.1| LOW QUALITY PROTEIN: preprotein translocase IISP family
           [Escherichia sp. 1_1_43]
 gi|226839964|gb|EEH71985.1| LOW QUALITY PROTEIN: preprotein translocase IISP family
           [Escherichia sp. 1_1_43]
 gi|226899114|gb|EEH85373.1| LOW QUALITY PROTEIN: preprotein translocase IISP family
           [Escherichia sp. 3_2_53FAA]
          Length = 141

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 32  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 91

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + S     +          +S
Sbjct: 92  TLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTS 137


>gi|291613537|ref|YP_003523694.1| preprotein translocase, SecG subunit [Sideroxydans lithotrophicus
           ES-1]
 gi|291583649|gb|ADE11307.1| preprotein translocase, SecG subunit [Sideroxydans lithotrophicus
           ES-1]
          Length = 115

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 43/108 (39%), Gaps = 6/108 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
           M+  + V+H++  V L+ ++LIQ    +  G      S+ +      +A+ L R TA+ A
Sbjct: 1   MENIVWVIHVVTAVVLIGLVLIQHGKGADMGAAFGSGSAGSVFGSSGSANFLSRSTAVAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF TS+AL  +               +    +       G  +S  
Sbjct: 61  TIFFITSLALTYLYSRPGKDQGVIDKVDVKTLQQQAVPAPAGTETSDS 108


>gi|116052894|ref|YP_793211.1| preprotein translocase subunit SecG [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115588115|gb|ABJ14130.1| secretion protein SecG [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 129

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 54/126 (42%), Gaps = 7/126 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           ++  ++VVHL++ +GLV +IL+Q    +  G+S      +     + +A  L R T ILA
Sbjct: 2   LEKVVIVVHLLMALGLVGLILVQHGKGADAGASFGAGASATVFGSQGSATFLSRITGILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG-SSPKLDSVSAKSSSS 113
             FF TS+ L   ++  S   +           + Q      D     +  S  A+S+  
Sbjct: 62  AVFFLTSLGLAYFAKEKSDALQHIGLPDPAVLEQKQEKAPAADDVPVLQEQSRPAESAGD 121

Query: 114 VVAGKR 119
           V A   
Sbjct: 122 VPAAPE 127


>gi|15599941|ref|NP_253435.1| preprotein translocase subunit SecG [Pseudomonas aeruginosa PAO1]
 gi|152989544|ref|YP_001350789.1| preprotein translocase subunit SecG [Pseudomonas aeruginosa PA7]
 gi|218893842|ref|YP_002442711.1| preprotein translocase subunit SecG [Pseudomonas aeruginosa LESB58]
 gi|254238517|ref|ZP_04931840.1| secretion protein SecG [Pseudomonas aeruginosa C3719]
 gi|254244351|ref|ZP_04937673.1| secretion protein SecG [Pseudomonas aeruginosa 2192]
 gi|296391574|ref|ZP_06881049.1| preprotein translocase subunit SecG [Pseudomonas aeruginosa PAb1]
 gi|313109728|ref|ZP_07795668.1| secretion protein SecG [Pseudomonas aeruginosa 39016]
 gi|13959569|sp|Q9HV52|SECG_PSEAE RecName: Full=Protein-export membrane protein secG
 gi|9951009|gb|AAG08133.1|AE004888_8 secretion protein SecG [Pseudomonas aeruginosa PAO1]
 gi|126170448|gb|EAZ55959.1| secretion protein SecG [Pseudomonas aeruginosa C3719]
 gi|126197729|gb|EAZ61792.1| secretion protein SecG [Pseudomonas aeruginosa 2192]
 gi|150964702|gb|ABR86727.1| protein-export membrane protein SecG [Pseudomonas aeruginosa PA7]
 gi|218774070|emb|CAW29886.1| secretion protein SecG [Pseudomonas aeruginosa LESB58]
 gi|310882170|gb|EFQ40764.1| secretion protein SecG [Pseudomonas aeruginosa 39016]
          Length = 129

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 54/126 (42%), Gaps = 7/126 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           ++  ++VVHL++ +GLV +IL+Q    +  G+S      +     + +A  L R T ILA
Sbjct: 2   LEKVVIVVHLLMALGLVGLILVQHGKGADAGASFGAGASATVFGSQGSATFLSRITGILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG-SSPKLDSVSAKSSSS 113
             FF TS+ L   ++  S   +           + Q      D     +  S  A+S+  
Sbjct: 62  AVFFLTSLGLAYFAKEKSDALQHIGLPDPAVLEQKQEKAPAADDVPVLQEQSKPAESAGD 121

Query: 114 VVAGKR 119
           V A   
Sbjct: 122 VPAAPE 127


>gi|319427308|gb|ADV55382.1| preprotein translocase, SecG subunit [Shewanella putrefaciens 200]
          Length = 111

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 47/111 (42%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+V +GL+ ++LIQ    +  G+S              + + L R TAILA
Sbjct: 1   MYEVLLVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ +G +S   +       +         Q   +  + S  K+  
Sbjct: 61  IAFFTLSLIIGNLSANHAKNEDSWKNLGSDTEQVTQPVQDETEKSETKIPD 111


>gi|262042733|ref|ZP_06015887.1| protein-export membrane protein SecG [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039958|gb|EEW41075.1| protein-export membrane protein SecG [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 115

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 56/121 (46%), Gaps = 13/121 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV ++++Q    +  G+S              + + + R T ILA
Sbjct: 1   MYEALLVVFLIVAIGLVGLVMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTGILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ALG I+   +++  +  + S   + + Q        ++P   +  A+ +S +
Sbjct: 61  ALFFIISLALGNINSNKTSKGSEWDNLSAPKTEQTQ-------PTAPAQPTAPAQPTSDI 113

Query: 115 V 115
            
Sbjct: 114 P 114


>gi|291616007|ref|YP_003518749.1| SecG [Pantoea ananatis LMG 20103]
 gi|291151037|gb|ADD75621.1| SecG [Pantoea ananatis LMG 20103]
 gi|327396258|dbj|BAK13680.1| protein-export membrane protein SecG [Pantoea ananatis AJ13355]
          Length = 113

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/110 (22%), Positives = 47/110 (42%), Gaps = 6/110 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S              + + + R TA+LA
Sbjct: 3   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSNGSGNFMTRMTAVLA 62

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG ++   +++  +  + +     + Q            + 
Sbjct: 63  TLFFVISLILGNLNSNKTSKGSEWENLTAPAQSQQQTQPAKPATPGNDIP 112


>gi|71906587|ref|YP_284174.1| preprotein translocase subunit SecG [Dechloromonas aromatica RCB]
 gi|71846208|gb|AAZ45704.1| protein translocase subunit secG [Dechloromonas aromatica RCB]
          Length = 123

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 46/121 (38%), Gaps = 8/121 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
           +   ++ VH++V + ++ ++L+Q    +  G+      S +      +A+ L R T ILA
Sbjct: 4   LFSLVLTVHILVAIVIIGLVLMQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ L  I           M   +      Q     G+   P     +   +  +
Sbjct: 64  GVFFVTSLTLAYIGSNKPKTTGSLMQEPVQSQTVSQPASAGGES--PAAPVEAGSRAKDI 121

Query: 115 V 115
            
Sbjct: 122 P 122


>gi|242240752|ref|YP_002988933.1| preprotein translocase, SecG subunit [Dickeya dadantii Ech703]
 gi|242132809|gb|ACS87111.1| preprotein translocase, SecG subunit [Dickeya dadantii Ech703]
          Length = 135

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 48/106 (45%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V + L+ +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 26  MYEALLVIFLLVAISLIGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 85

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG +S   S +  +  + S    ++    +     SS
Sbjct: 86  TLFFVISLILGNLSSGHSKKSSEWENLSQPAKVEQVVPEKPATPSS 131


>gi|110633987|ref|YP_674195.1| preprotein translocase subunit SecG [Mesorhizobium sp. BNC1]
 gi|110284971|gb|ABG63030.1| protein translocase subunit secG [Chelativorans sp. BNC1]
          Length = 162

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 60/127 (47%), Gaps = 3/127 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           M   ++V+HL++V+ LV V+L+Q S+    G      F + R  A+ L R TAILA  FF
Sbjct: 1   MHQVILVIHLLIVIALVGVVLMQRSEGGGLGIGGGSGFMTARGAANVLTRTTAILAAAFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
            TS+AL + +RY   R  D   R   D  + QG             +  A +     A +
Sbjct: 61  ITSLALSLHARY-GERPTDIFDRLPQDQTQPQGAGGGILDQLGGGTTAPAPAEEQAPASE 119

Query: 119 RSSSRTK 125
            + + ++
Sbjct: 120 TAPAPSE 126


>gi|255019906|ref|ZP_05291981.1| preprotein translocase, SecG subunit [Acidithiobacillus caldus ATCC
           51756]
 gi|254970686|gb|EET28173.1| preprotein translocase, SecG subunit [Acidithiobacillus caldus ATCC
           51756]
          Length = 135

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 52/130 (40%), Gaps = 6/130 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M  FL+++ +I+ V LV ++LIQ    +        G S      R   + L   TA++ 
Sbjct: 1   MYDFLLILQVIICVVLVGLVLIQKGQGADIGAVFGGGGSQTVFGARGAGNFLSHTTAVVG 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ L  +S + S      +      +           GSS +  + +   +S+ 
Sbjct: 61  ALFFLNSLGLAYLSDHASRSVSSGIALPAASAPAAAAPAAAATGSSTQAGASAQAPASAT 120

Query: 115 VAGKRSSSRT 124
            +  ++ S+ 
Sbjct: 121 TSASQAPSKE 130


>gi|209694187|ref|YP_002262115.1| preprotein translocase subunit SecG [Aliivibrio salmonicida
           LFI1238]
 gi|208008138|emb|CAQ78280.1| protein-export membrane protein SecG (preprotein translocase band
           subunit) [Aliivibrio salmonicida LFI1238]
          Length = 110

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 6/104 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++LI  VG++ ++L+Q    +  G+S              + + L R TAI A
Sbjct: 1   MHTILLVIYLIAAVGVIGLVLVQHGKGADMGASFGAGASNTVFGSGGSGNFLTRMTAICA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
             FF  S+ALG +S + S  +   + +   + + D  +D     
Sbjct: 61  TVFFIISLALGNMSTHKSEGFDLKLDQQATEQVTDNVSDVPATE 104


>gi|90416129|ref|ZP_01224061.1| preprotein translocase IISP family, auxillary membrane component
           [marine gamma proteobacterium HTCC2207]
 gi|90331854|gb|EAS47068.1| preprotein translocase IISP family, auxillary membrane component
           [marine gamma proteobacterium HTCC2207]
          Length = 116

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 24/116 (20%), Positives = 46/116 (39%), Gaps = 6/116 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
           M+ F+++ H +V V L+ +IL+Q    +  G       S        + +   R TAIL+
Sbjct: 1   MENFILIFHFLVAVFLIGLILVQQGKGAEAGASFGAGGSQTVFGSGGSWNFFSRMTAILS 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FF TS++L +I++  +    D +    V   +   + +                
Sbjct: 61  TIFFVTSVSLAVIAKNKTVVDADLLPEMEVIPFETPIDTDVPAVERRSEPGSEIPQ 116


>gi|85058352|ref|YP_454054.1| preprotein translocase subunit SecG [Sodalis glossinidius str.
           'morsitans']
 gi|84778872|dbj|BAE73649.1| protein-export protein SecG [Sodalis glossinidius str. 'morsitans']
          Length = 110

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 25/111 (22%), Positives = 42/111 (37%), Gaps = 7/111 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V VGLV +I++Q    +  G+S              + + + R TA+LA
Sbjct: 1   MYQALLVIFLLVAVGLVALIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG +S     +              D+            +  
Sbjct: 61  TLFFVLSLVLGNLSSNHG-QKGSQWDNLNQAQQADKAPAEAPAKPGNDIPQ 110


>gi|302879350|ref|YP_003847914.1| preprotein translocase, SecG subunit [Gallionella capsiferriformans
           ES-2]
 gi|302582139|gb|ADL56150.1| preprotein translocase, SecG subunit [Gallionella capsiferriformans
           ES-2]
          Length = 108

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 25/107 (23%), Positives = 43/107 (40%), Gaps = 6/107 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
           M+  + V HL+  + L  ++L+Q    +  G      S+ +      +A+ L R TAI A
Sbjct: 1   METIVWVFHLVTAIALCGLVLVQHGKGADMGAAFGTGSAGSLFGSGGSANFLSRSTAIAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
             FF TS+ L  +  + + +        +V        DN      P
Sbjct: 61  AIFFVTSLTLTYLYSHPTQQTGVMDRVDVVKPAVTAPVDNSKSKEIP 107


>gi|49475362|ref|YP_033403.1| preprotein translocase subunit SecG [Bartonella henselae str.
           Houston-1]
 gi|49238168|emb|CAF27377.1| Protein-export membrane protein [Bartonella henselae str.
           Houston-1]
          Length = 152

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 42/127 (33%), Positives = 61/127 (48%), Gaps = 4/127 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+H +VV+ LV VILIQ S+    G SS       R + ++L R TAILA  FF
Sbjct: 1   MQTVLIVIHFLVVITLVGVILIQHSEGGGLGVSSGSGLMKTRGSKNALSRLTAILACCFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           A SI L ++    S    D + R  V S ++  N    +  +P   S +  S    + G 
Sbjct: 61  AVSIGLTVVGSI-SNSSSDILKRIPVHSEQNSTNKGTSE-VAPSSKSEAEPSILEELGGG 118

Query: 119 RSSSRTK 125
               + +
Sbjct: 119 SVPPQEQ 125


>gi|260596199|ref|YP_003208770.1| protein-export membrane protein secG [Cronobacter turicensis z3032]
 gi|260215376|emb|CBA27397.1| Protein-export membrane protein secG [Cronobacter turicensis z3032]
          Length = 122

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 48/106 (45%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 13  MYEALLVVFLIVALGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 72

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   +++  +  + +     +          +S
Sbjct: 73  TLFFIISLVLGNINSNKTSKGSEWENLTAPAKTEQTQPAAPAKPTS 118


>gi|120597897|ref|YP_962471.1| preprotein translocase subunit SecG [Shewanella sp. W3-18-1]
 gi|146293931|ref|YP_001184355.1| preprotein translocase subunit SecG [Shewanella putrefaciens CN-32]
 gi|120557990|gb|ABM23917.1| protein translocase subunit secG [Shewanella sp. W3-18-1]
 gi|145565621|gb|ABP76556.1| protein translocase subunit secG [Shewanella putrefaciens CN-32]
          Length = 111

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 47/111 (42%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+V +GL+ ++LIQ    +  G+S              + + L R TAILA
Sbjct: 1   MYEVLLVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ +G +S   +       +         Q   +  + S  K+  
Sbjct: 61  IAFFTLSLIIGNLSANHAKNEDSWKNLGSDTEQVTQPVQDGTEKSETKIPD 111


>gi|192361247|ref|YP_001983129.1| putative preprotein translocase SecG subunit [Cellvibrio japonicus
           Ueda107]
 gi|190687412|gb|ACE85090.1| putative preprotein translocase SecG subunit [Cellvibrio japonicus
           Ueda107]
          Length = 135

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/119 (18%), Positives = 47/119 (39%), Gaps = 6/119 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M+ F++V+H +  + ++ ++L+Q    +A G+S              + +   R T  +A
Sbjct: 1   MEKFILVIHALAALVIIGLVLLQQGKGAAMGASFGAGASQTVFGSEGSGNFFTRATWTIA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF TS  L +I++  S          ++            D    +  + +A+S   
Sbjct: 61  ALFFCTSFGLAVIAKNNSQVASQGEIVPVIQQEVPAVQVPASDIPEAQAPAANAESDVP 119


>gi|28871627|ref|NP_794246.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213966650|ref|ZP_03394801.1| preprotein translocase, SecG subunit [Pseudomonas syringae pv.
           tomato T1]
 gi|301383160|ref|ZP_07231578.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           tomato Max13]
 gi|302063405|ref|ZP_07254946.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           tomato K40]
 gi|302133778|ref|ZP_07259768.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28854879|gb|AAO57941.1| preprotein translocase, SecG subunit [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213928500|gb|EEB62044.1| preprotein translocase, SecG subunit [Pseudomonas syringae pv.
           tomato T1]
 gi|331016645|gb|EGH96701.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 126

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/123 (21%), Positives = 51/123 (41%), Gaps = 10/123 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +  G+S            + T+  L +FTAILA
Sbjct: 2   LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSL----VDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FF TS+ LG  ++  + +             V      G+    +   P +    A  
Sbjct: 62  ACFFITSLGLGYFAKEKAQQLTQVGLPDPAVLEVKQKPAAGDVPVLEEQKPAVVPADAPQ 121

Query: 111 SSS 113
           +  
Sbjct: 122 APE 124


>gi|110616589|gb|ABF05256.1| protein export - membrane protein [Shigella flexneri 5 str. 8401]
          Length = 135

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 26  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 85

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + R  +  + S     +          +S
Sbjct: 86  TLFFIISLVLGNINSNKTNRGSEWENLSAPAKTEQTQPAAPAKPTS 131


>gi|94501387|ref|ZP_01307907.1| preprotein translocase, SecG subunit [Oceanobacter sp. RED65]
 gi|94426500|gb|EAT11488.1| preprotein translocase, SecG subunit [Oceanobacter sp. RED65]
          Length = 120

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 53/122 (43%), Gaps = 8/122 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M+  +++ H+IV + ++ ++LIQ    +        G+S        + + L R T++LA
Sbjct: 1   MESIILIFHIIVAIAIIGLVLIQQGKGAEAGASFGGGASQTVFGSAGSGNFLTRSTSVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FFATS AL  +++  +                 Q  D   +   P ++  + ++ + +
Sbjct: 61  VVFFATSFALAYVAKQKAD--GLVDAGLPSVQEVQQIEDAVQESEVPVVEESAPETDAPI 118

Query: 115 VA 116
           V 
Sbjct: 119 VD 120


>gi|59711090|ref|YP_203866.1| preprotein translocase subunit SecG [Vibrio fischeri ES114]
 gi|197334714|ref|YP_002155238.1| translocase [Vibrio fischeri MJ11]
 gi|59479191|gb|AAW84978.1| preprotein translocase membrane subunit [Vibrio fischeri ES114]
 gi|197316204|gb|ACH65651.1| translocase [Vibrio fischeri MJ11]
          Length = 110

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 49/106 (46%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++LI  VG++ ++L+Q    +  G+S              + + L R TAI A
Sbjct: 1   MHTILLVIYLIAAVGVIGLVLVQHGKGADMGASFGAGASNTVFGSSGSGNFLTRMTAICA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ALG +S + S  +   + +   + + D  +D      S
Sbjct: 61  TVFFVISLALGNMSTHKSEGFDLKLDQQATEQVTDNASDVPATEDS 106


>gi|330963972|gb|EGH64232.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 126

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 51/123 (41%), Gaps = 10/123 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +  G+S            + T+  L +FTAILA
Sbjct: 2   LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSL----VDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FF TS+ LG  ++  + +             V   +   +    +   P +    A  
Sbjct: 62  ACFFITSLGLGYFAKEKAQQLTQVGLPDPAVLEVKQKRAASDVPVLEEQKPAVVPADAPQ 121

Query: 111 SSS 113
           +  
Sbjct: 122 APE 124


>gi|329297287|ref|ZP_08254623.1| SecG [Plautia stali symbiont]
          Length = 111

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 47/111 (42%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S              + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSTGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG ++   +++  +  + S     + Q            +  
Sbjct: 61  TLFFIISLILGNLNSNKTSKGSEWENLSAPAQSQQQTQPAKPATPGNDIPQ 111


>gi|289207892|ref|YP_003459958.1| preprotein translocase, SecG subunit [Thioalkalivibrio sp. K90mix]
 gi|288943523|gb|ADC71222.1| preprotein translocase, SecG subunit [Thioalkalivibrio sp. K90mix]
          Length = 126

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 55/121 (45%), Gaps = 7/121 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAF 55
              L+VV + V + L+ ++L+Q    +        G+S+     R +A+ L R TA LA 
Sbjct: 3   YGLLLVVQVAVSIALIALVLMQHGKGADAGAAFGSGASATVFGARGSANFLSRSTAFLAV 62

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            FF  S+ L  ++  T  + +  M +   + ++++G+   G   +   D  S   +S   
Sbjct: 63  VFFVNSLTLAYLASSTP-QAESLMDQLEAEEMREEGDIPEGIPGTVPRDDESDAPASDRP 121

Query: 116 A 116
           A
Sbjct: 122 A 122


>gi|49474121|ref|YP_032163.1| preprotein translocase subunit SecG [Bartonella quintana str.
           Toulouse]
 gi|49239625|emb|CAF25984.1| Protein-export membrane protein [Bartonella quintana str. Toulouse]
          Length = 151

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 39/127 (30%), Positives = 62/127 (48%), Gaps = 4/127 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+H +VV+ LV +ILIQ S+    G SS       R + ++L R TAILA  FF
Sbjct: 1   MQTVLIVIHFLVVIALVGIILIQPSEGGGLGVSSGSGLMRTRGSKNALSRLTAILACCFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
             SI L ++    S    D + R  ++S ++  N +  + + P  +     S    + G 
Sbjct: 61  TVSIGLTVVGSI-SNSSSDILKRIPINSEQNSTNKDASE-AVPSSNGRPHPSILEQLGGV 118

Query: 119 RSSSRTK 125
              S+ +
Sbjct: 119 SVPSQEQ 125


>gi|319405523|emb|CBI79142.1| Preprotein translocase, SecG subunit [Bartonella sp. AR 15-3]
          Length = 145

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 41/125 (32%), Positives = 67/125 (53%), Gaps = 2/125 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           MQ  L+V+H +VV+ LV V+L+Q S+   FG SS F + R T  +L R T +LA  FFA 
Sbjct: 1   MQTVLIVIHFLVVIALVGVVLLQPSEGGGFGGSSGFINTRGTKSALTRLTTLLAICFFAI 60

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120
           SI L ++    S    D ++R  ++S ++   +N  + S+P +   +  S    +     
Sbjct: 61  SIGL-IVIGNLSNSGSDILNRIPINSEQNSIKENTSE-STPSVGDEAQPSIIDQLGSIPG 118

Query: 121 SSRTK 125
           SS+ +
Sbjct: 119 SSQQQ 123


>gi|16125963|ref|NP_420527.1| hypothetical protein CC_1719 [Caulobacter crescentus CB15]
 gi|13423135|gb|AAK23695.1| hypothetical protein CC_1719 [Caulobacter crescentus CB15]
          Length = 211

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 47/124 (37%), Gaps = 4/124 (3%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSS---AFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
            L+ ++++V +GL+ V+L+Q S+       G+S    + R     L R T IL   F   
Sbjct: 61  VLLAINIVVCLGLIGVVLLQRSEGGALGMGGNSGGLMTARGAGDLLTRITWILFSIFLTI 120

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120
           S+ L +++     +             K   N      +   L+S+ + +    +     
Sbjct: 121 SLVLTILTG-RLDKSGSVADSIKGLDAKTLQNVPAPTPAPGSLNSLPSSAQPGGIQAPTP 179

Query: 121 SSRT 124
              T
Sbjct: 180 QINT 183


>gi|152972099|ref|YP_001337245.1| preprotein translocase subunit SecG [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206580958|ref|YP_002236413.1| preprotein translocase, SecG subunit [Klebsiella pneumoniae 342]
 gi|288933397|ref|YP_003437456.1| preprotein translocase subunit G [Klebsiella variicola At-22]
 gi|329997756|ref|ZP_08302906.1| preprotein translocase, SecG subunit [Klebsiella sp. MS 92-3]
 gi|150956948|gb|ABR78978.1| protein-export membrane protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206570016|gb|ACI11792.1| preprotein translocase, SecG subunit [Klebsiella pneumoniae 342]
 gi|288888126|gb|ADC56444.1| preprotein translocase, SecG subunit [Klebsiella variicola At-22]
 gi|328538916|gb|EGF64976.1| preprotein translocase, SecG subunit [Klebsiella sp. MS 92-3]
          Length = 109

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 6/105 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV ++++Q    +  G+S              + + + R T ILA
Sbjct: 1   MYEALLVVFLIVAIGLVGLVMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTGILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
             FF  S+ALG I+   +++  +  + S   + + Q        S
Sbjct: 61  ALFFIISLALGNINSNKTSKGSEWDNLSAPKTEQTQPTAPAQPTS 105


>gi|153001792|ref|YP_001367473.1| preprotein translocase subunit SecG [Shewanella baltica OS185]
 gi|151366410|gb|ABS09410.1| preprotein translocase, SecG subunit [Shewanella baltica OS185]
          Length = 111

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 47/111 (42%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+V +GL+ ++LIQ    +  G+S              + + L R TAILA
Sbjct: 1   MYEVLVVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ +G +S   +       +         Q  +   + S  K+  
Sbjct: 61  IAFFTLSLLIGNLSANHAKNEDSWKNLGSDTEQVTQPVEQGTEKSETKIPD 111


>gi|91776415|ref|YP_546171.1| preprotein translocase subunit SecG [Methylobacillus flagellatus
           KT]
 gi|91710402|gb|ABE50330.1| protein translocase subunit secG [Methylobacillus flagellatus KT]
          Length = 111

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/111 (19%), Positives = 48/111 (43%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
           M+  + V+H+I  +G+V ++L+Q    +  G+      S +   V  +++ + R TAI  
Sbjct: 1   METIVTVIHVIAALGVVALVLLQHGKGADMGAAFGSGASGSLFGVSGSSNFMSRATAICV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS++L  ++ + S +        +  +            S+  +  
Sbjct: 61  AIFFVTSMSLAYLASHRSEQGSVVQKSVVKSAPASDVPKPAEPTSAKDVPQ 111


>gi|330877236|gb|EGH11385.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 126

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 50/123 (40%), Gaps = 10/123 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +  G+S            + T+  L +FTAILA
Sbjct: 2   LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSL----VDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FF TS+ LG  ++  + +             V       +    +   P +    A  
Sbjct: 62  ACFFITSLGLGYFAKEKAQQLTQVGLPDPAVLEVKQKPAASDVPVLEEQKPAVVPADAPQ 121

Query: 111 SSS 113
           +  
Sbjct: 122 APE 124


>gi|66047410|ref|YP_237251.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           syringae B728a]
 gi|289676021|ref|ZP_06496911.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           syringae FF5]
 gi|302185429|ref|ZP_07262102.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           syringae 642]
 gi|3024606|sp|P95577|SECG_PSEU2 RecName: Full=Protein-export membrane protein secG
 gi|1835602|gb|AAC45132.1| SecG [Pseudomonas syringae pv. syringae]
 gi|63258117|gb|AAY39213.1| Preprotein translocase SecG subunit [Pseudomonas syringae pv.
           syringae B728a]
 gi|330888661|gb|EGH21322.1| preprotein translocase subunit SecG [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330895308|gb|EGH27646.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330937943|gb|EGH41730.1| preprotein translocase subunit SecG [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330950308|gb|EGH50568.1| preprotein translocase subunit SecG [Pseudomonas syringae Cit 7]
 gi|330969648|gb|EGH69714.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           aceris str. M302273PT]
 gi|330981087|gb|EGH79190.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 126

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 50/125 (40%), Gaps = 8/125 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +  G+S            + T+  L +FTAILA
Sbjct: 2   LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ LG  ++  + +           ++ +       D          A   + V
Sbjct: 62  ACFFITSLGLGYFAKEKAQQLTQV--GLPDPAVLEVKQKPAADDVPVLEGQKPAAVPADV 119

Query: 115 VAGKR 119
                
Sbjct: 120 PQAPE 124


>gi|71280755|ref|YP_270121.1| preprotein translocase subunit SecG [Colwellia psychrerythraea 34H]
 gi|71146495|gb|AAZ26968.1| preprotein translocase, SecG subunit [Colwellia psychrerythraea
           34H]
          Length = 134

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 53/131 (40%), Gaps = 10/131 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
           +   L++V++++ + L+ ++LIQ    +  G      SS+       + + L   T  LA
Sbjct: 2   LYQVLIIVYVLIALALIGLVLIQQGKGADMGASFGAGSSATVFGSGGSGNFLTSATTYLA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ LG ++   +         + +    DQ  D     S     ++ A  +S V
Sbjct: 62  VGFFVISLILGNLTANRTK---SVDEWNNLAVPTDQAVDAIPSESVEAT-TLPAVQNSDV 117

Query: 115 VAGKRSSSRTK 125
            A    + + +
Sbjct: 118 PASDEPAKKEE 128


>gi|302036467|ref|YP_003796789.1| preprotein translocase, membrane subunit SecG [Candidatus
          Nitrospira defluvii]
 gi|300604531|emb|CBK40863.1| Preprotein translocase, membrane subunit SecG [Candidatus
          Nitrospira defluvii]
          Length = 117

 Score = 78.9 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 43/96 (44%), Gaps = 5/96 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS-----AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+++H+IV + ++  IL+QS   +       GSS      R  A+ L +FT I AF
Sbjct: 1  MYTLLIIIHVIVCLLMIGAILLQSGKGAEIGAAFGGSSQTVFGSRGPANFLSKFTVITAF 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG 91
           F  TS++L +I++  +             +     
Sbjct: 61 VFMFTSLSLAIIAKDRNFSSTVIDLNKKPAATTPSS 96


>gi|260771817|ref|ZP_05880735.1| preprotein translocase subunit SecG [Vibrio metschnikovii CIP
           69.14]
 gi|260613109|gb|EEX38310.1| preprotein translocase subunit SecG [Vibrio metschnikovii CIP
           69.14]
          Length = 114

 Score = 78.9 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/113 (24%), Positives = 52/113 (46%), Gaps = 9/113 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  VG++ ++LIQ    +  G+S              + + L R TA+ A
Sbjct: 4   MFTVLLVIYLLAAVGIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAVFA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             FF  S+ LG +S +     +      L   + +Q +++  D  +PK D + 
Sbjct: 64  TAFFVISLVLGNMSTHK---TESQWVDPLQGHVVEQADNSVSDIPAPKGDEIP 113


>gi|311277851|ref|YP_003940082.1| preprotein translocase, SecG subunit [Enterobacter cloacae SCF1]
 gi|308747046|gb|ADO46798.1| preprotein translocase, SecG subunit [Enterobacter cloacae SCF1]
          Length = 109

 Score = 78.9 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 6/105 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TAILA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
             FF  S+ALG I+   + +  +  + +   S + Q        S
Sbjct: 61  TLFFIISLALGNINTNKTNKGSEWENLTAPKSEQTQPAAPAQPSS 105


>gi|237805249|ref|ZP_04591953.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331026357|gb|EGI06412.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 142

 Score = 78.9 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 50/124 (40%), Gaps = 10/124 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +  G+S            + TA  L +FTAILA
Sbjct: 18  LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTATFLSKFTAILA 77

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSL----VDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FF TS+ LG  ++  + +             V       +    +   P +       
Sbjct: 78  ACFFITSLGLGYFAKEKAHQLTQAGLPDPAVLEVKQKPAADDVPVLEAQKPAVVPAEVPP 137

Query: 111 SSSV 114
           +S  
Sbjct: 138 ASEQ 141


>gi|304414226|ref|ZP_07395594.1| Preprotein translocase subunit SecG [Candidatus Regiella
           insecticola LSR1]
 gi|304283440|gb|EFL91836.1| Preprotein translocase subunit SecG [Candidatus Regiella
           insecticola LSR1]
          Length = 138

 Score = 78.9 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 46/108 (42%), Gaps = 6/108 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M + L+V  L++ +GL+ +I++Q    +  G+S      S       + + + R TAILA
Sbjct: 31  MYVTLLVFFLLISIGLIALIVLQQGKGADMGASFGAGASSTLFGSSGSGNFMTRMTAILA 90

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF  S+ LG +S     +  +  + S     +            P+
Sbjct: 91  TLFFIVSLVLGNMSSKQHRQSSEWENLSQPAKDEKISAPPKPSSDIPQ 138


>gi|119774095|ref|YP_926835.1| preprotein translocase subunit SecG [Shewanella amazonensis SB2B]
 gi|119766595|gb|ABL99165.1| protein translocase subunit secG [Shewanella amazonensis SB2B]
          Length = 108

 Score = 78.9 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 46/108 (42%), Gaps = 6/108 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+V +GL+ ++LIQ    +  G+S              + + L R TAILA
Sbjct: 1   MYEVLIVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF  S+ +G +S     +     +     + ++       +   P 
Sbjct: 61  VAFFTLSLIIGNLSANHIKQEDKWNNIGSEPTAEEVQQTEKSETKIPD 108


>gi|281602558|gb|ADA75542.1| Preprotein translocase IISP family, auxillary membrane component
           [Shigella flexneri 2002017]
          Length = 126

 Score = 78.9 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 17  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 76

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + R  +  + S     +          +S
Sbjct: 77  TLFFIISLVLGNINSNKTNRGSEWENLSAPAKTEQTQPAAPAKPTS 122


>gi|298488453|ref|ZP_07006484.1| preprotein translocase subunit [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298157078|gb|EFH98167.1| preprotein translocase subunit [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 142

 Score = 78.9 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 50/123 (40%), Gaps = 10/123 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +  G+S            + T+  L +FTAILA
Sbjct: 18  LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 77

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSL----VDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FF TS+ LG  ++  + +             V       +    +G  P +       
Sbjct: 78  ACFFITSLGLGYFAKEKAQQLTQVGLPDPAALEVKQKPAADDVPVLEGQKPAVVPADVPQ 137

Query: 111 SSS 113
           +  
Sbjct: 138 APE 140


>gi|71734190|ref|YP_276314.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257482264|ref|ZP_05636305.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|71554743|gb|AAZ33954.1| preprotein translocase, SecG subunit [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320330000|gb|EFW85987.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330875223|gb|EGH09372.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330987052|gb|EGH85155.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011496|gb|EGH91552.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 126

 Score = 78.9 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 50/123 (40%), Gaps = 10/123 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +  G+S            + T+  L +FTAILA
Sbjct: 2   LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSL----VDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FF TS+ LG  ++  + +             V       +    +G  P +       
Sbjct: 62  ACFFITSLGLGYFAKEKAQQLTQVGLPDPAVLEVKQKPAADDVPVLEGQKPAVVPADVPQ 121

Query: 111 SSS 113
           +  
Sbjct: 122 APE 124


>gi|257095320|ref|YP_003168961.1| preprotein translocase subunit SecG [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047844|gb|ACV37032.1| preprotein translocase, SecG subunit [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 123

 Score = 78.9 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 50/121 (41%), Gaps = 8/121 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
           +   ++VVH++  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 4   LFSAVLVVHILAAMGVIGLVLVQHGKGADMGAAFGSGASGSLFGATGSANFLSRATAVLA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS++L  I+          M  ++  +         G    P   +     +  +
Sbjct: 64  TVFFVTSLSLAYIASSKPKTTGSVMQDAVNSTPVPVP--PAGSVDKPASPADPDSKAKDI 121

Query: 115 V 115
            
Sbjct: 122 P 122


>gi|90022361|ref|YP_528188.1| protein translocase subunit secG [Saccharophagus degradans 2-40]
 gi|89951961|gb|ABD81976.1| protein translocase subunit secG [Saccharophagus degradans 2-40]
          Length = 129

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/123 (21%), Positives = 50/123 (40%), Gaps = 8/123 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M+  + +VHL+V + ++ +IL+Q    +  G+S              + +   R TA+L 
Sbjct: 1   MENIIFIVHLLVALAIIGLILMQQGKGAEMGASFGAGASQTLFGSGGSGNFFSRMTALLV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKD--QGNDNFGDGSSPKLDSVSAKSSS 112
             FF TS AL +I++  +   +D       +      +          P +D  +   SS
Sbjct: 61  AVFFITSFALAIIAKKQADITEDVSFSISEEVELPSLEETAPIDASDVPSVDIEAEADSS 120

Query: 113 SVV 115
             V
Sbjct: 121 EDV 123


>gi|237798560|ref|ZP_04587021.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|237803809|ref|ZP_04591394.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331021413|gb|EGI01470.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331025789|gb|EGI05845.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 126

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 50/124 (40%), Gaps = 10/124 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +  G+S            + TA  L +FTAILA
Sbjct: 2   LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTATFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSL----VDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FF TS+ LG  ++  + +             V       +    +   P +       
Sbjct: 62  ACFFITSLGLGYFAKEKAHQLTQAGLPDPAVLEVKQKPAADDVPVLEAQKPAVVPAEVPP 121

Query: 111 SSSV 114
           +S  
Sbjct: 122 ASEQ 125


>gi|289624599|ref|ZP_06457553.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289646958|ref|ZP_06478301.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330868243|gb|EGH02952.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 126

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 49/125 (39%), Gaps = 8/125 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +  G+S            + T+  L +FTAILA
Sbjct: 2   LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ LG  ++  + +           +  +       D          A   + V
Sbjct: 62  ACFFITSLGLGYFAKEKAQQLTQV--GLPDPAALEVKQKPAADDVPVLEGQKPAVVPADV 119

Query: 115 VAGKR 119
                
Sbjct: 120 PQAPE 124


>gi|146341033|ref|YP_001206081.1| preprotein translocase subunit SecG [Bradyrhizobium sp. ORS278]
 gi|146193839|emb|CAL77856.1| putative Protein-export membrane protein, secG-like [Bradyrhizobium
           sp. ORS278]
          Length = 127

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 35/113 (30%), Positives = 54/113 (47%), Gaps = 4/113 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V  L+  +L+Q S+    G      F S R TA+ L R TA+LA  FF
Sbjct: 1   MQTVLIVIHLMIVAVLIGAVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTAVLAVGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
            TS+ L  ++ Y   R   ++  ++    +  G      GS   LD +     
Sbjct: 61  VTSLLLTWLAGY--DRKPSSILGNMPGQTQSGGATPVAPGSGGVLDQLKKADE 111


>gi|114778953|ref|ZP_01453744.1| Preprotein translocase SecG subunit [Mariprofundus ferrooxydans
           PV-1]
 gi|114550825|gb|EAU53393.1| Preprotein translocase SecG subunit [Mariprofundus ferrooxydans
           PV-1]
          Length = 127

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 45/119 (37%), Gaps = 6/119 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L++VH++V + L+  +L+Q    +        G +      R +   LG+ T  LA
Sbjct: 1   MTTILIIVHVLVALLLIGTVLVQRGQGADMGVSFGGGGAQTLFGSRGSGSFLGKLTGGLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             F  TS+ L   S+  +    D         I+        +G  P      A +S+ 
Sbjct: 61  AAFMLTSLTLAFFSQQQTGSVVDRSLAGQATPIQQPAGTPQQEGFDPSKLKSDAPASAP 119


>gi|26110186|gb|AAN82372.1|AE016767_132 Protein-export membrane protein secG [Escherichia coli CFT073]
 gi|91074170|gb|ABE09051.1| protein-export membrane protein SecG [Escherichia coli UTI89]
          Length = 126

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 17  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 76

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + S     +          +S
Sbjct: 77  TLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTS 122


>gi|126175442|ref|YP_001051591.1| preprotein translocase subunit SecG [Shewanella baltica OS155]
 gi|217972312|ref|YP_002357063.1| preprotein translocase subunit SecG [Shewanella baltica OS223]
 gi|304410268|ref|ZP_07391887.1| preprotein translocase, SecG subunit [Shewanella baltica OS183]
 gi|307302021|ref|ZP_07581779.1| preprotein translocase, SecG subunit [Shewanella baltica BA175]
 gi|125998647|gb|ABN62722.1| protein translocase subunit secG [Shewanella baltica OS155]
 gi|217497447|gb|ACK45640.1| preprotein translocase, SecG subunit [Shewanella baltica OS223]
 gi|304351677|gb|EFM16076.1| preprotein translocase, SecG subunit [Shewanella baltica OS183]
 gi|306914059|gb|EFN44480.1| preprotein translocase, SecG subunit [Shewanella baltica BA175]
          Length = 111

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+V +GL+ ++LIQ    +  G+S              + + L R TAILA
Sbjct: 1   MYEVLVVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ +G +S   +       +         Q  +     S  K+  
Sbjct: 61  IAFFTLSLLIGNLSANHAKNEDSWKNLGSDTEQVTQPVEQGTQKSETKIPD 111


>gi|160876526|ref|YP_001555842.1| preprotein translocase subunit SecG [Shewanella baltica OS195]
 gi|160862048|gb|ABX50582.1| preprotein translocase, SecG subunit [Shewanella baltica OS195]
 gi|315268720|gb|ADT95573.1| preprotein translocase, SecG subunit [Shewanella baltica OS678]
          Length = 111

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+V +GL+ ++LIQ    +  G+S              + + L R TAILA
Sbjct: 1   MYEVLVVIYLLVALGLIGLVLIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ +G +S   +       +         Q  +     S  K+  
Sbjct: 61  IAFFTLSLLIGNLSANHAKNEDSWNNLGSDTEQVTQPVEQGTQKSETKIPD 111


>gi|127513758|ref|YP_001094955.1| preprotein translocase subunit SecG [Shewanella loihica PV-4]
 gi|126639053|gb|ABO24696.1| protein translocase subunit secG [Shewanella loihica PV-4]
          Length = 114

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 28/113 (24%), Positives = 49/113 (43%), Gaps = 6/113 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   LMV++L+V +GL+ +ILIQ    +  G+S      +       + + L R TAILA
Sbjct: 1   MYEVLMVIYLLVALGLIGLILIQQGKGADMGASFGAGASATLFGSSGSGNFLTRSTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             FFA S+ +G +S   +   +         +   +   +    +    D + 
Sbjct: 61  IAFFALSLTIGNLSANHAKTEESWKDLGADAAAVTEQVTDAAKDAQKSEDKIP 113


>gi|283788199|ref|YP_003368064.1| protein-export membrane protein [Citrobacter rodentium ICC168]
 gi|282951653|emb|CBG91353.1| protein-export membrane protein [Citrobacter rodentium ICC168]
          Length = 126

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 46/111 (41%), Gaps = 7/111 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 17  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 76

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG I+   + +           +  +Q         +  +  
Sbjct: 77  TLFFIISLVLGNINSNKTNK-GSEWENLSAPAKTEQTQPAAPAQPTSDIPQ 126


>gi|239996534|ref|ZP_04717058.1| protein-export membrane protein secG(General Secretory Pathway)
           [Alteromonas macleodii ATCC 27126]
          Length = 137

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 54/126 (42%), Gaps = 8/126 (6%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILAF 55
              L+V +LIV + L+  +LIQ    +  G       S+       + + + R TAILA 
Sbjct: 3   YEVLLVAYLIVALLLIGFVLIQQGKGADMGASFGSGGSNTVFGSSGSGNFMTRTTAILAG 62

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            FF  S++LG ++       +D  +   V +  ++  +   D   P ++   A++   VV
Sbjct: 63  LFFLISLSLGAMTANR-ESAEDEWNNLEVPAAVEESVELPADQDVPVIEDA-AQTDVPVV 120

Query: 116 AGKRSS 121
               + 
Sbjct: 121 ESDVTD 126


>gi|323376931|gb|ADX49199.1| preprotein translocase, SecG subunit [Escherichia coli KO11]
          Length = 126

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 17  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 76

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + S     +          +S
Sbjct: 77  TLFFIISLVLGNINSNKTNKGSEWENLSAPVKTEQTQPAAPAKPTS 122


>gi|163802300|ref|ZP_02196194.1| translocase [Vibrio sp. AND4]
 gi|159173829|gb|EDP58643.1| translocase [Vibrio sp. AND4]
          Length = 112

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +  G+S              + + L R TAILA
Sbjct: 1   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +      +  +L   + +Q  D   +  +P  D +  
Sbjct: 61  TVFFIISLLLGRMSTHKAE--SQWVDPTLGQPVVEQIKDAASEVPAPTGDEIPQ 112


>gi|262393379|ref|YP_003285233.1| preprotein translocase subunit SecG [Vibrio sp. Ex25]
 gi|262336973|gb|ACY50768.1| preprotein translocase subunit SecG [Vibrio sp. Ex25]
          Length = 112

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 51/114 (44%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +  G+S              + + L R TAILA
Sbjct: 1   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S +        +  +L   + +Q  D   +  +P  D +  
Sbjct: 61  TVFFIVSLLLGRMSTHKIE--SQWVDPTLGQPVVEQVKDAASEVPAPAGDEIPQ 112


>gi|153844466|ref|ZP_01993661.1| translocase [Vibrio parahaemolyticus AQ3810]
 gi|149745223|gb|EDM56474.1| translocase [Vibrio parahaemolyticus AQ3810]
          Length = 115

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +  G+S              + + L R TAILA
Sbjct: 4   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +      +  +L   + +Q  D   +  +P  D +  
Sbjct: 64  TVFFVVSLLLGRMSTHKTE--SQWVDPTLGQPVVEQVKDAASEVPAPTGDEIPQ 115


>gi|90580526|ref|ZP_01236331.1| putative protein export-membrane protein [Vibrio angustum S14]
 gi|90438184|gb|EAS63370.1| putative protein export-membrane protein [Photobacterium angustum
           S14]
          Length = 113

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 45/114 (39%), Gaps = 7/114 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++L+Q    +  G+S              + + L R T +LA
Sbjct: 1   MYEILLVIYLVAALGVIGLVLVQQGKGADMGASFGAGASGTLFGSSGSGNFLTRMTTVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S   +T            +      +      +P  D +  
Sbjct: 61  AIFFVISLVLGNMSAKQATE-GSGWDNLTAPATTQPVVEKTKTEKAPSTDEIPQ 113


>gi|90412482|ref|ZP_01220485.1| putative protein export-membrane protein [Photobacterium profundum
           3TCK]
 gi|90326519|gb|EAS42925.1| putative protein export-membrane protein [Photobacterium profundum
           3TCK]
          Length = 111

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 43/111 (38%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++L+Q    +  G+S              + + L R T + A
Sbjct: 1   MYEILLVIYLLAALGVIGLVLVQQGKGADMGASFGAGASGTLFGASGSGNFLTRMTTVCA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG +S   ++        S   + +           +  +  
Sbjct: 61  AIFFVISLVLGNMSAKQASEKSGWEDLSGNVNSEQVVEKTETAPVNSDIPQ 111


>gi|320322531|gb|EFW78624.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 126

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/123 (20%), Positives = 50/123 (40%), Gaps = 10/123 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +  G+S            + T+  L +FTAI+A
Sbjct: 2   LETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAIIA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSL----VDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FF TS+ LG  ++  + +             V       +    +G  P +       
Sbjct: 62  ACFFITSLGLGYFAKEKAQQLTQVGLPDPAVLEVKQKPAADDVPVLEGQKPAVVPADVPQ 121

Query: 111 SSS 113
           +  
Sbjct: 122 APE 124


>gi|114562165|ref|YP_749678.1| preprotein translocase subunit SecG [Shewanella frigidimarina NCIMB
           400]
 gi|114333458|gb|ABI70840.1| protein translocase subunit secG [Shewanella frigidimarina NCIMB
           400]
          Length = 111

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 47/111 (42%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV+L+V +GL+ +ILIQ    +  G+S              + + L R TA+LA
Sbjct: 1   MYEVLIVVYLVVALGLIGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FFA S+ +G +S   + + +                    + S  K+  
Sbjct: 61  IGFFALSLVIGNLSANHTEQNEQWKDLGPAAEQIIDDAPVQTEQSETKIPD 111


>gi|78485161|ref|YP_391086.1| preprotein translocase, SecG subunit [Thiomicrospira crunogena
           XCL-2]
 gi|78363447|gb|ABB41412.1| protein translocase subunit secG [Thiomicrospira crunogena XCL-2]
          Length = 106

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 45/102 (44%), Gaps = 6/102 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M   ++ +HL++   L+ ++L+Q    +        GSS +      + + + + T+++A
Sbjct: 1   MFQIILAIHLVIAFILIVLVLLQQGKGADAGANFGGGSSQSVFGSSGSNNFMLKMTSVVA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFG 96
             FF TS+AL  +    +  Y+  + +   +      + N  
Sbjct: 61  VVFFITSLALAYLGAQQAKGYQSVVQKPAAEQNAADSDTNEP 102


>gi|89072572|ref|ZP_01159144.1| putative protein export-membrane protein [Photobacterium sp. SKA34]
 gi|89051676|gb|EAR57129.1| putative protein export-membrane protein [Photobacterium sp. SKA34]
          Length = 113

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 45/114 (39%), Gaps = 7/114 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++L+Q    +  G+S              + + L R T +LA
Sbjct: 1   MYEILLVIYLVAALGVIGLVLVQQGKGADMGASFGAGASGTLFGSSGSGNFLTRMTTVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S   +T            +      +      +P  D +  
Sbjct: 61  AIFFVISLVLGNMSAKQATE-GSGWDNLTAPATIQPVVEKTKTEKAPSTDEIPQ 113


>gi|261345164|ref|ZP_05972808.1| homoserine dehydrogenase [Providencia rustigianii DSM 4541]
 gi|282566855|gb|EFB72390.1| homoserine dehydrogenase [Providencia rustigianii DSM 4541]
          Length = 114

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 24/111 (21%), Positives = 47/111 (42%), Gaps = 7/111 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M I L+++ L+V + L+ ++++Q    +  G+S      +       + + + R T ILA
Sbjct: 1   MYIALLIIFLLVAISLIGLVMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTGILA 60

Query: 55  FFFFATSIALGMISRYT-STRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG ++     T            +  +Q  D     ++P  D
Sbjct: 61  AVFFIISLVLGNMTANKYGTGTGSKWENISEPAKVEQPTDVPAAPATPTSD 111


>gi|269961977|ref|ZP_06176332.1| translocase [Vibrio harveyi 1DA3]
 gi|269833300|gb|EEZ87404.1| translocase [Vibrio harveyi 1DA3]
          Length = 112

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +  G+S              + + L R TAILA
Sbjct: 1   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +      +  +L   + +Q  D   +  +P  D +  
Sbjct: 61  TVFFIISLLLGRMSTHKTE--SQWVDPTLGQPVVEQVKDAASEVPAPAGDEIPQ 112


>gi|206890970|ref|YP_002248969.1| preprotein translocase, SecG subunit [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742908|gb|ACI21965.1| preprotein translocase, SecG subunit [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 107

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 37/105 (35%), Gaps = 6/105 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M+  L++ H+I+   ++ V+L+     +        GSS      R  A  L +   I+A
Sbjct: 1   MKTLLLIFHIILCFVMIAVVLLHRGKGAELGPAFGGGSSQTLFGPRGAATFLNKVATIVA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
             F  +S  L  I+  + +   D         ++           
Sbjct: 61  VLFMLSSFFLTYITTRSKSVVSDVNVPVQTQPVQPAQQPVGEQPQ 105


>gi|91229507|ref|ZP_01262931.1| translocase [Vibrio alginolyticus 12G01]
 gi|269968322|ref|ZP_06182344.1| translocase [Vibrio alginolyticus 40B]
 gi|91187393|gb|EAS73748.1| translocase [Vibrio alginolyticus 12G01]
 gi|269827073|gb|EEZ81385.1| translocase [Vibrio alginolyticus 40B]
          Length = 112

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +  G+S              + + L R TAILA
Sbjct: 1   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +      +  +L   + +Q  D   +  +P  D +  
Sbjct: 61  TVFFIVSLLLGRMSTHQTE--SQWVDPTLGQPVVEQVKDAASEVPAPAGDEIPQ 112


>gi|259907039|ref|YP_002647395.1| preprotein translocase subunit SecG [Erwinia pyrifoliae Ep1/96]
 gi|224962661|emb|CAX54116.1| Protein-export membrane protein SecG (Preprotein translocase band 1
           subunit) [Erwinia pyrifoliae Ep1/96]
 gi|283476835|emb|CAY72673.1| Protein-export membrane protein secG [Erwinia pyrifoliae DSM 12163]
 gi|310766251|gb|ADP11201.1| protein-export protein [Erwinia sp. Ejp617]
          Length = 110

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 45/106 (42%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S              + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + +     +           S
Sbjct: 61  TLFFIISLILGNINSNKTQKGSEWENLTQPAQSQQTQPAKPAAPGS 106


>gi|292486834|ref|YP_003529704.1| protein-export membrane protein SecG [Erwinia amylovora CFBP1430]
 gi|292900768|ref|YP_003540137.1| protein-export protein [Erwinia amylovora ATCC 49946]
 gi|291200616|emb|CBJ47748.1| protein-export protein [Erwinia amylovora ATCC 49946]
 gi|291552251|emb|CBA19288.1| Protein-export membrane protein secG [Erwinia amylovora CFBP1430]
          Length = 110

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 45/106 (42%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S              + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + +     +           S
Sbjct: 61  TLFFIISLILGNINSNKTQKGSEWENLTQPAQSQQTQPAKPATPGS 106


>gi|188532501|ref|YP_001906298.1| preprotein translocase subunit SecG [Erwinia tasmaniensis Et1/99]
 gi|188027543|emb|CAO95390.1| Protein-export membrane protein SecG (Preprotein translocase band 1
           subunit) [Erwinia tasmaniensis Et1/99]
          Length = 110

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 45/106 (42%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S              + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + S     +           S
Sbjct: 61  TLFFIISLILGNINSNKTQKGSEWENLSQPAQSQQTQPAKPATPGS 106


>gi|312170902|emb|CBX79161.1| Protein-export membrane protein secG [Erwinia amylovora ATCC
           BAA-2158]
          Length = 110

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 45/106 (42%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S              + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + +     K           S
Sbjct: 61  TLFFIISLILGNINSNKTQKGSEWENLTQPAQSKQTQPAKPATPGS 106


>gi|156935697|ref|YP_001439613.1| preprotein translocase subunit SecG [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156533951|gb|ABU78777.1| hypothetical protein ESA_03566 [Cronobacter sakazakii ATCC BAA-894]
          Length = 110

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVALGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + +     +          +S
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSEWENLTAPAKTEQTQPAAPAKPTS 106


>gi|56460079|ref|YP_155360.1| biopolymer transport protein [Idiomarina loihiensis L2TR]
 gi|56179089|gb|AAV81811.1| Biopolymer transport protein [Idiomarina loihiensis L2TR]
          Length = 113

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 45/113 (39%), Gaps = 6/113 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   LM+  L+V + L+  I++Q    +  G+S              + + L R TA LA
Sbjct: 1   MYEILMIAFLVVALVLIGFIMLQQGKGADMGASFGSGASNTVFGSSGSGNFLTRATAGLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             FF  S+ LG +S  T     D    S+    ++    +    S  ++  + 
Sbjct: 61  VVFFILSLVLGNLSTSTDESSNDFSDLSVPAEEQELPPADDKSESESEVPPID 113


>gi|54307812|ref|YP_128832.1| putative protein export-membrane protein [Photobacterium profundum
           SS9]
 gi|46912235|emb|CAG19030.1| putative protein export-membrane protein [Photobacterium profundum
           SS9]
          Length = 111

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 43/111 (38%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++L+Q    +  G+S              + + L R T + A
Sbjct: 1   MYEILLVIYLLAALGVIGLVLVQQGKGADMGASFGAGASGTLFGASGSGNFLTRMTTVCA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG +S   ++        S   + +           +  +  
Sbjct: 61  AIFFVISLVLGNMSAKQASEKSGWEDLSGNVNSEQVVEKTETAPINSDIPQ 111


>gi|238918421|ref|YP_002931935.1| preprotein translocase, SecG subunit, putative [Edwardsiella
           ictaluri 93-146]
 gi|238867989|gb|ACR67700.1| preprotein translocase, SecG subunit, putative [Edwardsiella
           ictaluri 93-146]
          Length = 111

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 47/115 (40%), Gaps = 11/115 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L++ V L+ +I++Q    +  G+S      +       T + + R T ILA
Sbjct: 1   MYEALLVIFLLISVALIALIMLQQGKGADMGASFGAGASATLFGSSGTGNFMTRTTGILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF  S+ LG +S + S +  +  +       +    +     + P   S    
Sbjct: 61  TLFFVLSLVLGNLSGHQSKQGSEWDNLG-----QPMKTEQPAKPAVPATPSSDIP 110


>gi|161506144|ref|YP_001573256.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867491|gb|ABX24114.1| hypothetical protein SARI_04332 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 110

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + S     +          +S
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSEWENLSAPTKTEQTQPAAPAQPTS 106


>gi|240141512|ref|YP_002965992.1| putative secG: preprotein translocase [Methylobacterium extorquens
           AM1]
 gi|240011489|gb|ACS42715.1| putative secG: preprotein translocase [Methylobacterium extorquens
           AM1]
          Length = 155

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 54/127 (42%), Gaps = 6/127 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           MQ  L+VVHLI+V+ L+ V+L+Q S+             S F + R  A++L R TAILA
Sbjct: 1   MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGGGGGGGVSGFMTGRGQANALTRATAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TSIAL +++  T+                 Q +      +        + S    
Sbjct: 61  ALFFTTSIALAILAHRTAAPRSILDEAGTPQGQTQQTDKPVNADNLLDTLRSGSPSQGGQ 120

Query: 115 VAGKRSS 121
            A   + 
Sbjct: 121 PASVPTD 127


>gi|268592828|ref|ZP_06127049.1| homoserine dehydrogenase [Providencia rettgeri DSM 1131]
 gi|291311613|gb|EFE52066.1| homoserine dehydrogenase [Providencia rettgeri DSM 1131]
          Length = 114

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 24/111 (21%), Positives = 47/111 (42%), Gaps = 7/111 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M + L+++ L+  +GL+ +I++Q    +  G+S      +       + + + R T ILA
Sbjct: 1   MYVALLIIFLLAAIGLIGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTGILA 60

Query: 55  FFFFATSIALGMISRYT-STRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG ++     T            +  +Q  D     ++P  D
Sbjct: 61  AVFFIISLILGNMTANKYGTGSGSKWENISEPTKVEQPTDVPAAPATPTSD 111


>gi|162139538|ref|YP_218219.2| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|224585088|ref|YP_002638887.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|224469616|gb|ACN47446.1| protein-export membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|322716288|gb|EFZ07859.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 110

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + S     +          +S
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAQPAS 106


>gi|16762055|ref|NP_457672.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16766589|ref|NP_462204.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29143544|ref|NP_806886.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56415222|ref|YP_152297.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|167552062|ref|ZP_02345815.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167990144|ref|ZP_02571244.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168231900|ref|ZP_02656958.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168237991|ref|ZP_02663049.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168243125|ref|ZP_02668057.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168262698|ref|ZP_02684671.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168463486|ref|ZP_02697403.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168819641|ref|ZP_02831641.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194446778|ref|YP_002042549.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194448171|ref|YP_002047320.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194471973|ref|ZP_03077957.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194734665|ref|YP_002116240.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197250047|ref|YP_002148217.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197262591|ref|ZP_03162665.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197364152|ref|YP_002143789.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|198245348|ref|YP_002217264.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200388900|ref|ZP_03215512.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204928325|ref|ZP_03219525.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205354194|ref|YP_002227995.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207858541|ref|YP_002245192.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213029357|ref|ZP_03343804.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
 gi|213052985|ref|ZP_03345863.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213425429|ref|ZP_03358179.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213622801|ref|ZP_03375584.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213645862|ref|ZP_03375915.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213865086|ref|ZP_03387205.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|238910086|ref|ZP_04653923.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289825805|ref|ZP_06544973.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25306332|pir||AD0902 protein-export membrane protein [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16421850|gb|AAL22163.1| preprotein translocase IISP family protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|16504358|emb|CAD07810.1| protein-export membrane protein [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139178|gb|AAO70746.1| export membrane protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56129479|gb|AAV78985.1| protein-export membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|194405441|gb|ACF65663.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194406475|gb|ACF66694.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194458337|gb|EDX47176.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194710167|gb|ACF89388.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195633471|gb|EDX51885.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197095629|emb|CAR61197.1| protein-export membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197213750|gb|ACH51147.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197240846|gb|EDY23466.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197289167|gb|EDY28536.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197939864|gb|ACH77197.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199605998|gb|EDZ04543.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204322647|gb|EDZ07844.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205273975|emb|CAR38981.1| protein-export membrane protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205323209|gb|EDZ11048.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205331185|gb|EDZ17949.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205333739|gb|EDZ20503.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205337750|gb|EDZ24514.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205343277|gb|EDZ30041.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205348487|gb|EDZ35118.1| preprotein translocase, SecG subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206710344|emb|CAR34702.1| protein-export membrane protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|261248457|emb|CBG26294.1| protein-export membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|301159841|emb|CBW19360.1| protein-export membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312914317|dbj|BAJ38291.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320087737|emb|CBY97501.1| Protein-export membrane protein secG Preprotein translocase band 1
           subunit; P12 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321225975|gb|EFX51029.1| Preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322615296|gb|EFY12217.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618345|gb|EFY15236.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322622850|gb|EFY19694.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626828|gb|EFY23625.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322631397|gb|EFY28157.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635336|gb|EFY32050.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643335|gb|EFY39899.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647093|gb|EFY43594.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322648896|gb|EFY45341.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655088|gb|EFY51399.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657691|gb|EFY53959.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664187|gb|EFY60385.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322667470|gb|EFY63632.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674718|gb|EFY70810.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322675649|gb|EFY71722.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682285|gb|EFY78308.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322684888|gb|EFY80886.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323131651|gb|ADX19081.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323191865|gb|EFZ77113.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199024|gb|EFZ84121.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204276|gb|EFZ89285.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207623|gb|EFZ92570.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211324|gb|EFZ96168.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323214734|gb|EFZ99483.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221214|gb|EGA05640.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224045|gb|EGA08338.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323230306|gb|EGA14425.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323233282|gb|EGA17376.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323239319|gb|EGA23369.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323242430|gb|EGA26456.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323246940|gb|EGA30906.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323254127|gb|EGA37947.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255244|gb|EGA39021.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262707|gb|EGA46263.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323264017|gb|EGA47525.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269403|gb|EGA52858.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326625042|gb|EGE31387.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326629315|gb|EGE35658.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 110

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + S     +          +S
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAQPTS 106


>gi|157962881|ref|YP_001502915.1| preprotein translocase subunit SecG [Shewanella pealeana ATCC
           700345]
 gi|157847881|gb|ABV88380.1| preprotein translocase, SecG subunit [Shewanella pealeana ATCC
           700345]
          Length = 111

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   LMVV+L+V +GLV +ILIQ    +  G+S              + + L R TAILA
Sbjct: 1   MYEVLMVVYLLVSIGLVGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FFA S+ +G +S   +             +   +      + S  K+  
Sbjct: 61  VAFFALSLTIGNLSANHTKAEGAWDDLGSDAAQVVEQVQQEAEKSEDKIPD 111


>gi|322831212|ref|YP_004211239.1| preprotein translocase SecG subunit [Rahnella sp. Y9602]
 gi|321166413|gb|ADW72112.1| preprotein translocase, SecG subunit [Rahnella sp. Y9602]
          Length = 111

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/110 (20%), Positives = 44/110 (40%), Gaps = 6/110 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ LIV +GL+ ++++Q    +  G+S              + + + R T +LA
Sbjct: 1   MYDALLVIFLIVAIGLIALVMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTGVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG +S     +  +  + S     +           +  + 
Sbjct: 61  ALFFIISLILGNMSTNKGQKGSEWENLSQPAKTEQTTAPAAPAAPNSDVP 110


>gi|262163946|ref|ZP_06031685.1| preprotein translocase subunit SecG [Vibrio mimicus VM223]
 gi|262027474|gb|EEY46140.1| preprotein translocase subunit SecG [Vibrio mimicus VM223]
          Length = 114

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 46/113 (40%), Gaps = 9/113 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 4   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             FF  S+ LG +S +     +          +  Q +D   +  +   D + 
Sbjct: 64  TIFFVISLVLGNMSTHK---TESQWVDPSQGQVIQQADDTVSETPAKSSDEIP 113


>gi|183600363|ref|ZP_02961856.1| hypothetical protein PROSTU_03926 [Providencia stuartii ATCC 25827]
 gi|188020154|gb|EDU58194.1| hypothetical protein PROSTU_03926 [Providencia stuartii ATCC 25827]
          Length = 112

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 47/110 (42%), Gaps = 7/110 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M I L++V L+V +GL+ +I++Q    +  G+S      +       + + + R T ILA
Sbjct: 1   MYIALLIVFLLVAIGLIGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTGILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG ++                 +  +Q  D     ++P  D
Sbjct: 61  AVFFIISLILGNMTANKYG-TGSKWENISEPAKVEQPTDVPAAPATPTSD 109


>gi|148255834|ref|YP_001240419.1| preprotein translocase subunit SecG [Bradyrhizobium sp. BTAi1]
 gi|146408007|gb|ABQ36513.1| protein translocase subunit secG [Bradyrhizobium sp. BTAi1]
          Length = 127

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 49/113 (43%), Gaps = 4/113 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ   +V+HL++V  L+  +L+Q S+    G      F S R TA+ L R TA+LA  FF
Sbjct: 1   MQTVFIVIHLMIVAVLIGAVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTAVLAVGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
            TS+ L  ++ Y        +  ++    +  G           LD +     
Sbjct: 61  VTSLLLTWLAGYDRKPTS--ILGNVPGQTQSGGATPVAPTGGGVLDQLKKADE 111


>gi|330958052|gb|EGH58312.1| preprotein translocase subunit SecG [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 126

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/124 (20%), Positives = 50/124 (40%), Gaps = 10/124 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +  G+S            + T+  L +FTAILA
Sbjct: 2   LETVVIVFHLMGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSL----VDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FF TS+ LG  ++  + +             V       +    +   P +       
Sbjct: 62  ACFFITSLGLGYFAKEKAQQLTQVGLPDPAVLEVKQKPAADDVPVLEAQKPAVVPADVPP 121

Query: 111 SSSV 114
           +S  
Sbjct: 122 ASGQ 125


>gi|288817939|ref|YP_003432286.1| protein export membrane protein [Hydrogenobacter thermophilus TK-6]
 gi|288787338|dbj|BAI69085.1| protein export membrane protein [Hydrogenobacter thermophilus TK-6]
          Length = 112

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 36/111 (32%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF----TSVRSTAHSLGRFTAILAFF 56
           M  FL+VV + +   L+ V+L+Q S      +                 L + T  L F 
Sbjct: 1   MYYFLLVVFVFIAFLLIVVVLLQRSRGDVGTAFGGMGQGVFGPGGVDTILTKITYWLGFL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
           F   +I L +   + S R             K Q +     G+       S
Sbjct: 61  FMFIAILLAL--THPSKRGSLLKDEGARAPQKTQQSIPERQGAPSGTPPES 109


>gi|157148744|ref|YP_001456063.1| preprotein translocase subunit SecG [Citrobacter koseri ATCC
           BAA-895]
 gi|157085949|gb|ABV15627.1| hypothetical protein CKO_04576 [Citrobacter koseri ATCC BAA-895]
          Length = 110

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 48/106 (45%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ALG I+   + +  +  + S     +          SS
Sbjct: 61  TLFFIISLALGNINSNKTNKGSEWENLSAPAKTEQTQPVAPAQPSS 106


>gi|260775412|ref|ZP_05884309.1| preprotein translocase subunit SecG [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608593|gb|EEX34758.1| preprotein translocase subunit SecG [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 111

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 48/114 (42%), Gaps = 9/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  VG++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S +     +          +  Q +D   +  +P  D +  
Sbjct: 61  TVFFILSLVLGNMSTHK---TESQWVDPTQGQVIQQADDAASEVPAPTGDEIPQ 111


>gi|163854058|ref|YP_001642101.1| preprotein translocase, SecG subunit [Methylobacterium extorquens
           PA1]
 gi|218533001|ref|YP_002423817.1| preprotein translocase, SecG subunit [Methylobacterium
           chloromethanicum CM4]
 gi|254564026|ref|YP_003071121.1| secG: preprotein translocase [Methylobacterium extorquens DM4]
 gi|163665663|gb|ABY33030.1| preprotein translocase, SecG subunit [Methylobacterium extorquens
           PA1]
 gi|218525304|gb|ACK85889.1| preprotein translocase, SecG subunit [Methylobacterium
           chloromethanicum CM4]
 gi|254271304|emb|CAX27316.1| putative secG: preprotein translocase [Methylobacterium extorquens
           DM4]
          Length = 155

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 54/127 (42%), Gaps = 6/127 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           MQ  L+VVHLI+V+ L+ V+L+Q S+             S F + R  A++L R TAILA
Sbjct: 1   MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGGGGGGGVSGFMTGRGQANALTRATAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TSIAL +++  ++                 Q +      +        + S    
Sbjct: 61  ALFFTTSIALAILAHRSAAPRSILDEAGTPQGQTQQTDKPVNADNLLDTLRSGSPSQGGQ 120

Query: 115 VAGKRSS 121
            A   + 
Sbjct: 121 PASVPTD 127


>gi|119504347|ref|ZP_01626427.1| secretion protein SecG [marine gamma proteobacterium HTCC2080]
 gi|119459855|gb|EAW40950.1| secretion protein SecG [marine gamma proteobacterium HTCC2080]
          Length = 142

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 54/131 (41%), Gaps = 10/131 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
           M+  ++VVHL+V +G++ +I++Q    +  G       S        +A+ L + TA L 
Sbjct: 1   MEQIILVVHLLVALGIIGLIMMQQGKGADIGASFGAGGSQTLFGSVGSANLLTKLTAWLV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN----FGDGSSPKLDSVSAKS 110
             FFA+S  L MI+   +    D      +++++             G  P +   +  S
Sbjct: 61  AAFFASSFGLAMIADSRTAGDDDLGFELPMEAVEMTPVQPLESDVPVGDMPDMTFEAEAS 120

Query: 111 SSSVVAGKRSS 121
              V+   +  
Sbjct: 121 DLPVLETTQGD 131


>gi|156975666|ref|YP_001446573.1| preprotein translocase subunit SecG [Vibrio harveyi ATCC BAA-1116]
 gi|156527260|gb|ABU72346.1| hypothetical protein VIBHAR_03401 [Vibrio harveyi ATCC BAA-1116]
          Length = 112

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +  G+S              + + L R TAILA
Sbjct: 1   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +      +  +L   + +Q  D   +  +P  D +  
Sbjct: 61  TVFFIVSLLLGRMSTHKTE--SQWVDPTLGQPVVEQVKDAVSEVPAPTGDEIPQ 112


>gi|283836282|ref|ZP_06356023.1| homoserine dehydrogenase [Citrobacter youngae ATCC 29220]
 gi|291067645|gb|EFE05754.1| homoserine dehydrogenase [Citrobacter youngae ATCC 29220]
          Length = 110

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 45/106 (42%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S              + + + R TA+L 
Sbjct: 1   MHEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAVLG 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG ++   + +  +  + S     +          +S
Sbjct: 61  TLFFIISLVLGNMNSNKTNKGSEWENLSAPAKTEQTQPAAPAQPTS 106


>gi|262274886|ref|ZP_06052697.1| hypothetical protein VHA_001868 [Grimontia hollisae CIP 101886]
 gi|262221449|gb|EEY72763.1| hypothetical protein VHA_001868 [Grimontia hollisae CIP 101886]
          Length = 110

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/102 (22%), Positives = 43/102 (42%), Gaps = 6/102 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 1   MYEILLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGSGGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFG 96
             FF  S+ LG ++   +    +    S+       G+    
Sbjct: 61  TVFFVLSLVLGNLTAKQTEVGGEYDDLSVPVEQIQSGDVPAA 102


>gi|258625323|ref|ZP_05720223.1| translocase [Vibrio mimicus VM603]
 gi|262172284|ref|ZP_06039962.1| preprotein translocase subunit SecG [Vibrio mimicus MB-451]
 gi|258582389|gb|EEW07238.1| translocase [Vibrio mimicus VM603]
 gi|261893360|gb|EEY39346.1| preprotein translocase subunit SecG [Vibrio mimicus MB-451]
          Length = 111

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 46/113 (40%), Gaps = 9/113 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             FF  S+ LG +S +     +          +  Q +D   +  +   D + 
Sbjct: 61  TIFFVISLVLGNMSTHK---TESQWVDPSQGQVIQQADDTVSETPAKSSDEIP 110


>gi|261856551|ref|YP_003263834.1| preprotein translocase, SecG subunit [Halothiobacillus neapolitanus
           c2]
 gi|261837020|gb|ACX96787.1| preprotein translocase, SecG subunit [Halothiobacillus neapolitanus
           c2]
          Length = 152

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/130 (20%), Positives = 48/130 (36%), Gaps = 6/130 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           MQ  +++ H+++ + L+ ++LIQ    +        GSS      R  A  L + T  L 
Sbjct: 1   MQTLILIGHVLIGLALIGLVLIQHGKGADAGAAFGSGSSGTVFGARGAATFLQKLTGWLV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FFATS+ L  +   + +         +  +    G+      S P        + +S 
Sbjct: 61  VAFFATSLLLAYVINTSHSPSSVVNSVPVSKTDSGDGSKPNPQNSVPSTSESVTPAPASQ 120

Query: 115 VAGKRSSSRT 124
                  S +
Sbjct: 121 GKPSDVPSTS 130


>gi|115524601|ref|YP_781512.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
           BisA53]
 gi|115518548|gb|ABJ06532.1| protein translocase subunit secG [Rhodopseudomonas palustris
           BisA53]
          Length = 130

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/131 (24%), Positives = 54/131 (41%), Gaps = 7/131 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           MQ  ++V+HL++V  L+ ++L+Q S+  A G          F S R TA+ L R T  LA
Sbjct: 1   MQTVIIVIHLMIVATLIALVLLQKSEGGALGVGGGGGGGGGFMSSRGTANLLTRSTGFLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ L  ++ Y   +    + +      +              LDS+  +     
Sbjct: 61  AGFFVTSLTLSWLASYD-RKPASVIDQFPASQTQPGTPTPPVSEGGGLLDSLKQQDQQQS 119

Query: 115 VAGKRSSSRTK 125
                   R++
Sbjct: 120 QPAVPQPPRSQ 130


>gi|300113264|ref|YP_003759839.1| preprotein translocase subunit SecG [Nitrosococcus watsonii C-113]
 gi|299539201|gb|ADJ27518.1| preprotein translocase, SecG subunit [Nitrosococcus watsonii C-113]
          Length = 153

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 39/103 (37%), Gaps = 6/103 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V H++V + LV ++LIQ    +        G+S+     R +   L R +AILA
Sbjct: 1   MHSVLLVFHIVVAIALVGLVLIQHGKGADAGAAFGSGASATVFGARGSGSFLTRASAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGD 97
             FF TS++L   S                    +        
Sbjct: 61  AAFFITSLSLAYFSVRKPQETSVTQTTKPRVIADENMVIPSLP 103


>gi|167625062|ref|YP_001675356.1| preprotein translocase subunit SecG [Shewanella halifaxensis
           HAW-EB4]
 gi|167355084|gb|ABZ77697.1| preprotein translocase, SecG subunit [Shewanella halifaxensis
           HAW-EB4]
          Length = 111

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 47/111 (42%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   LM+++L+V +GLV +ILIQ    +  G+S              + + L R TA+LA
Sbjct: 1   MYEVLMIIYLMVAIGLVGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FFA S+ +G +S   +             +   +      + S  K+  
Sbjct: 61  VAFFALSLTIGNLSANHTKAEGAWDDLGSDAAQVVEQVQQEAEKSEDKIPD 111


>gi|197287227|ref|YP_002153099.1| protein-export membrane protein [Proteus mirabilis HI4320]
 gi|227357078|ref|ZP_03841448.1| Sec family type II general secretory pathway preprotein translocase
           SecG [Proteus mirabilis ATCC 29906]
 gi|194684714|emb|CAR46694.1| protein-export membrane protein [Proteus mirabilis HI4320]
 gi|227162770|gb|EEI47733.1| Sec family type II general secretory pathway preprotein translocase
           SecG [Proteus mirabilis ATCC 29906]
          Length = 114

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/114 (21%), Positives = 44/114 (38%), Gaps = 6/114 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ +I   GLV +IL+Q    +  G+S              +A+ + R TA+LA
Sbjct: 1   MYTALIVILIIAATGLVGLILLQQGKGADMGASFGAGASGTVFGSSGSANFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             F    + LG +S   + R           + + +  +      +P    +  
Sbjct: 61  TVFIVLCLILGNLSANKTVREDSKWMSIEQTAEEAKKAEQLAAPVAPANTDIPQ 114


>gi|212710005|ref|ZP_03318133.1| hypothetical protein PROVALCAL_01056 [Providencia alcalifaciens DSM
           30120]
 gi|212687414|gb|EEB46942.1| hypothetical protein PROVALCAL_01056 [Providencia alcalifaciens DSM
           30120]
          Length = 114

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 47/111 (42%), Gaps = 7/111 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M I L+VV L+  +GL+ ++++Q    +  G+S      +       + + + R T ILA
Sbjct: 1   MYIALLVVFLLAAIGLIGLVMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTGILA 60

Query: 55  FFFFATSIALGMISRYT-STRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG ++     T            +  +Q  D     ++P  D
Sbjct: 61  AVFFVISLILGNMTANKYGTGAGSKWENISEPAKVEQPTDVPAAPATPTSD 111


>gi|297568027|ref|YP_003689371.1| preprotein translocase, SecG subunit [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296923942|gb|ADH84752.1| preprotein translocase, SecG subunit [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 124

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 41/121 (33%), Gaps = 9/121 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS-----AFGSSSNFTSVRSTAHSLGRFTAILAF 55
           M   L+V H++V + LV ++L+Q    +       GSS            + + T + A 
Sbjct: 1   MYTVLIVSHILVCLFLVTIVLLQHGKGASIGASFGGSSQTVFGTEGPLPLMNKITTMAAV 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            F  TSI+L  IS          M R        +      D   P    +   +   V 
Sbjct: 61  VFMITSISLAYISSRAGD--GSVMERVRTTPAPIEEVLPESDE--PVTIPLPGATDGDVP 116

Query: 116 A 116
            
Sbjct: 117 R 117


>gi|28899233|ref|NP_798838.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260879072|ref|ZP_05891427.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           AN-5034]
 gi|260897743|ref|ZP_05906239.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           Peru-466]
 gi|260900799|ref|ZP_05909194.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           AQ4037]
 gi|28807457|dbj|BAC60722.1| preprotein translocase, SecG subunit [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308088981|gb|EFO38676.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           Peru-466]
 gi|308089558|gb|EFO39253.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           AN-5034]
 gi|308108181|gb|EFO45721.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus
           AQ4037]
          Length = 112

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +  G+S              + + L R TAILA
Sbjct: 1   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +      +  +L   + +Q  D   +  +P  D +  
Sbjct: 61  TVFFVVSLLLGRMSTHKTE--SQWVDPTLGQPVVEQVKDAASEVPAPTGDEIPQ 112


>gi|82778489|ref|YP_404838.1| preprotein translocase subunit SecG [Shigella dysenteriae Sd197]
 gi|309785503|ref|ZP_07680134.1| preprotein translocase, SecG subunit [Shigella dysenteriae 1617]
 gi|81242637|gb|ABB63347.1| protein export - membrane protein [Shigella dysenteriae Sd197]
 gi|308926623|gb|EFP72099.1| preprotein translocase, SecG subunit [Shigella dysenteriae 1617]
          Length = 110

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GL+ +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLIGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + S     +          +S
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSEWKNLSAPAKTEQTQPAAPAKPTS 106


>gi|271499171|ref|YP_003332196.1| preprotein translocase subunit SecG [Dickeya dadantii Ech586]
 gi|270342726|gb|ACZ75491.1| preprotein translocase, SecG subunit [Dickeya dadantii Ech586]
          Length = 111

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/110 (21%), Positives = 46/110 (41%), Gaps = 6/110 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+++ L+V +GLV +I++Q    +  G+S      +       + + + R TA+ A
Sbjct: 1   MYEALLIIFLLVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG +S   S +     + S   + +           S  + 
Sbjct: 61  TLFFVLSLILGNMSSDHSKKSSGWDNLSQPAAAEKADQPKAPAAPSSDIP 110


>gi|297538987|ref|YP_003674756.1| preprotein translocase subunit SecG [Methylotenera sp. 301]
 gi|297258334|gb|ADI30179.1| preprotein translocase, SecG subunit [Methylotenera sp. 301]
          Length = 118

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/118 (18%), Positives = 46/118 (38%), Gaps = 7/118 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M+  ++V+H+I  +G++ ++L+Q    +  G+S       +   V  +A+ + R TA+  
Sbjct: 1   MEKLVLVIHVIAALGVIALVLLQHGKGADMGASFGSGASGSLFGVSGSANFMSRATAVFV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             FF TS+ L  +S +        +      S             +       A+   
Sbjct: 61  LIFFTTSLTLAYMSSHK-EGDGSVVKALAEKSAVVNTTAPAAKADAVTPPVAPAQDIP 117


>gi|24114464|ref|NP_708974.1| preprotein translocase subunit SecG [Shigella flexneri 2a str. 301]
 gi|30064513|ref|NP_838684.1| preprotein translocase subunit SecG [Shigella flexneri 2a str.
           2457T]
 gi|82545587|ref|YP_409534.1| preprotein translocase subunit SecG [Shigella boydii Sb227]
 gi|162139328|ref|YP_690561.2| preprotein translocase subunit SecG [Shigella flexneri 5 str. 8401]
 gi|24053646|gb|AAN44681.1| protein translocase membrane component [Shigella flexneri 2a str.
           301]
 gi|30042772|gb|AAP18495.1| protein translocase membrane component [Shigella flexneri 2a str.
           2457T]
 gi|81246998|gb|ABB67706.1| SecG [Shigella boydii Sb227]
 gi|313648583|gb|EFS13025.1| preprotein translocase, SecG subunit [Shigella flexneri 2a str.
           2457T]
          Length = 110

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + R  +  + S     +          +S
Sbjct: 61  TLFFIISLVLGNINSNKTNRGSEWENLSAPAKTEQTQPAAPAKPTS 106


>gi|328474231|gb|EGF45036.1| preprotein translocase subunit SecG [Vibrio parahaemolyticus 10329]
          Length = 112

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +  G+S              + + L R TAILA
Sbjct: 1   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +      +  +L   + +Q  D   +  +P  D +  
Sbjct: 61  TVFFVVSLLLGRMSTHKTE--SQWVDPTLGQPVVEQVKDAASEIPAPTGDEIPQ 112


>gi|238897566|ref|YP_002923245.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229465323|gb|ACQ67097.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 109

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/111 (18%), Positives = 48/111 (43%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L++  L++ + LV  I++Q    +  G+S      ++      + + + R T++LA
Sbjct: 1   MYHALLIFFLLISILLVGCIMLQQGKGADVGASFGAGVSTSLFGSNGSGNFMTRMTSVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG I+    + +++        S + +  +N  +     +  
Sbjct: 61  TLFFIISLILGNIATNKKSEWENL--NQPEKSGQAKKTENPVNKPQTDIPQ 109


>gi|146308626|ref|YP_001189091.1| preprotein translocase subunit SecG [Pseudomonas mendocina ymp]
 gi|145576827|gb|ABP86359.1| protein translocase subunit secG [Pseudomonas mendocina ymp]
          Length = 125

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 52/125 (41%), Gaps = 8/125 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           ++  ++V+HL+  +G+V ++L+Q    +  G+S      +     + +A  L +FTAILA
Sbjct: 2   LETVIVVLHLLGAIGVVVLVLLQQGKGADAGASFGAGASATVFGSQGSATFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ L   ++  +             ++ +       +      +   A  +S V
Sbjct: 62  TGFFITSLGLAFFAKEKADALSQV--GLPDPAVLEVQQKPAVEDVPVLEEQAPASDASDV 119

Query: 115 VAGKR 119
                
Sbjct: 120 PEAPE 124


>gi|330447380|ref|ZP_08311029.1| preprotein translocase, SecG subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328491571|dbj|GAA05526.1| preprotein translocase, SecG subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 113

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 45/114 (39%), Gaps = 7/114 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++L+Q    +  G+S              + + L R T +LA
Sbjct: 1   MYEILLVIYLVAALGVIGLVLVQQGKGADMGASFGAGASGTLFGSSGSGNFLTRMTTLLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S   +T            +      +      +P  D +  
Sbjct: 61  AIFFVISLVLGNMSAKQATE-GSGWENLTAPATTQPVVEKTNTEKAPSHDEIPQ 113


>gi|251791038|ref|YP_003005759.1| preprotein translocase subunit SecG [Dickeya zeae Ech1591]
 gi|247539659|gb|ACT08280.1| preprotein translocase, SecG subunit [Dickeya zeae Ech1591]
          Length = 111

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/110 (22%), Positives = 46/110 (41%), Gaps = 6/110 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V +GLV +I++Q    +  G+S      +       + + + R TA+ A
Sbjct: 1   MYEALLVIFLLVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG +S   S +     + S   + +           S  + 
Sbjct: 61  TLFFVLSLILGNMSSDHSKKGSGWDNLSQPVAPEKAEQSKAPAAPSSDIP 110


>gi|325293009|ref|YP_004278873.1| Protein-export membrane protein secG [Agrobacterium sp. H13-3]
 gi|325060862|gb|ADY64553.1| Protein-export membrane protein secG [Agrobacterium sp. H13-3]
          Length = 157

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R T ILA  FF
Sbjct: 6   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTGILAALFF 65

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
            TS+ LG+++RY S R  D ++R      +  G  +    +        A++     +G
Sbjct: 66  VTSLGLGLLTRYES-RPTDILNRIPATQGQGNGILDTLGPAQTPATPAPAENGVPTNSG 123


>gi|293416605|ref|ZP_06659244.1| protein-export membrane protein secG [Escherichia coli B185]
 gi|291431961|gb|EFF04944.1| protein-export membrane protein secG [Escherichia coli B185]
          Length = 110

 Score = 76.2 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GL+ +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLIGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + S     +          +S
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTS 106


>gi|304396344|ref|ZP_07378225.1| preprotein translocase, SecG subunit [Pantoea sp. aB]
 gi|304355853|gb|EFM20219.1| preprotein translocase, SecG subunit [Pantoea sp. aB]
          Length = 112

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 44/108 (40%), Gaps = 6/108 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV + LV +I++Q    +  G+S              + + + R T ILA
Sbjct: 1   MYEALLVVFLIVAIALVGMIMLQQGKGADMGASFGAGASGTVFGSSGSGNFMTRTTGILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF  S+ LG ++   +++  +  + S       Q        +   
Sbjct: 61  ALFFIISLVLGNLNSNKASKGSEWENLSAPAQSSQQTEKPAQPVTPGS 108


>gi|300721534|ref|YP_003710809.1| preprotein translocase membrane protein [Xenorhabdus nematophila
           ATCC 19061]
 gi|297628026|emb|CBJ88575.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Xenorhabdus
           nematophila ATCC 19061]
          Length = 112

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/110 (20%), Positives = 42/110 (38%), Gaps = 7/110 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+ + L+V +GL+ ++L+Q    +  G+S              + + + R TAILA
Sbjct: 1   MYEALLGIFLLVGIGLIALVLLQQGKGADMGASFGAGASNTLFGSSGSGNFMTRMTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             F   S+ LG ++                    ++  D   +   P  D
Sbjct: 61  TLFIVISLILGNMTSNKV-GSGSKWDNLSEPEKVEKQTDIPAEPVKPNSD 109


>gi|292493669|ref|YP_003529108.1| preprotein translocase subunit SecG [Nitrosococcus halophilus Nc4]
 gi|291582264|gb|ADE16721.1| preprotein translocase, SecG subunit [Nitrosococcus halophilus Nc4]
          Length = 151

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 55/130 (42%), Gaps = 7/130 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V H++V + LV ++LIQ    +        G+S+     R +A+ L R +AILA
Sbjct: 1   MHSVLLVFHILVAIALVSLVLIQHGKGADAGAAFGSGASATVFGARGSANFLTRASAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS++L   S     +       +    + D+                 ++ +  +
Sbjct: 61  AVFFITSLSLAYFSVREP-QTSSVTQAAEPKIVADEDMVIPPLPKDETTKDKLSEGAQQL 119

Query: 115 VAGKRSSSRT 124
            AG+  S ++
Sbjct: 120 GAGQEESPKS 129


>gi|94265674|ref|ZP_01289414.1| Preprotein translocase SecG subunit [delta proteobacterium MLMS-1]
 gi|93453801|gb|EAT04170.1| Preprotein translocase SecG subunit [delta proteobacterium MLMS-1]
          Length = 125

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 43/117 (36%), Gaps = 8/117 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           MQ  L+V+H++V + LV +IL+Q    ++        S+            + + T   A
Sbjct: 1   MQTILIVIHILVCLFLVVIILLQHGKGASIGASFGSASNQTVFGTEGPMPLMNKITTTAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
            FF ATS++L   S          M +    +  +       +   P+   +     
Sbjct: 61  IFFMATSVSLAYFSSRVGD--GSVMEQVRPPAAIEYEEPLPQEDDEPQAIPLPGGGD 115


>gi|261212249|ref|ZP_05926535.1| preprotein translocase subunit SecG [Vibrio sp. RC341]
 gi|260838857|gb|EEX65508.1| preprotein translocase subunit SecG [Vibrio sp. RC341]
          Length = 111

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 45/113 (39%), Gaps = 9/113 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             FF  S+ LG +S +     +          +  Q  +   +  +   D + 
Sbjct: 61  TVFFVISLVLGNMSTHK---TESQWVDPSQGQVIQQAGETVSEAPAKSSDEIP 110


>gi|254706679|ref|ZP_05168507.1| preprotein translocase subunit SecG [Brucella pinnipedialis
           M163/99/10]
 gi|261314140|ref|ZP_05953337.1| preprotein translocase subunit SecG [Brucella pinnipedialis
           M163/99/10]
 gi|261303166|gb|EEY06663.1| preprotein translocase subunit SecG [Brucella pinnipedialis
           M163/99/10]
          Length = 148

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 65/124 (52%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R    +         G  S+P   S +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPATT---------GSQSAPAGGSTNGGGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|254701879|ref|ZP_05163707.1| preprotein translocase subunit SecG [Brucella suis bv. 5 str. 513]
 gi|261752442|ref|ZP_05996151.1| preprotein translocase subunit SecG [Brucella suis bv. 5 str. 513]
 gi|261742195|gb|EEY30121.1| preprotein translocase subunit SecG [Brucella suis bv. 5 str. 513]
          Length = 148

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 65/124 (52%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R    +         G  S+P   S +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPATT---------GSQSAPAGGSTNGGGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|308189110|ref|YP_003933241.1| Protein-export membrane protein secG [Pantoea vagans C9-1]
 gi|308059620|gb|ADO11792.1| Protein-export membrane protein secG [Pantoea vagans C9-1]
          Length = 112

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 44/108 (40%), Gaps = 6/108 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV + LV +I++Q    +  G+S              + + + R T ILA
Sbjct: 1   MYEALLVVFLIVAIALVGMIMLQQGKGADMGASFGAGASGTVFGSSGSGNFMTRTTGILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF  S+ LG ++   +++  +  + S       Q        +   
Sbjct: 61  ALFFIISLVLGNLNSNKASKGSEWENLSAPVQSSQQTEKPAQPVTPGS 108


>gi|261342618|ref|ZP_05970476.1| homoserine dehydrogenase [Enterobacter cancerogenus ATCC 35316]
 gi|288315266|gb|EFC54204.1| homoserine dehydrogenase [Enterobacter cancerogenus ATCC 35316]
          Length = 110

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ LIV + LV +I++Q    +  G+S              +A+ + R TAILA
Sbjct: 1   MYEALLVIFLIVAIALVALIMLQQGKGADMGASFGAGASGTLFGSSGSANFMTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   +++  +  + S     +          +S
Sbjct: 61  TLFFIISLVLGNINSNKTSKGSEWENLSAPSKTEQTQPAEPAKPTS 106


>gi|317046738|ref|YP_004114386.1| preprotein translocase subunit SecG [Pantoea sp. At-9b]
 gi|316948355|gb|ADU67830.1| preprotein translocase, SecG subunit [Pantoea sp. At-9b]
          Length = 110

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 44/111 (39%), Gaps = 7/111 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVALGLVGLIMLQQGKGADMGASFGAGASATLFGSTGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG ++    T            +  +Q            +  
Sbjct: 61  TLFFIISLILGNLNTNK-TSKGSEWENLTAPAKSEQTQPAKPATPGNDIPQ 110


>gi|94268755|ref|ZP_01291276.1| Preprotein translocase SecG subunit [delta proteobacterium MLMS-1]
 gi|93451477|gb|EAT02311.1| Preprotein translocase SecG subunit [delta proteobacterium MLMS-1]
          Length = 125

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 43/117 (36%), Gaps = 8/117 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           MQ  L+V+H++V + LV +IL+Q    ++        S+            + + T   A
Sbjct: 1   MQTILIVIHILVCLFLVVIILLQHGKGASIGASFGSASNQTVFGTEGPMPLMNKITTTAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
            FF ATS++L   S          M +    +  +       +   P+   +     
Sbjct: 61  IFFMATSVSLAYFSSRVGD--GSVMEQVRPPAAIEYEEPLPQEDDEPQAIPLPGGGD 115


>gi|15833308|ref|NP_312081.1| preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           Sakai]
 gi|16131065|ref|NP_417642.1| preprotein translocase membrane subunit [Escherichia coli str. K-12
           substr. MG1655]
 gi|74313712|ref|YP_312131.1| preprotein translocase subunit SecG [Shigella sonnei Ss046]
 gi|89109938|ref|AP_003718.1| preprotein translocase membrane subunit [Escherichia coli str. K-12
           substr. W3110]
 gi|110643415|ref|YP_671145.1| preprotein translocase subunit SecG [Escherichia coli 536]
 gi|117625469|ref|YP_858792.1| preprotein translocase subunit SecG [Escherichia coli APEC O1]
 gi|161486108|ref|NP_755798.2| preprotein translocase subunit SecG [Escherichia coli CFT073]
 gi|162138366|ref|YP_542582.2| preprotein translocase subunit SecG [Escherichia coli UTI89]
 gi|168749232|ref|ZP_02774254.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4113]
 gi|168754154|ref|ZP_02779161.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4401]
 gi|168762139|ref|ZP_02787146.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4501]
 gi|168769591|ref|ZP_02794598.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773160|ref|ZP_02798167.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4196]
 gi|168781316|ref|ZP_02806323.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4076]
 gi|168786058|ref|ZP_02811065.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC869]
 gi|168797774|ref|ZP_02822781.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC508]
 gi|170082710|ref|YP_001732030.1| preprotein translocase membrane subunit [Escherichia coli str. K-12
           substr. DH10B]
 gi|187733049|ref|YP_001881910.1| preprotein translocase subunit SecG [Shigella boydii CDC 3083-94]
 gi|191172219|ref|ZP_03033762.1| preprotein translocase, SecG subunit [Escherichia coli F11]
 gi|193062136|ref|ZP_03043232.1| preprotein translocase, SecG subunit [Escherichia coli E22]
 gi|194430232|ref|ZP_03062730.1| preprotein translocase, SecG subunit [Escherichia coli B171]
 gi|194433719|ref|ZP_03065994.1| preprotein translocase, SecG subunit [Shigella dysenteriae 1012]
 gi|195938393|ref|ZP_03083775.1| preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           EC4024]
 gi|208806607|ref|ZP_03248944.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4206]
 gi|208814133|ref|ZP_03255462.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4045]
 gi|208818987|ref|ZP_03259307.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4042]
 gi|209400768|ref|YP_002272645.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4115]
 gi|215488491|ref|YP_002330922.1| preprotein translocase subunit SecG [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217326643|ref|ZP_03442726.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           TW14588]
 gi|218550458|ref|YP_002384249.1| preprotein translocase subunit SecG [Escherichia fergusonii ATCC
           35469]
 gi|218555745|ref|YP_002388658.1| preprotein translocase subunit SecG [Escherichia coli IAI1]
 gi|218560245|ref|YP_002393158.1| preprotein translocase subunit SecG [Escherichia coli S88]
 gi|218691465|ref|YP_002399677.1| preprotein translocase subunit SecG [Escherichia coli ED1a]
 gi|218696880|ref|YP_002404547.1| preprotein translocase subunit SecG [Escherichia coli 55989]
 gi|218701944|ref|YP_002409573.1| preprotein translocase subunit SecG [Escherichia coli IAI39]
 gi|218706795|ref|YP_002414314.1| preprotein translocase subunit SecG [Escherichia coli UMN026]
 gi|227887896|ref|ZP_04005701.1| Sec family type II general secretory pathway preprotein translocase
           SecG [Escherichia coli 83972]
 gi|238902277|ref|YP_002928073.1| preprotein translocase membrane subunit [Escherichia coli BW2952]
 gi|254795124|ref|YP_003079961.1| preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           TW14359]
 gi|256024251|ref|ZP_05438116.1| preprotein translocase subunit SecG [Escherichia sp. 4_1_40B]
 gi|260845988|ref|YP_003223766.1| preprotein translocase membrane subunit [Escherichia coli O103:H2
           str. 12009]
 gi|261228185|ref|ZP_05942466.1| preprotein translocase membrane subunit [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261255041|ref|ZP_05947574.1| preprotein translocase membrane subunit [Escherichia coli O157:H7
           str. FRIK966]
 gi|291284549|ref|YP_003501367.1| Preprotein translocase IISP family, auxillary membrane component
           [Escherichia coli O55:H7 str. CB9615]
 gi|293406784|ref|ZP_06650710.1| protein-export membrane protein secG [Escherichia coli FVEC1412]
 gi|293412547|ref|ZP_06655270.1| preprotein translocase subunit SecG [Escherichia coli B354]
 gi|298382525|ref|ZP_06992122.1| preprotein translocase SecG subunit [Escherichia coli FVEC1302]
 gi|300897939|ref|ZP_07116318.1| preprotein translocase, SecG subunit [Escherichia coli MS 198-1]
 gi|300918931|ref|ZP_07135490.1| preprotein translocase, SecG subunit [Escherichia coli MS 115-1]
 gi|300938085|ref|ZP_07152863.1| preprotein translocase, SecG subunit [Escherichia coli MS 21-1]
 gi|300948824|ref|ZP_07162892.1| preprotein translocase, SecG subunit [Escherichia coli MS 116-1]
 gi|300955760|ref|ZP_07168105.1| preprotein translocase, SecG subunit [Escherichia coli MS 175-1]
 gi|300980133|ref|ZP_07174853.1| preprotein translocase, SecG subunit [Escherichia coli MS 200-1]
 gi|300990776|ref|ZP_07179348.1| preprotein translocase, SecG subunit [Escherichia coli MS 45-1]
 gi|301022030|ref|ZP_07185973.1| preprotein translocase, SecG subunit [Escherichia coli MS 69-1]
 gi|301025981|ref|ZP_07189463.1| preprotein translocase, SecG subunit [Escherichia coli MS 196-1]
 gi|301047982|ref|ZP_07195024.1| preprotein translocase, SecG subunit [Escherichia coli MS 185-1]
 gi|301644885|ref|ZP_07244857.1| preprotein translocase, SecG subunit [Escherichia coli MS 146-1]
 gi|307139860|ref|ZP_07499216.1| preprotein translocase subunit SecG [Escherichia coli H736]
 gi|312968488|ref|ZP_07782697.1| preprotein translocase, SecG subunit [Escherichia coli 2362-75]
 gi|331643873|ref|ZP_08345004.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli H736]
 gi|331648975|ref|ZP_08350063.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli M605]
 gi|331654779|ref|ZP_08355779.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli M718]
 gi|331659462|ref|ZP_08360404.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli TA206]
 gi|331664787|ref|ZP_08365692.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli TA143]
 gi|331684822|ref|ZP_08385414.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli H299]
 gi|84028696|sp|P0AGA1|SECG_ECO57 RecName: Full=Protein-export membrane protein secG; AltName:
           Full=P12; AltName: Full=Preprotein translocase band 1
           subunit
 gi|84028697|sp|P0AGA0|SECG_ECOL6 RecName: Full=Protein-export membrane protein secG; AltName:
           Full=P12; AltName: Full=Preprotein translocase band 1
           subunit
 gi|84028698|sp|P0AG99|SECG_ECOLI RecName: Full=Protein-export membrane protein SecG; AltName:
           Full=P12; AltName: Full=Preprotein translocase band 1
           subunit
 gi|431135|dbj|BAA03930.1| p12 [Escherichia coli]
 gi|606113|gb|AAA57976.1| p12 [Escherichia coli str. K-12 substr. MG1655]
 gi|746404|gb|AAA97511.1| membrane protein [Escherichia coli]
 gi|1789565|gb|AAC76207.1| preprotein translocase membrane subunit [Escherichia coli str. K-12
           substr. MG1655]
 gi|13363527|dbj|BAB37477.1| protein-export protein SecG [Escherichia coli O157:H7 str. Sakai]
 gi|73857189|gb|AAZ89896.1| SecG [Shigella sonnei Ss046]
 gi|85675969|dbj|BAE77219.1| preprotein translocase membrane subunit [Escherichia coli str. K12
           substr. W3110]
 gi|110345007|gb|ABG71244.1| protein-export membrane protein SecG [Escherichia coli 536]
 gi|115514593|gb|ABJ02668.1| putative export membrane protein [Escherichia coli APEC O1]
 gi|169890545|gb|ACB04252.1| preprotein translocase membrane subunit [Escherichia coli str. K-12
           substr. DH10B]
 gi|187430041|gb|ACD09315.1| preprotein translocase, SecG subunit [Shigella boydii CDC 3083-94]
 gi|187770894|gb|EDU34738.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4196]
 gi|188016351|gb|EDU54473.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4113]
 gi|189001111|gb|EDU70097.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4076]
 gi|189358577|gb|EDU76996.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4401]
 gi|189361469|gb|EDU79888.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4486]
 gi|189367573|gb|EDU85989.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4501]
 gi|189373954|gb|EDU92370.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC869]
 gi|189379688|gb|EDU98104.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC508]
 gi|190907529|gb|EDV67125.1| preprotein translocase, SecG subunit [Escherichia coli F11]
 gi|192932356|gb|EDV84954.1| preprotein translocase, SecG subunit [Escherichia coli E22]
 gi|194411733|gb|EDX28057.1| preprotein translocase, SecG subunit [Escherichia coli B171]
 gi|194417982|gb|EDX34076.1| preprotein translocase, SecG subunit [Shigella dysenteriae 1012]
 gi|208726408|gb|EDZ76009.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4206]
 gi|208735410|gb|EDZ84097.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4045]
 gi|208739110|gb|EDZ86792.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4042]
 gi|209162168|gb|ACI39601.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           EC4115]
 gi|209758288|gb|ACI77456.1| protein-export protein SecG [Escherichia coli]
 gi|209758290|gb|ACI77457.1| protein-export protein SecG [Escherichia coli]
 gi|209758292|gb|ACI77458.1| protein-export protein SecG [Escherichia coli]
 gi|209758294|gb|ACI77459.1| protein-export protein SecG [Escherichia coli]
 gi|209758296|gb|ACI77460.1| protein-export protein SecG [Escherichia coli]
 gi|215266563|emb|CAS11002.1| preprotein translocase membrane subunit [Escherichia coli O127:H6
           str. E2348/69]
 gi|217319010|gb|EEC27435.1| preprotein translocase, SecG subunit [Escherichia coli O157:H7 str.
           TW14588]
 gi|218353612|emb|CAU99807.1| preprotein translocase membrane subunit [Escherichia coli 55989]
 gi|218357999|emb|CAQ90645.1| preprotein translocase membrane subunit [Escherichia fergusonii
           ATCC 35469]
 gi|218362513|emb|CAR00137.1| preprotein translocase membrane subunit [Escherichia coli IAI1]
 gi|218367014|emb|CAR04785.1| preprotein translocase membrane subunit [Escherichia coli S88]
 gi|218371930|emb|CAR19786.1| preprotein translocase membrane subunit [Escherichia coli IAI39]
 gi|218429029|emb|CAR09976.2| preprotein translocase membrane subunit [Escherichia coli ED1a]
 gi|218433892|emb|CAR14809.1| preprotein translocase membrane subunit [Escherichia coli UMN026]
 gi|227835292|gb|EEJ45758.1| Sec family type II general secretory pathway preprotein translocase
           SecG [Escherichia coli 83972]
 gi|238863271|gb|ACR65269.1| preprotein translocase membrane subunit [Escherichia coli BW2952]
 gi|254594524|gb|ACT73885.1| preprotein translocase membrane subunit [Escherichia coli O157:H7
           str. TW14359]
 gi|257761135|dbj|BAI32632.1| preprotein translocase membrane subunit [Escherichia coli O103:H2
           str. 12009]
 gi|260447798|gb|ACX38220.1| preprotein translocase, SecG subunit [Escherichia coli DH1]
 gi|281180217|dbj|BAI56547.1| preprotein translocase [Escherichia coli SE15]
 gi|284923198|emb|CBG36292.1| protein-export membrane protein [Escherichia coli 042]
 gi|290764422|gb|ADD58383.1| Preprotein translocase IISP family, auxillary membrane component
           [Escherichia coli O55:H7 str. CB9615]
 gi|291426790|gb|EFE99822.1| protein-export membrane protein secG [Escherichia coli FVEC1412]
 gi|291469318|gb|EFF11809.1| preprotein translocase subunit SecG [Escherichia coli B354]
 gi|294493447|gb|ADE92203.1| preprotein translocase, SecG subunit [Escherichia coli IHE3034]
 gi|298277665|gb|EFI19181.1| preprotein translocase SecG subunit [Escherichia coli FVEC1302]
 gi|299879876|gb|EFI88087.1| preprotein translocase, SecG subunit [Escherichia coli MS 196-1]
 gi|300300125|gb|EFJ56510.1| preprotein translocase, SecG subunit [Escherichia coli MS 185-1]
 gi|300307855|gb|EFJ62375.1| preprotein translocase, SecG subunit [Escherichia coli MS 200-1]
 gi|300317393|gb|EFJ67177.1| preprotein translocase, SecG subunit [Escherichia coli MS 175-1]
 gi|300358369|gb|EFJ74239.1| preprotein translocase, SecG subunit [Escherichia coli MS 198-1]
 gi|300397745|gb|EFJ81283.1| preprotein translocase, SecG subunit [Escherichia coli MS 69-1]
 gi|300407084|gb|EFJ90622.1| preprotein translocase, SecG subunit [Escherichia coli MS 45-1]
 gi|300413957|gb|EFJ97267.1| preprotein translocase, SecG subunit [Escherichia coli MS 115-1]
 gi|300451713|gb|EFK15333.1| preprotein translocase, SecG subunit [Escherichia coli MS 116-1]
 gi|300456945|gb|EFK20438.1| preprotein translocase, SecG subunit [Escherichia coli MS 21-1]
 gi|301076830|gb|EFK91636.1| preprotein translocase, SecG subunit [Escherichia coli MS 146-1]
 gi|307555269|gb|ADN48044.1| protein-export membrane protein SecG [Escherichia coli ABU 83972]
 gi|307625226|gb|ADN69530.1| preprotein translocase subunit SecG [Escherichia coli UM146]
 gi|309703601|emb|CBJ02941.1| protein-export membrane protein [Escherichia coli ETEC H10407]
 gi|312286706|gb|EFR14617.1| preprotein translocase, SecG subunit [Escherichia coli 2362-75]
 gi|315137761|dbj|BAJ44920.1| preprotein translocase IISP family [Escherichia coli DH1]
 gi|315288923|gb|EFU48321.1| preprotein translocase, SecG subunit [Escherichia coli MS 110-3]
 gi|315294921|gb|EFU54260.1| preprotein translocase, SecG subunit [Escherichia coli MS 153-1]
 gi|315297874|gb|EFU57144.1| preprotein translocase, SecG subunit [Escherichia coli MS 16-3]
 gi|320174539|gb|EFW49675.1| Preprotein translocase subunit SecG [Shigella dysenteriae CDC
           74-1112]
 gi|320181450|gb|EFW56368.1| Preprotein translocase subunit SecG [Shigella boydii ATCC 9905]
 gi|320186662|gb|EFW61386.1| Preprotein translocase subunit SecG [Shigella flexneri CDC 796-83]
 gi|320189528|gb|EFW64187.1| Preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           EC1212]
 gi|320194660|gb|EFW69290.1| Preprotein translocase subunit SecG [Escherichia coli WV_060327]
 gi|320640245|gb|EFX09817.1| preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           G5101]
 gi|320645542|gb|EFX14551.1| preprotein translocase subunit SecG [Escherichia coli O157:H- str.
           493-89]
 gi|320650852|gb|EFX19309.1| preprotein translocase subunit SecG [Escherichia coli O157:H- str.
           H 2687]
 gi|320656233|gb|EFX24145.1| preprotein translocase subunit SecG [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661923|gb|EFX29331.1| preprotein translocase subunit SecG [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320666758|gb|EFX33737.1| preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323162867|gb|EFZ48702.1| preprotein translocase, SecG subunit [Escherichia coli E128010]
 gi|323165134|gb|EFZ50924.1| preprotein translocase, SecG subunit [Shigella sonnei 53G]
 gi|323173565|gb|EFZ59194.1| preprotein translocase, SecG subunit [Escherichia coli LT-68]
 gi|323183129|gb|EFZ68527.1| preprotein translocase, SecG subunit [Escherichia coli 1357]
 gi|323189204|gb|EFZ74488.1| preprotein translocase, SecG subunit [Escherichia coli RN587/1]
 gi|323936131|gb|EGB32425.1| preprotein translocase SecG [Escherichia coli E1520]
 gi|323951306|gb|EGB47181.1| preprotein translocase SecG subunit [Escherichia coli H252]
 gi|323957678|gb|EGB53392.1| preprotein translocase SecG subunit [Escherichia coli H263]
 gi|323966355|gb|EGB61789.1| preprotein translocase SecG subunit [Escherichia coli M863]
 gi|323979108|gb|EGB74186.1| preprotein translocase SecG subunit [Escherichia coli TW10509]
 gi|324012098|gb|EGB81317.1| preprotein translocase, SecG subunit [Escherichia coli MS 60-1]
 gi|324115221|gb|EGC09185.1| preprotein translocase SecG subunit [Escherichia fergusonii B253]
 gi|324119540|gb|EGC13422.1| preprotein translocase SecG subunit [Escherichia coli E1167]
 gi|326337875|gb|EGD61709.1| Preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           1125]
 gi|326347445|gb|EGD71170.1| Preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           1044]
 gi|330909229|gb|EGH37743.1| preprotein translocase subunit SecG [Escherichia coli AA86]
 gi|331037344|gb|EGI09568.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli H736]
 gi|331042722|gb|EGI14864.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli M605]
 gi|331048161|gb|EGI20238.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli M718]
 gi|331054044|gb|EGI26073.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli TA206]
 gi|331058035|gb|EGI30017.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli TA143]
 gi|331078437|gb|EGI49643.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli H299]
 gi|332086095|gb|EGI91257.1| preprotein translocase, SecG subunit [Shigella boydii 5216-82]
          Length = 110

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + S     +          +S
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTS 106


>gi|261253853|ref|ZP_05946426.1| preprotein translocase subunit SecG [Vibrio orientalis CIP 102891]
 gi|323499458|ref|ZP_08104430.1| preprotein translocase subunit SecG [Vibrio sinaloensis DSM 21326]
 gi|260937244|gb|EEX93233.1| preprotein translocase subunit SecG [Vibrio orientalis CIP 102891]
 gi|323315514|gb|EGA68553.1| preprotein translocase subunit SecG [Vibrio sinaloensis DSM 21326]
          Length = 110

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 48/114 (42%), Gaps = 10/114 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  VG++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +                 Q  D+  +  +P+ D +  
Sbjct: 61  TVFFILSLVLGNMSTHKTESQ----WVDPTQGQVIQQADDASEIPAPQGDEIPQ 110


>gi|294634512|ref|ZP_06713047.1| homoserine dehydrogenase [Edwardsiella tarda ATCC 23685]
 gi|291092026|gb|EFE24587.1| homoserine dehydrogenase [Edwardsiella tarda ATCC 23685]
          Length = 120

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/110 (20%), Positives = 45/110 (40%), Gaps = 6/110 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L++ V L+ +I++Q    +  G+S      +       + + + R T ILA
Sbjct: 10  MYEALLVIFLLISVALIALIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRTTGILA 69

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG +S + + +  +  +       +           S  + 
Sbjct: 70  TLFFVLSLVLGNLSGHQNKQGSEWDNLGQPVKTEQPAKPAAPATPSSDIP 119


>gi|254719200|ref|ZP_05181011.1| preprotein translocase subunit SecG [Brucella sp. 83/13]
 gi|265984196|ref|ZP_06096931.1| preprotein translocase subunit SecG [Brucella sp. 83/13]
 gi|264662788|gb|EEZ33049.1| preprotein translocase subunit SecG [Brucella sp. 83/13]
          Length = 136

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 65/124 (52%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R    +         G  S+P   S +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPATT---------GSQSAPAGGSTNGSGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|161619089|ref|YP_001592976.1| preprotein translocase subunit SecG [Brucella canis ATCC 23365]
 gi|161335900|gb|ABX62205.1| preprotein translocase, SecG subunit [Brucella canis ATCC 23365]
          Length = 148

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 43/124 (34%), Positives = 64/124 (51%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R    +         G  S+P     +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPATT---------GSQSAPAGGRTNGGGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|316933954|ref|YP_004108936.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
           DX-1]
 gi|315601668|gb|ADU44203.1| preprotein translocase, SecG subunit [Rhodopseudomonas palustris
           DX-1]
          Length = 135

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 5/110 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           MQ  ++V+HL++V+GL+ V+L+Q S+    G        F S R TA+ L R TAILA  
Sbjct: 1   MQTVIIVIHLMLVLGLIGVVLLQKSEGGGLGVGGGGGGGFMSSRGTANLLTRTTAILAVG 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSV 106
           FF TS+ L  ++ Y + +    +  + +                  LD++
Sbjct: 61  FFITSLLLTWLASY-NRKPTTILPTAPIQQQVPGQPAPPVSQGGGLLDTL 109


>gi|170765735|ref|ZP_02900546.1| preprotein translocase, SecG subunit [Escherichia albertii TW07627]
 gi|170124881|gb|EDS93812.1| preprotein translocase, SecG subunit [Escherichia albertii TW07627]
          Length = 110

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + S     +          +S
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSEWENLSAPAKAEQTQPAAPAKPTS 106


>gi|307129382|ref|YP_003881398.1| preprotein translocase membrane subunit [Dickeya dadantii 3937]
 gi|306526911|gb|ADM96841.1| preprotein translocase membrane subunit [Dickeya dadantii 3937]
          Length = 111

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 46/110 (41%), Gaps = 6/110 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ LIV +GLV +I++Q    +  G+S      +       + + + R TA+ A
Sbjct: 1   MYEALLVIFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG +S   S +  +    S   + +           S  + 
Sbjct: 61  TLFFVLSLILGNMSSDHSKKGSEWESLSQPAAPEKAEQSKAPAAPSSDIP 110


>gi|109897896|ref|YP_661151.1| preprotein translocase subunit SecG [Pseudoalteromonas atlantica
           T6c]
 gi|109700177|gb|ABG40097.1| protein translocase subunit secG [Pseudoalteromonas atlantica T6c]
          Length = 123

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 45/121 (37%), Gaps = 7/121 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILAF 55
              L+VV+LIV + L+  +LIQ    +  G       S+       + + L R TAILA 
Sbjct: 3   YEVLIVVYLIVAIMLIGFVLIQQGKGADMGASFGSGGSNTVFGSTGSGNFLTRTTAILAT 62

Query: 56  FFFATSIALGMISRYTSTRYKDNMH-RSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
           FFF  S+ LG  +        D  +    V     Q      +   P   S +  S    
Sbjct: 63  FFFVISLILGNQTADKEKAVDDWQNIEVPVLDEPAQSTTAPVESDVPVTTSDAPASDVPQ 122

Query: 115 V 115
            
Sbjct: 123 S 123


>gi|226946310|ref|YP_002801383.1| preprotein translocase subunit SecG [Azotobacter vinelandii DJ]
 gi|226721237|gb|ACO80408.1| Preprotein translocase SecG subunit [Azotobacter vinelandii DJ]
          Length = 129

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 49/124 (39%), Gaps = 11/124 (8%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAF 55
           +  ++V HL+  +G++ ++LIQ    +        G+S+     + ++  L R TAILA 
Sbjct: 5   ETIVIVFHLLAALGVIALVLIQQGKGAEAGASFGSGASATVFGSQGSSTFLSRVTAILAT 64

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS-----PKLDSVSAKS 110
            FF TS+ LG +++  +                 Q      D        P  D+V    
Sbjct: 65  AFFLTSLGLGFLAKEKADSLSKVGLPDPAALEVQQKKPAAEDVPVLEERKPAGDAVDVPQ 124

Query: 111 SSSV 114
           +   
Sbjct: 125 APEQ 128


>gi|258623145|ref|ZP_05718156.1| translocase [Vibrio mimicus VM573]
 gi|258584565|gb|EEW09303.1| translocase [Vibrio mimicus VM573]
          Length = 111

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 46/114 (40%), Gaps = 9/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S +     +          +  Q +D   +  +   D +  
Sbjct: 61  TIFFVISLVLGNMSTHK---TESQWVDPSQGQVIQQADDTVSETPAKSSDEIPQ 111


>gi|157376524|ref|YP_001475124.1| preprotein translocase subunit SecG [Shewanella sediminis HAW-EB3]
 gi|157318898|gb|ABV37996.1| preprotein translocase, SecG subunit [Shewanella sediminis HAW-EB3]
          Length = 115

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 49/114 (42%), Gaps = 7/114 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   LMVV+L+V +GLV +ILIQ    +  G+S      +         + L R TA+LA
Sbjct: 1   MYEVLMVVYLVVAIGLVGLILIQQGKGADMGASFGAGASATLFGSSGAGNFLTRSTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMH-RSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             FFA S+ +G +S   +          S    + +Q  +     S    + + 
Sbjct: 61  IGFFALSLTIGNLSANHTKSEDAWKDLSSDAAQVTEQVTEQVKQESEKSEEKIP 114


>gi|157155933|ref|YP_001464650.1| preprotein translocase subunit SecG [Escherichia coli E24377A]
 gi|157162658|ref|YP_001459976.1| preprotein translocase subunit SecG [Escherichia coli HS]
 gi|170018575|ref|YP_001723529.1| preprotein translocase subunit SecG [Escherichia coli ATCC 8739]
 gi|188492818|ref|ZP_03000088.1| preprotein translocase, SecG subunit [Escherichia coli 53638]
 gi|191168047|ref|ZP_03029847.1| preprotein translocase, SecG subunit [Escherichia coli B7A]
 gi|193067481|ref|ZP_03048449.1| preprotein translocase, SecG subunit [Escherichia coli E110019]
 gi|194438755|ref|ZP_03070841.1| preprotein translocase, SecG subunit [Escherichia coli 101-1]
 gi|209920650|ref|YP_002294734.1| preprotein translocase subunit SecG [Escherichia coli SE11]
 gi|253771991|ref|YP_003034822.1| preprotein translocase subunit SecG [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254163117|ref|YP_003046225.1| preprotein translocase subunit SecG [Escherichia coli B str.
           REL606]
 gi|256018907|ref|ZP_05432772.1| preprotein translocase subunit SecG [Shigella sp. D9]
 gi|260857302|ref|YP_003231193.1| preprotein translocase membrane subunit [Escherichia coli O26:H11
           str. 11368]
 gi|260869926|ref|YP_003236328.1| preprotein translocase membrane subunit [Escherichia coli O111:H-
           str. 11128]
 gi|293449509|ref|ZP_06663930.1| preprotein translocase SecG subunit [Escherichia coli B088]
 gi|297518209|ref|ZP_06936595.1| preprotein translocase subunit SecG [Escherichia coli OP50]
 gi|300817573|ref|ZP_07097789.1| preprotein translocase, SecG subunit [Escherichia coli MS 107-1]
 gi|300823862|ref|ZP_07103986.1| preprotein translocase, SecG subunit [Escherichia coli MS 119-7]
 gi|300904360|ref|ZP_07122213.1| preprotein translocase, SecG subunit [Escherichia coli MS 84-1]
 gi|300926086|ref|ZP_07141904.1| preprotein translocase, SecG subunit [Escherichia coli MS 182-1]
 gi|300929865|ref|ZP_07145311.1| preprotein translocase, SecG subunit [Escherichia coli MS 187-1]
 gi|301301768|ref|ZP_07207902.1| preprotein translocase, SecG subunit [Escherichia coli MS 124-1]
 gi|301326403|ref|ZP_07219757.1| preprotein translocase, SecG subunit [Escherichia coli MS 78-1]
 gi|307313120|ref|ZP_07592746.1| preprotein translocase, SecG subunit [Escherichia coli W]
 gi|309793752|ref|ZP_07688178.1| preprotein translocase, SecG subunit [Escherichia coli MS 145-7]
 gi|312972551|ref|ZP_07786725.1| preprotein translocase, SecG subunit [Escherichia coli 1827-70]
 gi|331670002|ref|ZP_08370847.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli TA271]
 gi|331679254|ref|ZP_08379926.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli H591]
 gi|157068338|gb|ABV07593.1| preprotein translocase, SecG subunit [Escherichia coli HS]
 gi|157077963|gb|ABV17671.1| preprotein translocase, SecG subunit [Escherichia coli E24377A]
 gi|169753503|gb|ACA76202.1| preprotein translocase, SecG subunit [Escherichia coli ATCC 8739]
 gi|188488017|gb|EDU63120.1| preprotein translocase, SecG subunit [Escherichia coli 53638]
 gi|190901916|gb|EDV61665.1| preprotein translocase, SecG subunit [Escherichia coli B7A]
 gi|192959438|gb|EDV89873.1| preprotein translocase, SecG subunit [Escherichia coli E110019]
 gi|194422227|gb|EDX38228.1| preprotein translocase, SecG subunit [Escherichia coli 101-1]
 gi|209913909|dbj|BAG78983.1| preprotein translocase [Escherichia coli SE11]
 gi|242378718|emb|CAQ33508.1| secG, subunit of SecEGY-Secretion Complex and Sec Protein Secretion
           Complex [Escherichia coli BL21(DE3)]
 gi|253323035|gb|ACT27637.1| preprotein translocase, SecG subunit [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975018|gb|ACT40689.1| protein-export membrane protein [Escherichia coli B str. REL606]
 gi|253979174|gb|ACT44844.1| protein-export membrane protein [Escherichia coli BL21(DE3)]
 gi|257755951|dbj|BAI27453.1| preprotein translocase membrane subunit [Escherichia coli O26:H11
           str. 11368]
 gi|257766282|dbj|BAI37777.1| preprotein translocase membrane subunit [Escherichia coli O111:H-
           str. 11128]
 gi|291322599|gb|EFE62028.1| preprotein translocase SecG subunit [Escherichia coli B088]
 gi|300403711|gb|EFJ87249.1| preprotein translocase, SecG subunit [Escherichia coli MS 84-1]
 gi|300417851|gb|EFK01162.1| preprotein translocase, SecG subunit [Escherichia coli MS 182-1]
 gi|300462227|gb|EFK25720.1| preprotein translocase, SecG subunit [Escherichia coli MS 187-1]
 gi|300523630|gb|EFK44699.1| preprotein translocase, SecG subunit [Escherichia coli MS 119-7]
 gi|300529871|gb|EFK50933.1| preprotein translocase, SecG subunit [Escherichia coli MS 107-1]
 gi|300842749|gb|EFK70509.1| preprotein translocase, SecG subunit [Escherichia coli MS 124-1]
 gi|300846892|gb|EFK74652.1| preprotein translocase, SecG subunit [Escherichia coli MS 78-1]
 gi|306907031|gb|EFN37539.1| preprotein translocase, SecG subunit [Escherichia coli W]
 gi|308122709|gb|EFO59971.1| preprotein translocase, SecG subunit [Escherichia coli MS 145-7]
 gi|310334928|gb|EFQ01133.1| preprotein translocase, SecG subunit [Escherichia coli 1827-70]
 gi|315062481|gb|ADT76808.1| preprotein translocase membrane subunit [Escherichia coli W]
 gi|315257100|gb|EFU37068.1| preprotein translocase, SecG subunit [Escherichia coli MS 85-1]
 gi|320202089|gb|EFW76664.1| Preprotein translocase subunit SecG [Escherichia coli EC4100B]
 gi|323154388|gb|EFZ40589.1| preprotein translocase, SecG subunit [Escherichia coli EPECa14]
 gi|323178649|gb|EFZ64225.1| preprotein translocase, SecG subunit [Escherichia coli 1180]
 gi|323941725|gb|EGB37904.1| preprotein translocase SecG subunit [Escherichia coli E482]
 gi|323946971|gb|EGB42987.1| preprotein translocase SecG [Escherichia coli H120]
 gi|323961170|gb|EGB56784.1| preprotein translocase SecG subunit [Escherichia coli H489]
 gi|323970262|gb|EGB65533.1| preprotein translocase SecG subunit [Escherichia coli TA007]
 gi|324018300|gb|EGB87519.1| preprotein translocase, SecG subunit [Escherichia coli MS 117-3]
 gi|331062915|gb|EGI34829.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli TA271]
 gi|331073319|gb|EGI44642.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli H591]
 gi|332102347|gb|EGJ05693.1| preprotein translocase subunit SecG [Shigella sp. D9]
          Length = 110

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + S     +          +S
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSEWENLSAPVKTEQTQPAAPAKPTS 106


>gi|270265056|ref|ZP_06193319.1| hypothetical protein SOD_k00920 [Serratia odorifera 4Rx13]
 gi|270040990|gb|EFA14091.1| hypothetical protein SOD_k00920 [Serratia odorifera 4Rx13]
          Length = 111

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 25/111 (22%), Positives = 45/111 (40%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L++ +GLV +I++Q    +  G+S              + + + R TAILA
Sbjct: 1   MYEALLVIFLLISIGLVALIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG +S   S +  +  +       +           S  +  
Sbjct: 61  ALFFVISLILGNLSTNQSKKGSEWENLGQPVKSEQTTAPAAPTKPSSDIPQ 111


>gi|77463939|ref|YP_353443.1| preprotein translocase subunit SecG [Rhodobacter sphaeroides 2.4.1]
 gi|77388357|gb|ABA79542.1| Preprotein translocase SecG subunit [Rhodobacter sphaeroides 2.4.1]
          Length = 208

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 48/120 (40%), Gaps = 2/120 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV-RSTAHSLGRFTAILAFFFFA 59
           MQ  +++VHLI+ + L+ V+L+Q S+    G         R  A+++ R T I A  F  
Sbjct: 1   MQNVVLIVHLILALLLIGVVLLQRSEGGGLGMGGGGAMTGRQAANAMTRMTWIFAIAFIG 60

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           TSIAL + +   S      + +      ++          +  L    A +  +      
Sbjct: 61  TSIALTIFAAQNSH-GSSVIDQFGGTVRQEAPATPEAPLGNDLLPPAPANAPLTPPRADE 119


>gi|332174439|gb|AEE23693.1| preprotein translocase, SecG subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 123

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 45/121 (37%), Gaps = 7/121 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILAF 55
              L+VV+LIV + L+  +LIQ    +  G       S+       + + L R TAILA 
Sbjct: 3   YEVLIVVYLIVAIMLIGFVLIQQGKGADMGASFGSGGSNTVFGSTGSGNFLTRTTAILAT 62

Query: 56  FFFATSIALGMISRYTSTRYKDNMH-RSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
           FFF  S+ LG  +        D  +    V     Q      +   P   S +  S    
Sbjct: 63  FFFVISLILGNQTADKEKAVDDWQNIEVPVLDEPAQSTPAPVESDVPVTTSDAPASDVPQ 122

Query: 115 V 115
            
Sbjct: 123 S 123


>gi|293393156|ref|ZP_06637471.1| homoserine dehydrogenase [Serratia odorifera DSM 4582]
 gi|291424302|gb|EFE97516.1| homoserine dehydrogenase [Serratia odorifera DSM 4582]
          Length = 111

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/111 (21%), Positives = 45/111 (40%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L++ +GLV +I++Q    +  G+S              + + + R TA+LA
Sbjct: 1   MYEALLVIFLLISIGLVALIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG +S   S +  +  +       +           S  +  
Sbjct: 61  TLFFVISLILGNLSSNQSQKGSEWENLGQPVKTEQTTAPAAPAKPSSDIPQ 111


>gi|294142063|ref|YP_003558041.1| preprotein translocase subunit SecG [Shewanella violacea DSS12]
 gi|293328532|dbj|BAJ03263.1| preprotein translocase, SecG subunit [Shewanella violacea DSS12]
          Length = 111

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 46/111 (41%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V++L+V +GLV +ILIQ    +  G+S      +         + L R TA+LA
Sbjct: 1   MYEVLIVIYLLVAIGLVGLILIQQGKGADMGASFGAGASATLFGSSGAGNFLTRSTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FFA S+ +G +S   +         S   +            +  K+  
Sbjct: 61  IGFFALSLIIGNLSANHTKSEDAWSDLSNEAAQVVDQVSEEVQQTEDKIPD 111


>gi|331674711|ref|ZP_08375470.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli TA280]
 gi|331068150|gb|EGI39546.1| protein-export membrane protein SecG (Preprotein translocase band
           1subunit) (P12) [Escherichia coli TA280]
          Length = 110

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 48/106 (45%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + S   + +          +S
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSEWENLSAPANTEQTQPAAPAKPTS 106


>gi|260771176|ref|ZP_05880103.1| preprotein translocase subunit SecG [Vibrio furnissii CIP 102972]
 gi|260613773|gb|EEX38965.1| preprotein translocase subunit SecG [Vibrio furnissii CIP 102972]
 gi|315179218|gb|ADT86132.1| preprotein translocase subunit SecG [Vibrio furnissii NCTC 11218]
          Length = 112

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 49/114 (42%), Gaps = 8/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  VG++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVGIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +      +  S    I+ +  +   D  +   D +  
Sbjct: 61  TVFFIISLVLGNMSTHKTE--SQWVDPSQGQVIQQKAAETVSDAPAKSGDEIPQ 112


>gi|71083625|ref|YP_266344.1| preprotein translocase subunit SecG [Candidatus Pelagibacter
          ubique HTCC1062]
 gi|91761954|ref|ZP_01263919.1| Preprotein translocase SecG subunit [Candidatus Pelagibacter
          ubique HTCC1002]
 gi|71062738|gb|AAZ21741.1| Preprotein translocase SecG subunit [Candidatus Pelagibacter
          ubique HTCC1062]
 gi|91717756|gb|EAS84406.1| Preprotein translocase SecG subunit [Candidatus Pelagibacter
          ubique HTCC1002]
          Length = 99

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 3/97 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS---AFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
          M+  L+VV+L++   LV +IL+Q S+        S  NF   RS  + +G+ TA++A  F
Sbjct: 1  MENILLVVNLVLATILVLLILVQKSEGGALGIGVSQDNFMLSRSAGNFMGKATAVVATLF 60

Query: 58 FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN 94
             S+AL +ISR   T  +  +      S        
Sbjct: 61 IICSLALTIISRGELTPTESVLDIIEEKSSDTPSIPE 97


>gi|238787591|ref|ZP_04631389.1| Protein-export membrane protein secG [Yersinia frederiksenii ATCC
           33641]
 gi|238724378|gb|EEQ16020.1| Protein-export membrane protein secG [Yersinia frederiksenii ATCC
           33641]
          Length = 111

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 45/111 (40%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L++ +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVIFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG +S     +  +  +       +           S  +  
Sbjct: 61  TLFFVISLILGNMSTNQGNKGSEWENLGQPAKTEQTTAPVAPTKPSSDIPQ 111


>gi|254507459|ref|ZP_05119593.1| preprotein translocase, SecG subunit [Vibrio parahaemolyticus 16]
 gi|219549529|gb|EED26520.1| preprotein translocase, SecG subunit [Vibrio parahaemolyticus 16]
          Length = 110

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 48/114 (42%), Gaps = 10/114 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  VG++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +                 Q  D+  +  +P+ D +  
Sbjct: 61  TVFFILSLVLGNMSTHKTESQ----WVDPTQGQIIQQADDASEIPAPQGDEIPQ 110


>gi|323491476|ref|ZP_08096659.1| preprotein translocase subunit SecG [Vibrio brasiliensis LMG 20546]
 gi|323314260|gb|EGA67341.1| preprotein translocase subunit SecG [Vibrio brasiliensis LMG 20546]
          Length = 110

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 48/114 (42%), Gaps = 10/114 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  VG++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S + +                 Q  D+  D  +P+ D +  
Sbjct: 61  TVFFVISLVLGNMSTHKTESQ----WVDPTQGQVIQQADDASDIPAPQGDEIPQ 110


>gi|229525293|ref|ZP_04414698.1| preprotein translocase subunit SecG [Vibrio cholerae bv. albensis
           VL426]
 gi|229338874|gb|EEO03891.1| preprotein translocase subunit SecG [Vibrio cholerae bv. albensis
           VL426]
          Length = 114

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 45/114 (39%), Gaps = 9/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 4   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S +     +          +  Q  D   +  +   D +  
Sbjct: 64  TVFFVISLVLGNMSTHK---TESQWVDPSQGQVIQQAGDTVSETPAKSSDEIPQ 114


>gi|126462773|ref|YP_001043887.1| preprotein translocase subunit SecG [Rhodobacter sphaeroides ATCC
           17029]
 gi|126104437|gb|ABN77115.1| preprotein translocase, SecG subunit [Rhodobacter sphaeroides ATCC
           17029]
          Length = 203

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 48/120 (40%), Gaps = 2/120 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV-RSTAHSLGRFTAILAFFFFA 59
           MQ  +++VHLI+ + L+ V+L+Q S+    G         R  A+++ R T I A  F  
Sbjct: 1   MQNVVLIVHLILALLLIGVVLLQRSEGGGLGMGGGGAMTGRQAANAMTRMTWIFAIAFIG 60

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           TSIAL + +   S      + +      ++          +  L    A +  +      
Sbjct: 61  TSIALTIFAAQNSH-SSSVIDQFGGTVRQEAPATPEAPLGNDLLPPAPANAPLTPPRADE 119


>gi|30142057|gb|AAO17817.1| SecG [Citrobacter rodentium]
          Length = 110

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 46/111 (41%), Gaps = 7/111 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG I+   + +           +  +Q         +  +  
Sbjct: 61  TLFFIISLVLGNINSNKTNK-GSEWENLSAPAKTEQTQPAAPAQPTSDIPQ 110


>gi|306816483|ref|ZP_07450615.1| preprotein translocase subunit SecG [Escherichia coli NC101]
 gi|222034892|emb|CAP77635.1| Protein-export membrane protein secG [Escherichia coli LF82]
 gi|305850048|gb|EFM50507.1| preprotein translocase subunit SecG [Escherichia coli NC101]
 gi|312947732|gb|ADR28559.1| preprotein translocase subunit SecG [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|324008775|gb|EGB77994.1| preprotein translocase, SecG subunit [Escherichia coli MS 57-2]
          Length = 110

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 46/110 (41%), Gaps = 7/110 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG I+   + +           +  +Q         +  + 
Sbjct: 61  TLFFIISLVLGNINSNKTNK-GSEWENLSAPAKTEQTQPAAPAKQTSDIP 109


>gi|170680429|ref|YP_001745447.1| preprotein translocase subunit SecG [Escherichia coli SMS-3-5]
 gi|170518147|gb|ACB16325.1| preprotein translocase, SecG subunit [Escherichia coli SMS-3-5]
          Length = 110

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 48/106 (45%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + S     +   +      +S
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQSAAPAKPTS 106


>gi|157368733|ref|YP_001476722.1| preprotein translocase subunit SecG [Serratia proteamaculans 568]
 gi|157320497|gb|ABV39594.1| preprotein translocase, SecG subunit [Serratia proteamaculans 568]
          Length = 111

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 45/111 (40%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L++ +GLV +I++Q    +  G+S              + + + R TA+LA
Sbjct: 1   MYEALLVIFLLISIGLVALIMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG +S   + +  +  +       +           S  +  
Sbjct: 61  TLFFVISLILGNLSTNQTKKGSEWENLGQPVKSEQTTAPAAPTKPSSDIPQ 111


>gi|123440810|ref|YP_001004801.1| preprotein translocase subunit SecG [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238761765|ref|ZP_04622739.1| Protein-export membrane protein secG [Yersinia kristensenii ATCC
           33638]
 gi|332160076|ref|YP_004296653.1| preprotein translocase subunit SecG [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|122087771|emb|CAL10557.1| protein-export membrane protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238699879|gb|EEP92622.1| Protein-export membrane protein secG [Yersinia kristensenii ATCC
           33638]
 gi|318607364|emb|CBY28862.1| preprotein translocase subunit SecG [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664306|gb|ADZ40950.1| preprotein translocase subunit SecG [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862033|emb|CBX72199.1| protein-export membrane protein secG [Yersinia enterocolitica
           W22703]
          Length = 111

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 45/111 (40%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L++ +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVIFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG +S     +  +  +       +           S  +  
Sbjct: 61  ALFFVISLILGNMSTNQGNKGSEWENLGQPAKAEQTTAPVAPTKPSSDIPQ 111


>gi|306841862|ref|ZP_07474543.1| preprotein translocase, SecG subunit [Brucella sp. BO2]
 gi|306288055|gb|EFM59455.1| preprotein translocase, SecG subunit [Brucella sp. BO2]
          Length = 148

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 65/124 (52%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R    +         G  S+P   S +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPATT---------GSQSAPAGGSTNGGGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|306844001|ref|ZP_07476596.1| preprotein translocase, SecG subunit [Brucella sp. BO1]
 gi|306275756|gb|EFM57480.1| preprotein translocase, SecG subunit [Brucella sp. BO1]
          Length = 150

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 45/124 (36%), Positives = 66/124 (53%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD--SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+      G  S F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R    +         G  S+P   S +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPATT---------GSQSAPAGGSTNGGGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|88860508|ref|ZP_01135146.1| protein-export membrane protein secG (General Secretory Pathway)
           [Pseudoalteromonas tunicata D2]
 gi|88817706|gb|EAR27523.1| protein-export membrane protein secG (General Secretory Pathway)
           [Pseudoalteromonas tunicata D2]
          Length = 118

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/110 (22%), Positives = 43/110 (39%), Gaps = 6/110 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L++V+LIV + L+ ++LIQ    +  GSS      +         + + + T  LA
Sbjct: 1   MYEILLIVYLIVALALIGMVLIQQGKGADMGSSFGAGASATVFGSSGAGNFMTKTTTTLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  SI LG ++     +  +    S   S +            P  +
Sbjct: 61  AVFFVLSIVLGNLTAGQIKKTDEWTDLSTAPSAEVVEKIIPAAEDVPVSE 110


>gi|212634071|ref|YP_002310596.1| preprotein translocase subunit SecG [Shewanella piezotolerans WP3]
 gi|212555555|gb|ACJ28009.1| Preprotein translocase, SecG subunit [Shewanella piezotolerans WP3]
          Length = 111

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   LMVV+L+V +GLV +ILIQ    +  G+S              + + L R TAILA
Sbjct: 1   MYEVLMVVYLLVAIGLVGMILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FFA S+ +G +S   +             +   +      + S  K+  
Sbjct: 61  IAFFALSLTIGNLSANHTQSEDAWNDLGSDAAQAVEQVQQGAEKSEDKIPD 111


>gi|315127236|ref|YP_004069239.1| preprotein translocase subunit SecG [Pseudoalteromonas sp. SM9913]
 gi|315015750|gb|ADT69088.1| preprotein translocase subunit SecG [Pseudoalteromonas sp. SM9913]
          Length = 117

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 45/119 (37%), Gaps = 9/119 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV+LIV + LV ++LIQ    +  GSS      S         + + + T +LA
Sbjct: 1   MYEILLVVYLIVALALVGMVLIQQGKGADMGSSFGAGASSTVFGSSGAGNFMTKTTTVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             FF  SI LG ++     +         +++          +   P   +    S   
Sbjct: 61  TIFFVLSIVLGNLTAGQIKKTD---EWENLEAAPAVETVTPVEEDVPVTSTKEQSSDVP 116


>gi|294852477|ref|ZP_06793150.1| preprotein translocase [Brucella sp. NVSL 07-0026]
 gi|294821066|gb|EFG38065.1| preprotein translocase [Brucella sp. NVSL 07-0026]
          Length = 148

 Score = 74.3 bits (181), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 65/124 (52%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R    +         G  S+P   S +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPATT---------GSQSAPAGGSTNGGGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|62290050|ref|YP_221843.1| preprotein translocase subunit SecG [Brucella abortus bv. 1 str.
           9-941]
 gi|82699977|ref|YP_414551.1| preprotein translocase subunit SecG [Brucella melitensis biovar
           Abortus 2308]
 gi|148559914|ref|YP_001259058.1| preprotein translocase subunit SecG [Brucella ovis ATCC 25840]
 gi|161511144|ref|NP_539764.2| preprotein translocase subunit SecG [Brucella melitensis bv. 1 str.
           16M]
 gi|163843402|ref|YP_001627806.1| preprotein translocase subunit SecG [Brucella suis ATCC 23445]
 gi|189024290|ref|YP_001935058.1| Preprotein translocase SecG subunit [Brucella abortus S19]
 gi|225627606|ref|ZP_03785643.1| preprotein translocase, SecG subunit [Brucella ceti str. Cudo]
 gi|225852636|ref|YP_002732869.1| preprotein translocase subunit SecG [Brucella melitensis ATCC
           23457]
 gi|237815559|ref|ZP_04594556.1| preprotein translocase, SecG subunit [Brucella abortus str. 2308 A]
 gi|254689362|ref|ZP_05152616.1| preprotein translocase subunit SecG [Brucella abortus bv. 6 str.
           870]
 gi|254693846|ref|ZP_05155674.1| preprotein translocase subunit SecG [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697495|ref|ZP_05159323.1| preprotein translocase subunit SecG [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254704425|ref|ZP_05166253.1| preprotein translocase subunit SecG [Brucella suis bv. 3 str. 686]
 gi|254710213|ref|ZP_05172024.1| preprotein translocase subunit SecG [Brucella pinnipedialis B2/94]
 gi|254714210|ref|ZP_05176021.1| preprotein translocase subunit SecG [Brucella ceti M644/93/1]
 gi|254717646|ref|ZP_05179457.1| preprotein translocase subunit SecG [Brucella ceti M13/05/1]
 gi|254730392|ref|ZP_05188970.1| preprotein translocase subunit SecG [Brucella abortus bv. 4 str.
           292]
 gi|256031707|ref|ZP_05445321.1| preprotein translocase subunit SecG [Brucella pinnipedialis
           M292/94/1]
 gi|256044793|ref|ZP_05447697.1| preprotein translocase subunit SecG [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256061220|ref|ZP_05451371.1| preprotein translocase subunit SecG [Brucella neotomae 5K33]
 gi|256113699|ref|ZP_05454503.1| preprotein translocase subunit SecG [Brucella melitensis bv. 3 str.
           Ether]
 gi|256159866|ref|ZP_05457595.1| preprotein translocase subunit SecG [Brucella ceti M490/95/1]
 gi|256255108|ref|ZP_05460644.1| preprotein translocase subunit SecG [Brucella ceti B1/94]
 gi|256257608|ref|ZP_05463144.1| preprotein translocase subunit SecG [Brucella abortus bv. 9 str.
           C68]
 gi|256263871|ref|ZP_05466403.1| preprotein translocase SecG subunit [Brucella melitensis bv. 2 str.
           63/9]
 gi|256369563|ref|YP_003107073.1| protein-export membrane protein [Brucella microti CCM 4915]
 gi|260168839|ref|ZP_05755650.1| preprotein translocase subunit SecG [Brucella sp. F5/99]
 gi|260546602|ref|ZP_05822341.1| preprotein translocase SecG subunit [Brucella abortus NCTC 8038]
 gi|260565604|ref|ZP_05836088.1| preprotein translocase SecG subunit [Brucella melitensis bv. 1 str.
           16M]
 gi|260566328|ref|ZP_05836798.1| preprotein translocase SecG subunit [Brucella suis bv. 4 str. 40]
 gi|260754879|ref|ZP_05867227.1| preprotein translocase subunit SecG [Brucella abortus bv. 6 str.
           870]
 gi|260758096|ref|ZP_05870444.1| preprotein translocase subunit SecG [Brucella abortus bv. 4 str.
           292]
 gi|260761920|ref|ZP_05874263.1| preprotein translocase subunit SecG [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883891|ref|ZP_05895505.1| preprotein translocase subunit SecG [Brucella abortus bv. 9 str.
           C68]
 gi|261214131|ref|ZP_05928412.1| preprotein translocase subunit SecG [Brucella abortus bv. 3 str.
           Tulya]
 gi|261219485|ref|ZP_05933766.1| preprotein translocase subunit SecG [Brucella ceti M13/05/1]
 gi|261222303|ref|ZP_05936584.1| preprotein translocase subunit SecG [Brucella ceti B1/94]
 gi|261317771|ref|ZP_05956968.1| preprotein translocase subunit SecG [Brucella pinnipedialis B2/94]
 gi|261321980|ref|ZP_05961177.1| preprotein translocase subunit SecG [Brucella ceti M644/93/1]
 gi|261325227|ref|ZP_05964424.1| preprotein translocase subunit SecG [Brucella neotomae 5K33]
 gi|261755102|ref|ZP_05998811.1| preprotein translocase subunit SecG [Brucella suis bv. 3 str. 686]
 gi|261758327|ref|ZP_06002036.1| preprotein translocase SecG subunit [Brucella sp. F5/99]
 gi|265988802|ref|ZP_06101359.1| preprotein translocase subunit SecG [Brucella pinnipedialis
           M292/94/1]
 gi|265991217|ref|ZP_06103774.1| preprotein translocase subunit SecG [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995053|ref|ZP_06107610.1| preprotein translocase subunit SecG [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998267|ref|ZP_06110824.1| preprotein translocase subunit SecG [Brucella ceti M490/95/1]
 gi|297248450|ref|ZP_06932168.1| protein-export membrane protein [Brucella abortus bv. 5 str. B3196]
 gi|62196182|gb|AAX74482.1| preprotein translocase, SecG subunit, hypothetical [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616078|emb|CAJ11116.1| Preprotein translocase SecG subunit [Brucella melitensis biovar
           Abortus 2308]
 gi|148371171|gb|ABQ61150.1| protein-export membrane protein [Brucella ovis ATCC 25840]
 gi|163674125|gb|ABY38236.1| preprotein translocase, SecG subunit [Brucella suis ATCC 23445]
 gi|189019862|gb|ACD72584.1| Preprotein translocase SecG subunit [Brucella abortus S19]
 gi|225617611|gb|EEH14656.1| preprotein translocase, SecG subunit [Brucella ceti str. Cudo]
 gi|225641001|gb|ACO00915.1| preprotein translocase, SecG subunit [Brucella melitensis ATCC
           23457]
 gi|237788857|gb|EEP63068.1| preprotein translocase, SecG subunit [Brucella abortus str. 2308 A]
 gi|255999725|gb|ACU48124.1| protein-export membrane protein [Brucella microti CCM 4915]
 gi|260095652|gb|EEW79529.1| preprotein translocase SecG subunit [Brucella abortus NCTC 8038]
 gi|260151672|gb|EEW86766.1| preprotein translocase SecG subunit [Brucella melitensis bv. 1 str.
           16M]
 gi|260155846|gb|EEW90926.1| preprotein translocase SecG subunit [Brucella suis bv. 4 str. 40]
 gi|260668414|gb|EEX55354.1| preprotein translocase subunit SecG [Brucella abortus bv. 4 str.
           292]
 gi|260672352|gb|EEX59173.1| preprotein translocase subunit SecG [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674987|gb|EEX61808.1| preprotein translocase subunit SecG [Brucella abortus bv. 6 str.
           870]
 gi|260873419|gb|EEX80488.1| preprotein translocase subunit SecG [Brucella abortus bv. 9 str.
           C68]
 gi|260915738|gb|EEX82599.1| preprotein translocase subunit SecG [Brucella abortus bv. 3 str.
           Tulya]
 gi|260920887|gb|EEX87540.1| preprotein translocase subunit SecG [Brucella ceti B1/94]
 gi|260924574|gb|EEX91142.1| preprotein translocase subunit SecG [Brucella ceti M13/05/1]
 gi|261294670|gb|EEX98166.1| preprotein translocase subunit SecG [Brucella ceti M644/93/1]
 gi|261296994|gb|EEY00491.1| preprotein translocase subunit SecG [Brucella pinnipedialis B2/94]
 gi|261301207|gb|EEY04704.1| preprotein translocase subunit SecG [Brucella neotomae 5K33]
 gi|261738311|gb|EEY26307.1| preprotein translocase SecG subunit [Brucella sp. F5/99]
 gi|261744855|gb|EEY32781.1| preprotein translocase subunit SecG [Brucella suis bv. 3 str. 686]
 gi|262552735|gb|EEZ08725.1| preprotein translocase subunit SecG [Brucella ceti M490/95/1]
 gi|262766166|gb|EEZ11955.1| preprotein translocase subunit SecG [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002001|gb|EEZ14576.1| preprotein translocase subunit SecG [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094002|gb|EEZ17936.1| preprotein translocase SecG subunit [Brucella melitensis bv. 2 str.
           63/9]
 gi|264660999|gb|EEZ31260.1| preprotein translocase subunit SecG [Brucella pinnipedialis
           M292/94/1]
 gi|297175619|gb|EFH34966.1| protein-export membrane protein [Brucella abortus bv. 5 str. B3196]
 gi|326409155|gb|ADZ66220.1| Preprotein translocase SecG subunit [Brucella melitensis M28]
 gi|326538865|gb|ADZ87080.1| preprotein translocase, SecG subunit [Brucella melitensis M5-90]
          Length = 148

 Score = 74.3 bits (181), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 65/124 (52%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R    +         G  S+P   S +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPATT---------GSQSAPAGGSTNGGGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|270158115|ref|ZP_06186772.1| preprotein translocase SecG subunit [Legionella longbeachae D-4968]
 gi|289163620|ref|YP_003453758.1| Protein-export membrane protein secG (Preprotein translocase
           subunit) [Legionella longbeachae NSW150]
 gi|269990140|gb|EEZ96394.1| preprotein translocase SecG subunit [Legionella longbeachae D-4968]
 gi|288856793|emb|CBJ10604.1| Protein-export membrane protein secG (Preprotein translocase
           subunit) [Legionella longbeachae NSW150]
          Length = 109

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 40/100 (40%), Gaps = 6/100 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M   ++++H+IV V L+ ++LIQ    +        G+S+     + T   L + T  LA
Sbjct: 1   MYQLILMIHVIVAVVLIGLVLIQHGKGADVGAAFGSGASNTLFGSQGTGGFLFKLTGGLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN 94
             FF TS+ L  +      + +  +         +     
Sbjct: 61  LTFFVTSLLLSYLVSIQYQKTEQQVIPQQTSVPVNSIPVP 100


>gi|28198170|ref|NP_778484.1| preprotein translocase subunit SecG [Xylella fastidiosa Temecula1]
 gi|182680804|ref|YP_001828964.1| preprotein translocase subunit SecG [Xylella fastidiosa M23]
 gi|28056240|gb|AAO28133.1| protein-export membrane protein SecG [Xylella fastidiosa Temecula1]
 gi|182630914|gb|ACB91690.1| preprotein translocase, SecG subunit [Xylella fastidiosa M23]
 gi|307579272|gb|ADN63241.1| preprotein translocase subunit SecG [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 132

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 48/128 (37%), Gaps = 6/128 (4%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L V++++V + ++ +IL+Q    +A GS             R  ++ L + T  LA  F
Sbjct: 3   LLNVIYVLVAIAMIVLILMQRGTGAAAGSGFGAGASGTVFGSRGASNFLSKSTKWLAVVF 62

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           F  S+ +   +                         +       ++ +V   +++ V   
Sbjct: 63  FGISLFMAWYASRGHHSVAQQNSLMTEVPAAPAAGADQAASPVLQVPAVPTSTNTPVGDK 122

Query: 118 KRSSSRTK 125
           +++S  ++
Sbjct: 123 EKASDHSQ 130


>gi|229592639|ref|YP_002874758.1| preprotein translocase subunit SecG [Pseudomonas fluorescens SBW25]
 gi|229364505|emb|CAY52355.1| general secretory pathway, protein-export membrane protein
           [Pseudomonas fluorescens SBW25]
          Length = 127

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 47/125 (37%), Gaps = 11/125 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +  G+S            + ++  L +FTAILA
Sbjct: 2   LETVVVVFHLLAALGVVALVLLQQGKGADAGASFGAGASNTVFGSQGSSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSL-----VDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF TS+ LG  ++  +         +        +     +            +    
Sbjct: 62  AGFFITSLGLGYFAKEKAHVLTQVGLPNPAVLEVPKAKPASDDVPVLQEQKSATPATDVP 121

Query: 110 SSSSV 114
            +   
Sbjct: 122 PAQEQ 126


>gi|23502015|ref|NP_698142.1| preprotein translocase subunit SecG [Brucella suis 1330]
 gi|23347967|gb|AAN30057.1| preprotein translocase, SecG subunit, putative [Brucella suis 1330]
          Length = 148

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 43/124 (34%), Positives = 64/124 (51%), Gaps = 12/124 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R   ++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGATNALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ LG+++RY   R  D ++R    +         G  S+P   S +       + G+
Sbjct: 61  ATSLLLGIMARY-GERPTDILNRIPATT---------GSQSAPAGGSTNGGGILDQLGGE 110

Query: 119 RSSS 122
            S S
Sbjct: 111 PSGS 114


>gi|317493623|ref|ZP_07952044.1| preprotein translocase SecG subunit protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316918566|gb|EFV39904.1| preprotein translocase SecG subunit protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 111

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 23/110 (20%), Positives = 45/110 (40%), Gaps = 6/110 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V +GLV ++++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVIFLLVSIGLVAMVMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRTTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG +S     +  +  +       +           S  + 
Sbjct: 61  TLFFVLSLVLGNLSGQQGKKGSEWENLGTPVKTEQPAAPAAPAAPSSDIP 110


>gi|312885111|ref|ZP_07744796.1| preprotein translocase subunit SecG [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367211|gb|EFP94778.1| preprotein translocase subunit SecG [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 111

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 25/111 (22%), Positives = 49/111 (44%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  VG++ ++LIQ    +  G+S              + + L R TA+ A
Sbjct: 1   MFNVLLVIYLLAAVGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAVFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ALG +S + S     ++ +           ++    +S ++  
Sbjct: 61  TVFFVISLALGNMSTHKSDAQGVDVSQGQFIEKTKNNGESSQSSNSDEIPQ 111


>gi|94987573|ref|YP_595506.1| preprotein translocase subunit SecG [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731822|emb|CAJ55185.1| Preprotein translocase subunit SecG [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 112

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 42/104 (40%), Gaps = 4/104 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   ++ +HLIV + LV ++L+QS          G +++          L + TA LA  
Sbjct: 1   MNTLILSLHLIVCILLVIIVLLQSGKEGMGVIFGGGNTSVFGSSGAGGLLTKLTAFLAII 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
           F  TS++  +I+   S      +   + +S          +  S
Sbjct: 61  FIITSLSYNIITNTNSANQSTILDVQIENSSNTTQAHPQSNQES 104


>gi|300718580|ref|YP_003743383.1| Protein-export membrane protein SecG (Preprotein translocase band 1
           subunit) [Erwinia billingiae Eb661]
 gi|299064416|emb|CAX61536.1| Protein-export membrane protein SecG (Preprotein translocase band 1
           subunit) [Erwinia billingiae Eb661]
          Length = 110

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 45/106 (42%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GLV +I++Q    +  G       S+       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGGSATLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG ++   + +  +  + +     +           S
Sbjct: 61  TLFFIISLILGNLNSNKTQKGSEWENLTQPAQSQQSQPAKPATPGS 106


>gi|91792364|ref|YP_562015.1| preprotein translocase subunit SecG [Shewanella denitrificans
           OS217]
 gi|91714366|gb|ABE54292.1| protein translocase subunit secG [Shewanella denitrificans OS217]
          Length = 110

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 48/111 (43%), Gaps = 7/111 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   LMVV+L+V +GLV +ILIQ    +  G+S              + + L R TA+LA
Sbjct: 1   MYEVLMVVYLMVSIGLVGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRSTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FFA S+ +G +S     +  D  +     + +        + +   +  
Sbjct: 61  IGFFALSLIIGNLSANHVKQ-GDAWNEINSAAEQVVEQAPVTEETGTNIPD 110


>gi|284006665|emb|CBA71927.1| protein-export membrane protein [Arsenophonus nasoniae]
          Length = 112

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 47/115 (40%), Gaps = 10/115 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M I L+V+ L+V + L+ ++++Q    +  G+S      +       + + + R TAI A
Sbjct: 1   MYITLLVIFLLVSIALIGMVMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF  S+ LG ++   S                ++     G  ++P + +    
Sbjct: 61  TLFFIISLILGNLTSNKSV-TGSKWENIGEPVKVEK---PAGVPTAPAVPTSDIP 111


>gi|71897765|ref|ZP_00679991.1| Preprotein translocase SecG subunit [Xylella fastidiosa Ann-1]
 gi|71732320|gb|EAO34374.1| Preprotein translocase SecG subunit [Xylella fastidiosa Ann-1]
          Length = 132

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 48/128 (37%), Gaps = 6/128 (4%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L V++++V + ++ +IL+Q    +A GS             R  ++ L + T  LA  F
Sbjct: 3   LLNVIYVLVAIAMIVLILLQRGTGAAAGSGFGAGASGTVFGSRGASNFLSKSTKWLAVVF 62

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           F  S+ +   +                         +       ++ +V   +++ V   
Sbjct: 63  FGISLFMAWYASRGHHSVAQQNSLMTEVPAAPAAGADQAASPVLQVPAVPTSTNTPVGDK 122

Query: 118 KRSSSRTK 125
           +++S  ++
Sbjct: 123 EKASDHSQ 130


>gi|226329686|ref|ZP_03805204.1| hypothetical protein PROPEN_03598 [Proteus penneri ATCC 35198]
 gi|225202872|gb|EEG85226.1| hypothetical protein PROPEN_03598 [Proteus penneri ATCC 35198]
          Length = 133

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 46/114 (40%), Gaps = 6/114 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ +IV  GLV +IL+Q    +  G+S              +A+ + R TA+LA
Sbjct: 20  MYTALIVILIIVATGLVGLILLQQGKGADMGASFGAGASGTVFGSSGSANFMTRMTAVLA 79

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             F   ++ LG +S   + R           + + +  +      +P    +  
Sbjct: 80  TAFIVLALILGNLSANKTVREDSKWMSIEQTTEEAKKAEQLAAPVAPANTDIPQ 133


>gi|229512902|ref|ZP_04402369.1| preprotein translocase subunit SecG [Vibrio cholerae TMA 21]
 gi|229350151|gb|EEO15104.1| preprotein translocase subunit SecG [Vibrio cholerae TMA 21]
          Length = 114

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 45/114 (39%), Gaps = 9/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 4   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S +     +          +  Q  D   +  +   D +  
Sbjct: 64  TVFFVISLVLGNMSTHK---TESQWVDPSQGQVIQQTGDTVSEAPAKSSDEIPQ 114


>gi|39935952|ref|NP_948228.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
           CGA009]
 gi|39649806|emb|CAE28328.1| possible secG: preprotein translocase [Rhodopseudomonas palustris
           CGA009]
          Length = 134

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 2/108 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  ++V+HL+ V+GL+ V+L+Q S+    G      F S R TA+ L R TAILA  FF
Sbjct: 1   MQTVIIVIHLMFVLGLIGVVLLQKSEGGGLGVGGGGGFMSSRGTANLLTRTTAILAAGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSV 106
           ATS+ L  ++ Y           + V                  LD++
Sbjct: 61  ATSLLLTWLASYDRKPATILPTAAPVQQQVPGQPAPPLSQGGGLLDTL 108


>gi|15803715|ref|NP_289749.1| preprotein translocase subunit SecG [Escherichia coli O157:H7
           EDL933]
 gi|25306329|pir||A85981 protein export membrane protein [imported] - Escherichia coli
           (strain O157:H7, substrain EDL933)
 gi|12517787|gb|AAG58309.1|AE005546_3 protein export - membrane protein [Escherichia coli O157:H7 str.
           EDL933]
          Length = 110

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 46/106 (43%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV LIV +GL  +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVVFLIVAIGLXGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   + +  +  + S     +          +S
Sbjct: 61  TLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTS 106


>gi|299136769|ref|ZP_07029952.1| preprotein translocase, SecG subunit [Acidobacterium sp. MP5ACTX8]
 gi|298601284|gb|EFI57439.1| preprotein translocase, SecG subunit [Acidobacterium sp. MP5ACTX8]
          Length = 124

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 37/96 (38%), Gaps = 7/96 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M I L+++H++V + L+ V+L+Q   S+          S      R  A+ L R T   A
Sbjct: 28  MIILLVILHVVVCLFLIGVVLVQQGKSADLAGAFGGQGSQTAFGPRGAANLLTRLTTWSA 87

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
             F  TSI L ++    +         +        
Sbjct: 88  IIFMLTSIGLTVMMS-RNAGGHSVFSGTPSSQTTPA 122


>gi|71275691|ref|ZP_00651976.1| Preprotein translocase SecG subunit [Xylella fastidiosa Dixon]
 gi|71897853|ref|ZP_00680079.1| Preprotein translocase SecG subunit [Xylella fastidiosa Ann-1]
 gi|170729488|ref|YP_001774921.1| preprotein translocase subunit SecG [Xylella fastidiosa M12]
 gi|71163582|gb|EAO13299.1| Preprotein translocase SecG subunit [Xylella fastidiosa Dixon]
 gi|71732408|gb|EAO34462.1| Preprotein translocase SecG subunit [Xylella fastidiosa Ann-1]
 gi|167964281|gb|ACA11291.1| protein-export membrane protein SecG [Xylella fastidiosa M12]
          Length = 132

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 48/128 (37%), Gaps = 6/128 (4%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L V++++V + ++ +IL+Q    +A GS             R  ++ L + T  LA  F
Sbjct: 3   LLNVIYVLVAIAMIVLILMQRGTGAAAGSGFGAGASGTVFGARGASNFLSKSTKWLAVVF 62

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           F  S+ +   +                         +       ++ +V   +++ V   
Sbjct: 63  FGISLFMAWYASRGHHSVAQQNSLMTEVPAAPAAGADQAVSPVLQVPAVPTSTNTPVGDK 122

Query: 118 KRSSSRTK 125
           +++S  ++
Sbjct: 123 EKASDHSQ 130


>gi|27379917|ref|NP_771446.1| preprotein translocase subunit SecG [Bradyrhizobium japonicum USDA
           110]
 gi|27353070|dbj|BAC50071.1| protein-export membrane protein [Bradyrhizobium japonicum USDA 110]
          Length = 129

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 53/125 (42%), Gaps = 3/125 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  ++V+HL++V  ++  +L+Q S+    G      F S R TA+ L R TAILA  FF
Sbjct: 1   MQTVVIVIHLMIVAVMIGAVLLQKSEGGGLGMGGGAGFMSSRGTANLLSRTTAILAAGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
            TS+ L   + Y +      + +         G+      S   LDS+            
Sbjct: 61  VTSLFLSWYAGY-NRAPSSIIGQPASQGQPAGGSPIAPPTSGGILDSLKKADEQQQAPAA 119

Query: 119 RSSSR 123
            S  +
Sbjct: 120 PSGPQ 124


>gi|269137760|ref|YP_003294460.1| preprotein translocase subunit SecG [Edwardsiella tarda EIB202]
 gi|267983420|gb|ACY83249.1| preprotein translocase subunit SecG [Edwardsiella tarda EIB202]
 gi|304557817|gb|ADM40481.1| Preprotein translocase subunit SecG [Edwardsiella tarda FL6-60]
          Length = 111

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 25/110 (22%), Positives = 45/110 (40%), Gaps = 6/110 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V V L+ +I++Q    +  G+S      +       T + + R T ILA
Sbjct: 1   MYEALLVIFLLVSVALIALIMLQQGKGADMGASFGAGASATLFGSSGTGNFMTRTTGILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG +S + S +  +  +       +           S  + 
Sbjct: 61  TLFFVLSLVLGNLSGHQSKQGSEWDNLGQPVKTEQPATPAAPATPSSDIP 110


>gi|262189771|ref|ZP_06048122.1| preprotein translocase subunit SecG [Vibrio cholerae CT 5369-93]
 gi|262034348|gb|EEY52737.1| preprotein translocase subunit SecG [Vibrio cholerae CT 5369-93]
          Length = 111

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 45/114 (39%), Gaps = 9/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S +     +          +  Q  D   +  +   D +  
Sbjct: 61  TVFFVISLVLGNMSTHK---TESQWLDPSQGQVIQQTGDTVSEAPAKSSDEIPQ 111


>gi|229505738|ref|ZP_04395248.1| preprotein translocase subunit SecG [Vibrio cholerae BX 330286]
 gi|229509229|ref|ZP_04398714.1| preprotein translocase subunit SecG [Vibrio cholerae B33]
 gi|229519562|ref|ZP_04409005.1| preprotein translocase subunit SecG [Vibrio cholerae RC9]
 gi|229520931|ref|ZP_04410353.1| preprotein translocase subunit SecG [Vibrio cholerae TM 11079-80]
 gi|229530445|ref|ZP_04419833.1| preprotein translocase subunit SecG [Vibrio cholerae 12129(1)]
 gi|229608849|ref|YP_002879497.1| preprotein translocase subunit SecG [Vibrio cholerae MJ-1236]
 gi|229332218|gb|EEN97706.1| preprotein translocase subunit SecG [Vibrio cholerae 12129(1)]
 gi|229342164|gb|EEO07160.1| preprotein translocase subunit SecG [Vibrio cholerae TM 11079-80]
 gi|229344251|gb|EEO09226.1| preprotein translocase subunit SecG [Vibrio cholerae RC9]
 gi|229353801|gb|EEO18737.1| preprotein translocase subunit SecG [Vibrio cholerae B33]
 gi|229357961|gb|EEO22878.1| preprotein translocase subunit SecG [Vibrio cholerae BX 330286]
 gi|229371504|gb|ACQ61927.1| preprotein translocase subunit SecG [Vibrio cholerae MJ-1236]
          Length = 114

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 46/114 (40%), Gaps = 9/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 4   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S +     +          +  Q  D+  +  +   D +  
Sbjct: 64  TVFFVISLVLGNMSTHK---TESQWVDPSQGQVIQQAGDSVSEAPAKSSDEIPQ 114


>gi|77457003|ref|YP_346508.1| preprotein translocase subunit SecG [Pseudomonas fluorescens Pf0-1]
 gi|77381006|gb|ABA72519.1| general secretory pathway, protein-export membrane protein
           [Pseudomonas fluorescens Pf0-1]
          Length = 127

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 47/125 (37%), Gaps = 11/125 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  +G+V ++L+Q    +  G+S            + ++  L +FTAILA
Sbjct: 2   LETVVVVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGSQGSSTFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSL-----VDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF TS+ LG  ++  + +       +              +            +    
Sbjct: 62  AGFFITSLGLGYFAKEKAHQLTQAGLPNPAVLEVPKQQPASDDVPVLQEQKSATPATDVP 121

Query: 110 SSSSV 114
            +   
Sbjct: 122 PAQEQ 126


>gi|317486890|ref|ZP_07945701.1| preprotein translocase [Bilophila wadsworthia 3_1_6]
 gi|316921880|gb|EFV43155.1| preprotein translocase [Bilophila wadsworthia 3_1_6]
          Length = 119

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 37/84 (44%), Gaps = 4/84 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFF 56
          MQ  ++ +H+IV V LV ++L+Q+          G +++          L + TA +A  
Sbjct: 1  MQTLILSLHVIVCVTLVILVLLQAGKEGMGVIFGGGNASVFGSSGAGGLLAKMTAFMAVL 60

Query: 57 FFATSIALGMISRYTSTRYKDNMH 80
          F  TS++   +S     +    + 
Sbjct: 61 FIVTSLSYNYVSSSHKAQESTILD 84


>gi|192291604|ref|YP_001992209.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
           TIE-1]
 gi|192285353|gb|ACF01734.1| preprotein translocase, SecG subunit [Rhodopseudomonas palustris
           TIE-1]
          Length = 134

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 2/108 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  ++V+HL+ V+GL+ V+L+Q S+    G      F S R TA+ L R TAILA  FF
Sbjct: 1   MQTVIIVIHLMFVLGLIGVVLLQKSEGGGLGVGGGGGFMSSRGTANLLTRTTAILAAGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSV 106
           ATS+ L  ++ Y           + V                  LD++
Sbjct: 61  ATSLLLTWLASYDRKPATILPTAAPVQQQAPGQPAPPLSQGGGLLDTL 108


>gi|209549427|ref|YP_002281344.1| preprotein translocase subunit SecG [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535183|gb|ACI55118.1| preprotein translocase, SecG subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 179

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 42/118 (35%), Positives = 60/118 (50%), Gaps = 3/118 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
            TS+ LG+++RY   R  D + R      +  G  +   G +    S  A +      
Sbjct: 61  ITSLGLGILTRYEG-RPSDILDRIPATGGQGNGILDSLGGGAQAPASQPAGNGVPSSG 117


>gi|114321120|ref|YP_742803.1| preprotein translocase subunit SecG [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114227514|gb|ABI57313.1| protein translocase subunit secG [Alkalilimnicola ehrlichii MLHE-1]
          Length = 118

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 45/116 (38%), Gaps = 6/116 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
           M   L+ +H+I+ V LV ++L+Q    +  G+      SS     R     L R T  LA
Sbjct: 1   MFQILLAIHVIIAVVLVVLVLLQQGKGADMGAAFGSGASSTVFGSRGAGSFLTRVTTGLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FFATS+ L +++   +      + R            +    +    D +   +
Sbjct: 61  ITFFATSLVLAILAARGTDAPGSLLEREQEVEETVPPAADDEPEAPEVDDELPPPA 116


>gi|149192455|ref|ZP_01870648.1| protein-export membrane protein [Vibrio shilonii AK1]
 gi|148833706|gb|EDL50750.1| protein-export membrane protein [Vibrio shilonii AK1]
          Length = 111

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 45/114 (39%), Gaps = 9/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 1   MIQVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +  +                + +Q  D   D  +   D +  
Sbjct: 61  IVFFVISLVLGNMYTHKGE---SQWVDPSQGQVVEQQVDAASDVPAKSSDEIPQ 111


>gi|307546730|ref|YP_003899209.1| hypothetical protein HELO_4140 [Halomonas elongata DSM 2581]
 gi|307218754|emb|CBV44024.1| hypothetical protein predicted by Glimmer/Critica [Halomonas
           elongata DSM 2581]
          Length = 120

 Score = 73.5 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 46/113 (40%), Gaps = 6/113 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           MQ+ ++++H+ + + LV +IL+Q    +        G+S      R +   L R TA+LA
Sbjct: 1   MQVAILMIHVAIAIALVALILLQQGKGADAGASFGGGASQTVFGSRGSGSFLSRATAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             FFATS+ L   +       ++          +        D  +   ++  
Sbjct: 61  AAFFATSLTLAYFASQAGEAPEEVGIPDAEVVEQQSAEPTLDDKGNGADNAAP 113


>gi|254292206|ref|ZP_04962974.1| preprotein translocase, SecG subunit [Vibrio cholerae AM-19226]
 gi|150421887|gb|EDN13866.1| preprotein translocase, SecG subunit [Vibrio cholerae AM-19226]
          Length = 111

 Score = 73.5 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 46/114 (40%), Gaps = 9/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S +     +          +  Q  D+  +  +   D +  
Sbjct: 61  TVFFVISLVLGNMSTHK---TESQWVDPSQGQVIQQTGDSVSEAPAKSSDEIPQ 111


>gi|126208223|ref|YP_001053448.1| preprotein translocase subunit SecG [Actinobacillus
           pleuropneumoniae L20]
 gi|190150056|ref|YP_001968581.1| protein-export membrane protein [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303251465|ref|ZP_07337641.1| preprotein translocase subunit SecG [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303252338|ref|ZP_07338504.1| preprotein translocase subunit SecG [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307245603|ref|ZP_07527689.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307247723|ref|ZP_07529761.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307249956|ref|ZP_07531928.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307252299|ref|ZP_07534196.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307254559|ref|ZP_07536393.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307256766|ref|ZP_07538545.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307259013|ref|ZP_07540744.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307261209|ref|ZP_07542884.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307263388|ref|ZP_07545004.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|126097015|gb|ABN73843.1| protein-export membrane protein [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|189915187|gb|ACE61439.1| protein-export membrane protein [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302648797|gb|EFL78987.1| preprotein translocase subunit SecG [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302649697|gb|EFL79877.1| preprotein translocase subunit SecG [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306853305|gb|EFM85524.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306855753|gb|EFM87918.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306858016|gb|EFM90100.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306860221|gb|EFM92237.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306862496|gb|EFM94456.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306864814|gb|EFM96718.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306867037|gb|EFM98894.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306868940|gb|EFN00742.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306871266|gb|EFN02994.1| Preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 108

 Score = 73.5 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 46/108 (42%), Gaps = 6/108 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L +++L+V V L+  +L+Q    +  G+S              +A+ L R TA+LA
Sbjct: 1   MLNVLTIIYLVVAVALIGFVLMQQGKGADAGASFGAGASGTVFGSAGSANFLSRTTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF  S+ +G ++ + +         S V    +Q      +   P+
Sbjct: 61  IIFFGISLLIGNLNSHQTAPKSQFEDLSGVQQKVEQPKVENPNNDIPQ 108


>gi|15640660|ref|NP_230289.1| preprotein translocase subunit SecG [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|147675589|ref|YP_001216134.1| preprotein translocase subunit SecG [Vibrio cholerae O395]
 gi|153215849|ref|ZP_01950181.1| preprotein translocase, SecG subunit [Vibrio cholerae 1587]
 gi|153820383|ref|ZP_01973050.1| preprotein translocase, SecG subunit [Vibrio cholerae NCTC 8457]
 gi|227080821|ref|YP_002809372.1| preprotein translocase, SecG subunit [Vibrio cholerae M66-2]
 gi|254850874|ref|ZP_05240224.1| preprotein translocase subunit SecG [Vibrio cholerae MO10]
 gi|255744143|ref|ZP_05418096.1| preprotein translocase subunit SecG [Vibrio cholera CIRS 101]
 gi|262156119|ref|ZP_06029238.1| preprotein translocase subunit SecG [Vibrio cholerae INDRE 91/1]
 gi|262169939|ref|ZP_06037629.1| preprotein translocase subunit SecG [Vibrio cholerae RC27]
 gi|297580766|ref|ZP_06942692.1| preprotein translocase [Vibrio cholerae RC385]
 gi|298500756|ref|ZP_07010559.1| preprotein translocase subunit SecG [Vibrio cholerae MAK 757]
 gi|9655076|gb|AAF93806.1| preprotein translocase, SecG subunit [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|124114566|gb|EAY33386.1| preprotein translocase, SecG subunit [Vibrio cholerae 1587]
 gi|126509073|gb|EAZ71667.1| preprotein translocase, SecG subunit [Vibrio cholerae NCTC 8457]
 gi|146317472|gb|ABQ22011.1| preprotein translocase, SecG subunit [Vibrio cholerae O395]
 gi|227008709|gb|ACP04921.1| preprotein translocase, SecG subunit [Vibrio cholerae M66-2]
 gi|227012465|gb|ACP08675.1| preprotein translocase, SecG subunit [Vibrio cholerae O395]
 gi|254846579|gb|EET24993.1| preprotein translocase subunit SecG [Vibrio cholerae MO10]
 gi|255738083|gb|EET93475.1| preprotein translocase subunit SecG [Vibrio cholera CIRS 101]
 gi|262021673|gb|EEY40384.1| preprotein translocase subunit SecG [Vibrio cholerae RC27]
 gi|262030155|gb|EEY48800.1| preprotein translocase subunit SecG [Vibrio cholerae INDRE 91/1]
 gi|297535182|gb|EFH74017.1| preprotein translocase [Vibrio cholerae RC385]
 gi|297540537|gb|EFH76595.1| preprotein translocase subunit SecG [Vibrio cholerae MAK 757]
 gi|327483442|gb|AEA77849.1| Preprotein translocase subunit SecG [Vibrio cholerae LMA3894-4]
          Length = 111

 Score = 73.5 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 46/114 (40%), Gaps = 9/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF  S+ LG +S +     +          +  Q  D+  +  +   D +  
Sbjct: 61  TVFFVISLVLGNMSTHK---TESQWVDPSQGQVIQQAGDSVSEAPAKSSDEIPQ 111


>gi|221639795|ref|YP_002526057.1| preprotein translocase subunit SecG [Rhodobacter sphaeroides KD131]
 gi|221160576|gb|ACM01556.1| Preprotein translocase SecG subunit [Rhodobacter sphaeroides KD131]
          Length = 227

 Score = 73.5 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 50/123 (40%), Gaps = 2/123 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV-RSTAHSLGRFTAILAFFFFA 59
           MQ  +++VHLI+ + L+ V+L+Q S+    G         R  A+++ R T I A  F  
Sbjct: 1   MQNVVLIVHLILALLLIGVVLLQRSEGGGLGMGGGGAMTGRQAANAMTRMTWIFAIAFIG 60

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           TSIAL + +   S      + +      ++          +  L    A +  +      
Sbjct: 61  TSIALTIFAAQNSH-SSSVIDQFGGTVRQEAPATPEAPLGNDLLPPAPANAPLTPPRADE 119

Query: 120 SSS 122
            S+
Sbjct: 120 QSA 122


>gi|260433187|ref|ZP_05787158.1| preprotein translocase subunit SecG [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417015|gb|EEX10274.1| preprotein translocase subunit SecG [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 121

 Score = 73.5 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 50/121 (41%), Gaps = 3/121 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV---RSTAHSLGRFTAILAFFF 57
           M+  ++++HL++ +GL+ V+L+Q S+    G           RS A +LG+ T ILA  F
Sbjct: 1   MENVVLIIHLLLALGLIAVVLMQRSEGGGLGMGGGGGGAMAGRSAATALGKLTWILAACF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
             TSI L +++   S          +    + +        +   L      ++  +   
Sbjct: 61  IVTSITLTILAAQKSAGTSVIDRLGVPAPAETEETVPAVPSAEDLLPPAQGDNAPLIPKA 120

Query: 118 K 118
            
Sbjct: 121 D 121


>gi|218961463|ref|YP_001741238.1| protein-export membrane protein secG, essential membrane protein
           [Candidatus Cloacamonas acidaminovorans]
 gi|167730120|emb|CAO81032.1| protein-export membrane protein secG, essential membrane protein
           [Candidatus Cloacamonas acidaminovorans]
          Length = 136

 Score = 73.5 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 22/108 (20%), Positives = 42/108 (38%), Gaps = 5/108 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           +    +++H+I+ V LV VIL Q+S      +              +  L ++T ILA  
Sbjct: 27  LYTIALIIHVIICVALVLVILAQTSKGGLDSNLGGAAMNVFGGSGASKFLKKWTQILAVV 86

Query: 57  FFATSIALGMISRY-TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKL 103
           F A+ + L  + +   ++   D   R       +Q   +    + P  
Sbjct: 87  FAASCLFLAFLVKNINASALADIQSRQKKIKDTEQTAPSSKPATKPAT 134


>gi|254482491|ref|ZP_05095730.1| preprotein translocase SecG subunit, putative [marine gamma
           proteobacterium HTCC2148]
 gi|214037182|gb|EEB77850.1| preprotein translocase SecG subunit, putative [marine gamma
           proteobacterium HTCC2148]
          Length = 129

 Score = 73.5 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/124 (18%), Positives = 47/124 (37%), Gaps = 6/124 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M+  +++VHL+V + ++ +I++Q    +  G+S              + + L R T    
Sbjct: 1   MEQIILIVHLLVALAIIGLIMLQQGKGADMGASFGAGASQTLFGSDGSGNVLTRATGWFV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FFATS  L +I+  +S    D        +++ +                +  S +  
Sbjct: 61  TLFFATSFGLALIASQSSQPVNDLGIDIPGAAMQVREAVESELPVVEDDIPAAIGSGTVE 120

Query: 115 VAGK 118
             G 
Sbjct: 121 PEGD 124


>gi|170025948|ref|YP_001722453.1| preprotein translocase subunit SecG [Yersinia pseudotuberculosis
           YPIII]
 gi|169752482|gb|ACA70000.1| preprotein translocase, SecG subunit [Yersinia pseudotuberculosis
           YPIII]
          Length = 111

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 44/111 (39%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V  L++ +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVFFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG +S     +  +  +       +           S  +  
Sbjct: 61  TLFFVISLILGNMSSNQGQKSSEWENLGQPLKTEQTTTPVAPVKPSSDIPQ 111


>gi|22124599|ref|NP_668022.1| preprotein translocase subunit SecG [Yersinia pestis KIM 10]
 gi|45440438|ref|NP_991977.1| preprotein translocase subunit SecG [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51594829|ref|YP_069020.1| preprotein translocase subunit SecG [Yersinia pseudotuberculosis IP
           32953]
 gi|108806047|ref|YP_649963.1| preprotein translocase subunit SecG [Yersinia pestis Antiqua]
 gi|108813403|ref|YP_649170.1| preprotein translocase subunit SecG [Yersinia pestis Nepal516]
 gi|145600795|ref|YP_001164871.1| preprotein translocase subunit SecG [Yersinia pestis Pestoides F]
 gi|153948565|ref|YP_001402553.1| preprotein translocase subunit SecG [Yersinia pseudotuberculosis IP
           31758]
 gi|153997276|ref|ZP_02022376.1| protein-export membrane protein [Yersinia pestis CA88-4125]
 gi|162418621|ref|YP_001608283.1| preprotein translocase subunit SecG [Yersinia pestis Angola]
 gi|165937570|ref|ZP_02226133.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166214015|ref|ZP_02240050.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167401353|ref|ZP_02306853.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167420700|ref|ZP_02312453.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167423246|ref|ZP_02314999.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|186893838|ref|YP_001870950.1| preprotein translocase subunit SecG [Yersinia pseudotuberculosis
           PB1/+]
 gi|218930513|ref|YP_002348388.1| preprotein translocase subunit SecG [Yersinia pestis CO92]
 gi|229839151|ref|ZP_04459310.1| preprotein translocase membrane subunit [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229896640|ref|ZP_04511807.1| preprotein translocase membrane subunit [Yersinia pestis Pestoides
           A]
 gi|229899715|ref|ZP_04514856.1| preprotein translocase membrane subunit [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229903877|ref|ZP_04518990.1| preprotein translocase membrane subunit [Yersinia pestis Nepal516]
 gi|270489133|ref|ZP_06206207.1| preprotein translocase, SecG subunit [Yersinia pestis KIM D27]
 gi|21957402|gb|AAM84273.1|AE013670_10 protein export - membrane protein [Yersinia pestis KIM 10]
 gi|45435295|gb|AAS60854.1| protein-export membrane protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51588111|emb|CAH19717.1| protein-export membrane protein segG [Yersinia pseudotuberculosis
           IP 32953]
 gi|108777051|gb|ABG19570.1| protein translocase subunit secG [Yersinia pestis Nepal516]
 gi|108777960|gb|ABG12018.1| protein translocase subunit secG [Yersinia pestis Antiqua]
 gi|115349124|emb|CAL22087.1| protein-export membrane protein [Yersinia pestis CO92]
 gi|145212491|gb|ABP41898.1| protein translocase subunit secG [Yersinia pestis Pestoides F]
 gi|149288913|gb|EDM38993.1| protein-export membrane protein [Yersinia pestis CA88-4125]
 gi|152960060|gb|ABS47521.1| preprotein translocase, SecG subunit [Yersinia pseudotuberculosis
           IP 31758]
 gi|162351436|gb|ABX85384.1| preprotein translocase, SecG subunit [Yersinia pestis Angola]
 gi|165914675|gb|EDR33289.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166204810|gb|EDR49290.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166961506|gb|EDR57527.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167049378|gb|EDR60786.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167057416|gb|EDR67162.1| preprotein translocase, SecG subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|186696864|gb|ACC87493.1| preprotein translocase, SecG subunit [Yersinia pseudotuberculosis
           PB1/+]
 gi|229679647|gb|EEO75750.1| preprotein translocase membrane subunit [Yersinia pestis Nepal516]
 gi|229687207|gb|EEO79282.1| preprotein translocase membrane subunit [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229695517|gb|EEO85564.1| preprotein translocase membrane subunit [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229700418|gb|EEO88450.1| preprotein translocase membrane subunit [Yersinia pestis Pestoides
           A]
 gi|270337637|gb|EFA48414.1| preprotein translocase, SecG subunit [Yersinia pestis KIM D27]
 gi|320013702|gb|ADV97273.1| preprotein translocase membrane subunit [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 111

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 44/111 (39%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V  L++ +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVFFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG +S     +  +  +       +           S  +  
Sbjct: 61  TLFFVISLILGNMSSNQGQKSSEWENLGQPLKTEQTATPVAPVKPSSDIPQ 111


>gi|170727897|ref|YP_001761923.1| preprotein translocase subunit SecG [Shewanella woodyi ATCC 51908]
 gi|169813244|gb|ACA87828.1| preprotein translocase, SecG subunit [Shewanella woodyi ATCC 51908]
          Length = 113

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 46/105 (43%), Gaps = 6/105 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   LMVV+L+V +GLV +ILIQ    +  G+S      +         + L R TAILA
Sbjct: 1   MYEVLMVVYLLVAIGLVGLILIQQGKGADMGASFGAGASATLFGSSGAGNFLTRSTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
             FFA S+ +G +S   +         S   +   +   +  +  
Sbjct: 61  IGFFALSLIIGNLSANHAKGEDAWQDLSSGAAQVTEQVTDAVETQ 105


>gi|119944576|ref|YP_942256.1| preprotein translocase, SecG subunit [Psychromonas ingrahamii 37]
 gi|119863180|gb|ABM02657.1| protein translocase subunit secG [Psychromonas ingrahamii 37]
          Length = 107

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 6/82 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
          M   L+VV+LIV + L+  +LIQ    +  G      SS+         + + R TAILA
Sbjct: 1  MYEILLVVYLIVAIILIGFVLIQQGKGAGMGASFGSGSSNTVFGASGAGNFMTRTTAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYK 76
            FF  S+ LG +S    T  +
Sbjct: 61 IVFFGLSLVLGNLSTNKVTADQ 82


>gi|160871839|ref|ZP_02061971.1| preprotein translocase SecG subunit [Rickettsiella grylli]
 gi|159120638|gb|EDP45976.1| preprotein translocase SecG subunit [Rickettsiella grylli]
          Length = 116

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/117 (17%), Positives = 48/117 (41%), Gaps = 8/117 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           +Q FL+++H+I+ + L+ ++LIQ    +  G++            + ++  L + T + A
Sbjct: 2   LQQFLVLMHVIISLALIALVLIQQDKGAELGATFGSAASQTVFGSQGSSSFLLKLTGLFA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
             FF TS++LG ++ + + +  D +   +                          S 
Sbjct: 62  LLFFMTSLSLGYLAGHRAKQ--DPIQNLVNRGHASSFAQQSEPPRLEHEPPYPHPSD 116


>gi|116252258|ref|YP_768096.1| preprotein translocase subunit SecG [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115256906|emb|CAK08000.1| putative secG protein [Rhizobium leguminosarum bv. viciae 3841]
          Length = 173

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 54/108 (50%), Gaps = 2/108 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSV 106
            TS+ LG+++RY                  +   D+ G   +P     
Sbjct: 61  LTSLGLGILTRYEGRPSDILDRIPATGGQGNGILDSLGGAQAPATPPA 108


>gi|261820125|ref|YP_003258231.1| preprotein translocase subunit SecG [Pectobacterium wasabiae
           WPP163]
 gi|261604138|gb|ACX86624.1| preprotein translocase, SecG subunit [Pectobacterium wasabiae
           WPP163]
          Length = 110

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 42/108 (38%), Gaps = 8/108 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V +GLV +I++Q    +  G+S      +       + + + R TAILA
Sbjct: 1   MYEVLLVIFLLVSIGLVALIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF  S+ LG +S                    +Q        +   
Sbjct: 61  TLFFIISLILGNLSSLQKR--GGTWDNLSQPERVEQTTAPVAPSTPAS 106


>gi|296104886|ref|YP_003615032.1| preprotein translocase subunit SecG [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295059345|gb|ADF64083.1| preprotein translocase subunit SecG [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295097661|emb|CBK86751.1| protein translocase subunit secG [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 110

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ LIV + LV +I++Q    +  G+S              +A+ + R TAILA
Sbjct: 1   MYEALLVIFLIVAIALVALIMLQQGKGADMGASFGAGASGTLFGSSGSANFMTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG I+   +++  +  + S     +          +S
Sbjct: 61  TLFFIISLVLGNINSNKTSKGSEWENLSAPAKTEQTQPAAPAKPTS 106


>gi|323144912|ref|ZP_08079475.1| preprotein translocase, SecG subunit [Succinatimonas hippei YIT
           12066]
 gi|322415310|gb|EFY06081.1| preprotein translocase, SecG subunit [Succinatimonas hippei YIT
           12066]
          Length = 117

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 45/111 (40%), Gaps = 7/111 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   ++VV L+V V +V +IL+Q    +  G+S              + + L R T +LA
Sbjct: 1   MYEIVIVVFLLVAVAMVALILVQQGKGAGMGASFGAGASNTVFGAVGSGNFLTRSTWLLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FFA  + +G + +  S +          +S      +N      P +D 
Sbjct: 61  IVFFAICLFIGWLQKDHSVQNDS-FTNISSESEISTPVENKTPADVPTVDG 110


>gi|241204752|ref|YP_002975848.1| preprotein translocase subunit SecG [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858642|gb|ACS56309.1| preprotein translocase, SecG subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 177

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 41/118 (34%), Positives = 60/118 (50%), Gaps = 3/118 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
            TS+ LG+++RY   R  D + R      +  G  +   G +    +  A +      
Sbjct: 61  LTSLGLGILTRYEG-RPSDILDRIPATGGQGNGILDSLGGGAQAPATQPAGNGVPSSG 117


>gi|301155604|emb|CBW15072.1| preprotein translocase membrane subunit [Haemophilus
          parainfluenzae T3T1]
          Length = 115

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 6/88 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
          M   L+ V++++ + L+  ILIQ    +  G+S                + L R +AILA
Sbjct: 1  MYNILLFVYVLICIALIGFILIQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRS 82
            FF  ++ LG I+ +     K +    
Sbjct: 61 TGFFVIALVLGNINSHRGNVQKGSFDDL 88


>gi|325579173|ref|ZP_08149129.1| preprotein translocase subunit SecG [Haemophilus parainfluenzae
          ATCC 33392]
 gi|325159408|gb|EGC71542.1| preprotein translocase subunit SecG [Haemophilus parainfluenzae
          ATCC 33392]
          Length = 115

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 38/88 (43%), Gaps = 6/88 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYNILLFIYVLVCIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRS 82
            FF  ++ LG I+ +     K +    
Sbjct: 61 TGFFVIALVLGNINSHRGNVQKGSFDDL 88


>gi|195941094|ref|ZP_03086476.1| preprotein translocase subunit SecG [Escherichia coli O157:H7 str.
           EC4024]
          Length = 105

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 46/105 (43%), Gaps = 6/105 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ LIV + LV +I++Q    +  G+S              +A+ + R TAILA
Sbjct: 1   MYEALLVIFLIVAIALVALIMLQQGKGADMGASFGAGASGTLFGSSGSANFMTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
             FF  S+ LG I+   +++  +  + S     +          +
Sbjct: 61  TLFFIISLVLGNINSNKTSKGSEWENLSAPAKTEQTQPAAPAKPT 105


>gi|288942135|ref|YP_003444375.1| preprotein translocase subunit SecG [Allochromatium vinosum DSM
           180]
 gi|288897507|gb|ADC63343.1| preprotein translocase, SecG subunit [Allochromatium vinosum DSM
           180]
          Length = 152

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 50/121 (41%), Gaps = 9/121 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           MQ  L V+ + + +GL+ ++LIQ    +        G+S+     + +   L R TAILA
Sbjct: 1   MQTILTVLQVFLSLGLIGLVLIQHGKGADAGAAFGSGASATVFGAQGSGSFLTRLTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYK---DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
             FF TS+AL   +  TS             +V S+  +          P +   +  S 
Sbjct: 61  TLFFLTSMALAYYATQTSGPAGLMDKMGDAVVVPSVPAESIPRPASSDVPAIPGAAMPSE 120

Query: 112 S 112
           S
Sbjct: 121 S 121


>gi|170749511|ref|YP_001755771.1| preprotein translocase, SecG subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656033|gb|ACB25088.1| preprotein translocase, SecG subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 140

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 49/103 (47%), Gaps = 6/103 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           MQ  L+VVHLI+V+ L+ V+L+Q S+               F + R  A++L R TAILA
Sbjct: 1   MQTVLIVVHLIIVLALIGVVLLQRSEGGLGLGGGGGGGVGGFMTGRGQANALTRATAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGD 97
             FF TS+ L ++S  ++         +   S +        D
Sbjct: 61  ALFFTTSMVLAILSHRSAAPKSILDTGAPQTSGQPAKQPTGAD 103


>gi|148292186|dbj|BAF62901.1| putative protein-export protein [uncultured bacterium]
          Length = 110

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 41/108 (37%), Gaps = 5/108 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS-----AFGSSSNFTSVRSTAHSLGRFTAILAF 55
           +   L+ +HL V V ++ ++L+Q    S       GSS +    R +A  L R TA LA 
Sbjct: 2   LTNILLGLHLAVTVAVIILVLLQQGRGSDAGAVFGGSSQSVFGSRGSASFLSRLTAALAT 61

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKL 103
            FF  S+ L  +             R++     +          +P  
Sbjct: 62  LFFVNSLVLAWLYNRDQADLSVTAPRAVEAVTDEAAEPQSDVPDAPDS 109


>gi|15836907|ref|NP_297595.1| preprotein translocase subunit SecG [Xylella fastidiosa 9a5c]
 gi|9105125|gb|AAF83115.1|AE003883_10 protein-export membrane protein [Xylella fastidiosa 9a5c]
          Length = 132

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 48/128 (37%), Gaps = 6/128 (4%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L V++++V + ++ +IL+Q    +A GS             R  ++ L + T  LA  F
Sbjct: 3   LLNVIYVLVAIAMIVLILMQRGTGAAAGSGFGAGASGTVFGSRGASNFLSKSTKWLAVVF 62

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           F  S+ +   +                         +       ++ +V A +++     
Sbjct: 63  FGISLFMAWYASRGHHAVAQQNSLMTEVPAAPAAGADQAASPVLQVPAVPASTNTPAGDK 122

Query: 118 KRSSSRTK 125
           +++S  ++
Sbjct: 123 EKASDHSQ 130


>gi|146283633|ref|YP_001173786.1| preprotein translocase subunit SecG [Pseudomonas stutzeri A1501]
 gi|145571838|gb|ABP80944.1| preprotein translocase, SecG subunit [Pseudomonas stutzeri A1501]
          Length = 141

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 56/126 (44%), Gaps = 9/126 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           +Q  ++VVHL+V +G+V ++L+Q    +        G+S+     + +A  L RFTAILA
Sbjct: 16  LQTVVIVVHLLVALGVVALVLLQQGKGADAGASFGSGASATVFGSQGSATFLSRFTAILA 75

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS-VSAKSSSS 113
             FF TS+ L   ++  + +           ++ +           P L+    A ++  
Sbjct: 76  GVFFLTSLGLAFFAKQQADQLSQA--GLPDPAVLEVPASKPAVEDVPVLEQRKPADTAGD 133

Query: 114 VVAGKR 119
           +   + 
Sbjct: 134 LPEVEE 139


>gi|83942932|ref|ZP_00955392.1| preprotein translocase, SecG subunit [Sulfitobacter sp. EE-36]
 gi|83954106|ref|ZP_00962826.1| preprotein translocase, SecG subunit [Sulfitobacter sp. NAS-14.1]
 gi|83841143|gb|EAP80313.1| preprotein translocase, SecG subunit [Sulfitobacter sp. NAS-14.1]
 gi|83845940|gb|EAP83817.1| preprotein translocase, SecG subunit [Sulfitobacter sp. EE-36]
          Length = 122

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 54/122 (44%), Gaps = 4/122 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M+  +++VHLI+ +GL+ V+L+Q S+    G          S R+ A ++G+ T +LA  
Sbjct: 1   MENVVLIVHLILALGLIAVVLLQRSEGGGLGMGGGGGGGAVSGRAAATAMGKLTWVLAAA 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           F  TSI L +I+   S                +QG+      +   L    A+++  V  
Sbjct: 61  FIVTSITLTIIAAEKSAGSSVIDRLGGTPPALNQGDAPALPDADALLPPTPAENTPQVPT 120

Query: 117 GK 118
             
Sbjct: 121 AD 122


>gi|218710448|ref|YP_002418069.1| preprotein translocase subunit SecG [Vibrio splendidus LGP32]
 gi|218323467|emb|CAV19644.1| Preprotein translocase subunit SecG [Vibrio splendidus LGP32]
          Length = 124

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/106 (22%), Positives = 44/106 (41%), Gaps = 9/106 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 15  MFTVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFA 74

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG +S +     +          +  Q  D   +  +
Sbjct: 75  TTFFILSLVLGNMSTHK---TESQWIDPTQGQVIQQAEDAVSEVPA 117


>gi|218662639|ref|ZP_03518569.1| preprotein translocase subunit SecG [Rhizobium etli IE4771]
          Length = 176

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 60/116 (51%), Gaps = 8/116 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIK-----DQGNDNFGDGSSPKLDSVSAK 109
            TS+ LG+++RY   R  D + R    S +     D         + P  + V + 
Sbjct: 61  LTSLGLGILTRYEG-RPGDILDRIPATSGQGNGILDSLGGAQAPANQPAGNGVPSS 115


>gi|218462580|ref|ZP_03502671.1| preprotein translocase subunit SecG [Rhizobium etli Kim 5]
          Length = 171

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 60/116 (51%), Gaps = 8/116 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIK-----DQGNDNFGDGSSPKLDSVSAK 109
            TS+ LG+++RY   R  D + R    S +     D         + P  + V + 
Sbjct: 61  LTSLGLGILTRYEG-RPGDILDRIPATSGQGNGILDSLGGAQAPANQPAGNGVPSS 115


>gi|190891863|ref|YP_001978405.1| probable protein-export translocase protein [Rhizobium etli CIAT
           652]
 gi|190697142|gb|ACE91227.1| probable protein-export translocase protein [Rhizobium etli CIAT
           652]
          Length = 174

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 60/109 (55%), Gaps = 3/109 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
            TS+ LG+++RY   R  D ++R    S +  G  +   G +    +  
Sbjct: 61  LTSLGLGILTRYEG-RPSDILNRIPATSGQGNGILDSLGGGAQAPANQP 108


>gi|165976159|ref|YP_001651752.1| preprotein translocase subunit SecG [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|165876260|gb|ABY69308.1| preprotein translocase SecG subunit [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
          Length = 108

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 46/108 (42%), Gaps = 6/108 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L +++L+V V L+  +L+Q    +  G+S              +A+ L R TA+LA
Sbjct: 1   MLNVLPIIYLVVAVALIGFVLMQQGKGADAGASFGAGASGTVFGSAGSANFLSRTTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF  S+ +G ++ + +         S V    +Q      +   P+
Sbjct: 61  IIFFGISLLIGNLNSHQTAPKSQFEDLSGVQQKVEQPKVENPNNDIPQ 108


>gi|90409006|ref|ZP_01217136.1| Biopolymer transport protein [Psychromonas sp. CNPT3]
 gi|90309891|gb|EAS38046.1| Biopolymer transport protein [Psychromonas sp. CNPT3]
          Length = 109

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 6/96 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   L+VV+LIV V L+  +LIQ    +  G+S                + + R TA+LA
Sbjct: 1  MYEMLLVVYLIVAVILIGFVLIQQGKGAGMGASFGSGASNTVFGASGAGNFMTRTTAVLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
            FF  S+ALG +S    +        ++   +   
Sbjct: 61 IVFFILSLALGNLSTNKVSNDDVFSDLTIEKVVDAP 96


>gi|320355228|ref|YP_004196567.1| protein translocase subunit SecG [Desulfobulbus propionicus DSM
           2032]
 gi|320123730|gb|ADW19276.1| protein translocase subunit secG [Desulfobulbus propionicus DSM
           2032]
          Length = 124

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 45/124 (36%), Gaps = 10/124 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS-----AFGSSSNFTSVRSTAHSLGRFTAILAF 55
           M   L+VVH+IV + L+C++L+Q    +       GSS +          L + T + A 
Sbjct: 1   MTTILIVVHVIVCLFLICIVLLQHGKGADIGASFGGSSQSLFGTEGPVPLLNKITTLAAI 60

Query: 56  FFFATSIALGMISRYTSTRY-----KDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
            F  TS+ L  +S   S+       K    +                 + P+     A +
Sbjct: 61  VFMGTSVTLAYLSANKSSGSVMSDLKVQEQQIPAQQQPVAVPLPAEKAAGPQAPQEKADA 120

Query: 111 SSSV 114
           S   
Sbjct: 121 SGQQ 124


>gi|253998382|ref|YP_003050445.1| preprotein translocase subunit SecG [Methylovorus sp. SIP3-4]
 gi|253985061|gb|ACT49918.1| preprotein translocase, SecG subunit [Methylovorus sp. SIP3-4]
          Length = 116

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 19/116 (16%), Positives = 49/116 (42%), Gaps = 6/116 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
           M+  + +VH++  +G++ ++L+Q    +  G+      S +   V  +++ + R TA+  
Sbjct: 1   METLVSIVHVLAALGVIGLVLLQHGKGADMGAAFGSGASGSLFGVSGSSNFMSRATAVFV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FFATS+ L  +S + +         +       + +++     +    +     
Sbjct: 61  AIFFATSLTLAYMSSHRTQGSSVVKLPTNSVVAPGKASESAPAKPAESSPAKDVPQ 116


>gi|162455629|ref|YP_001617996.1| protein-export membrane protein [Sorangium cellulosum 'So ce 56']
 gi|161166211|emb|CAN97516.1| protein-export membrane protein [Sorangium cellulosum 'So ce 56']
          Length = 90

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS-----SSNFTSVRSTAHSLGRFTAILAF 55
          +  FL +VH+ V + L+ V+L+Q       GS     ++     R   + + R TA  A 
Sbjct: 2  LHTFLNIVHVFVCLFLILVVLLQQGRGGGMGSAMGGATAQVFGGRGAGNFMTRLTAACAV 61

Query: 56 FFFATSIALGMISR 69
           F ATS++L  +S 
Sbjct: 62 VFMATSVSLAYLSS 75


>gi|119477405|ref|ZP_01617596.1| Preprotein translocase SecG subunit [marine gamma proteobacterium
           HTCC2143]
 gi|119449331|gb|EAW30570.1| Preprotein translocase SecG subunit [marine gamma proteobacterium
           HTCC2143]
          Length = 134

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/112 (19%), Positives = 46/112 (41%), Gaps = 6/112 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M+  +++VH++V + ++ +I+IQ    +  G+S                + L   T+ L 
Sbjct: 1   MEQIVLIVHVLVALAIIGLIMIQQGKGADMGASFGAGASQTLFGSGGGGNVLTSATSWLV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSV 106
             FFATS  L +I++  S    +            +   +  +   P +D+ 
Sbjct: 61  TLFFATSFGLAVIAKENSMAAGNVDLPMPAVIESFEMPADVRESDIPGVDAA 112


>gi|326794267|ref|YP_004312087.1| preprotein translocase, SecG subunit [Marinomonas mediterranea
           MMB-1]
 gi|326545031|gb|ADZ90251.1| preprotein translocase, SecG subunit [Marinomonas mediterranea
           MMB-1]
          Length = 115

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 19/114 (16%), Positives = 44/114 (38%), Gaps = 6/114 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M+  ++VVH++  V ++ ++L+Q    +        G+S      +  +   GR TA  A
Sbjct: 1   MEALILVVHVLAAVAIIALVLLQQGKGADAGASFGGGASQTVFGSQGGSSFFGRMTAFFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FF TS  L  ++   +      +       + +  +      ++     + +
Sbjct: 61  LVFFLTSFGLAYVASEKAKSVSGALDFVPQAPVVESEDSLPQLDTTEVGSDIPS 114


>gi|313200457|ref|YP_004039115.1| preprotein translocase subunit SecG [Methylovorus sp. MP688]
 gi|312439773|gb|ADQ83879.1| preprotein translocase, SecG subunit [Methylovorus sp. MP688]
          Length = 116

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 19/116 (16%), Positives = 49/116 (42%), Gaps = 6/116 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
           M+  + +VH++  +G++ ++L+Q    +  G+      S +   V  +++ + R TA+  
Sbjct: 1   METLVSIVHVLAALGVIGLVLLQHGKGADMGAAFGSGASGSLFGVSGSSNFMSRATAVFV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FFATS+ L  +S + +         +       + +++     +    +     
Sbjct: 61  GIFFATSLTLAYMSSHRTQGSSVVKLPTNSVVAPGKASESAPAKPAESSPAKDVPQ 116


>gi|238793019|ref|ZP_04636648.1| Protein-export membrane protein secG [Yersinia intermedia ATCC
           29909]
 gi|238727619|gb|EEQ19144.1| Protein-export membrane protein secG [Yersinia intermedia ATCC
           29909]
          Length = 111

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 43/111 (38%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V  L++ +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1   MYEALLVFFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG +S        +  +       +           S  +  
Sbjct: 61  TLFFVISLILGNMSTNQGHTGSEWENLGTPAKTEQTTAPVAPAKPSSDIPQ 111


>gi|253991505|ref|YP_003042861.1| preprotein translocase subunit SecG [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|211638383|emb|CAR67005.1| protein-export membrane protein secg (preprotein translocase band
           subunit) (p12) [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782955|emb|CAQ86120.1| protein-export membrane protein secg (preprotein translocase band
           subunit) (p12) [Photorhabdus asymbiotica]
          Length = 114

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/114 (18%), Positives = 46/114 (40%), Gaps = 9/114 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L++V L+V +GL+ ++++Q    +  G+S      +       + + + R TAI A
Sbjct: 1   MYEALLIVFLLVAIGLIALVMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYK---DNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG ++   +       +    + V+   +          +  +  
Sbjct: 61  ALFFIISLVLGNMTSNQTGTSSKWENIGEPAKVEKSTEVPTAPAAPTPNSDIPQ 114


>gi|320540174|ref|ZP_08039829.1| preprotein translocase membrane subunit [Serratia symbiotica str.
           Tucson]
 gi|320029840|gb|EFW11864.1| preprotein translocase membrane subunit [Serratia symbiotica str.
           Tucson]
          Length = 111

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/111 (19%), Positives = 44/111 (39%), Gaps = 6/111 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L++ + LV +I++Q    +  G+S              + + +   TA+LA
Sbjct: 1   MYEALLVIFLLISIALVALIMLQQGKGAQAGASFGAGASGTLFGSSGSGNFMTHMTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF  S+ LG +S   S +  +  +       +     +     S  +  
Sbjct: 61  TLFFVISLILGNLSSNKSKKGSEWENLGQPVKSEQTTVPSAPAKPSSDIPQ 111


>gi|253686970|ref|YP_003016160.1| preprotein translocase, SecG subunit [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251753548|gb|ACT11624.1| preprotein translocase, SecG subunit [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 110

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 43/108 (39%), Gaps = 8/108 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V +GLV +I++Q    +  G+S      +       + + + R TAILA
Sbjct: 1   MYEALLVIFLLVSIGLVALIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF  S+ LG +S     +              +Q        +   
Sbjct: 61  TLFFIISLVLGNLSSLQ--KKGGAWDNLNQPEKAEQTTTPAAPSTPAS 106


>gi|146276923|ref|YP_001167082.1| preprotein translocase subunit SecG [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555164|gb|ABP69777.1| protein translocase subunit secG [Rhodobacter sphaeroides ATCC
           17025]
          Length = 207

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 48/120 (40%), Gaps = 3/120 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV--RSTAHSLGRFTAILAFFFF 58
           MQ  +++VHLI+ + L+ V+L+Q S+    G      ++  R  A+++ R T + A  F 
Sbjct: 1   MQNVVLIVHLILALLLIGVVLLQRSEGGGLGMGGGGGAMTGRQAANAMTRLTWVFAVAFI 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
            TSIAL + +   S      + +    + +              L      +  +     
Sbjct: 61  GTSIALTIFAAQNSH-GSSVIDQFGGTTRQQAPATPEAPLGGDLLPPAPTNAPLAPPRAD 119


>gi|54295619|ref|YP_128034.1| preprotein translocase subunit SecG [Legionella pneumophila str.
           Lens]
 gi|54298773|ref|YP_125142.1| preprotein translocase subunit SecG [Legionella pneumophila str.
           Paris]
 gi|53752558|emb|CAH13990.1| Protein-export membrane protein secG (Preprotein translocase
           subunit) [Legionella pneumophila str. Paris]
 gi|53755451|emb|CAH16947.1| Protein-export membrane protein secG (Preprotein translocase
           subunit) [Legionella pneumophila str. Lens]
          Length = 107

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 39/101 (38%), Gaps = 6/101 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M   ++++H+++ V L+ ++LIQ    +        G+S+     + T   L + T  LA
Sbjct: 1   MYQLILMIHVLIAVILIGLVLIQHGKGADIGAAFGSGASNTLFGSQGTGGFLFKLTGGLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF 95
             FF TS+ L  +    + +           +         
Sbjct: 61  MTFFITSLMLSYMVSTQNQKAGQLAIPQQTGAPVSSVPVPV 101


>gi|148361103|ref|YP_001252310.1| preprotein translocase subunit SecG [Legionella pneumophila str.
           Corby]
 gi|296108433|ref|YP_003620134.1| preprotein translocase SecG subunit [Legionella pneumophila 2300/99
           Alcoy]
 gi|148282876|gb|ABQ56964.1| preprotein translocase, SecG subunit [Legionella pneumophila str.
           Corby]
 gi|295650335|gb|ADG26182.1| preprotein translocase SecG subunit [Legionella pneumophila 2300/99
           Alcoy]
          Length = 107

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 38/101 (37%), Gaps = 6/101 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M   ++++H+++ V L+ ++LIQ    +        G+S+     + T   L + T  LA
Sbjct: 1   MYQLILMIHVLIAVILIGLVLIQHGKGADIGAAFGSGASNTLFGSQGTGGFLFKLTGGLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF 95
             FF TS+ L  +      +           +         
Sbjct: 61  MTFFITSLMLSYMVSTQHQKAGQLAIPQQTGAPVSSVPVPV 101


>gi|289548684|ref|YP_003473672.1| preprotein translocase, SecG subunit [Thermocrinis albus DSM 14484]
 gi|289182301|gb|ADC89545.1| preprotein translocase, SecG subunit [Thermocrinis albus DSM 14484]
          Length = 112

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 35/106 (33%), Gaps = 6/106 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF----TSVRSTAHSLGRFTAILAFF 56
           M  FL+V+ L+V   L+ V+L+Q S      +                 L R T  L F 
Sbjct: 1   MYYFLLVLFLMVAFLLIVVVLLQRSRGDVGTAFGGMGQSVFGPGGVDTILTRITYWLGFL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
           F A +I L +   +   R           S         G   SP 
Sbjct: 61  FMALAILLAL--THPGRRESLIKDEGAGTSQPASQGKQEGKTPSPS 104


>gi|86357801|ref|YP_469693.1| preprotein translocase subunit SecG [Rhizobium etli CFN 42]
 gi|86281903|gb|ABC90966.1| protein-export translocase protein [Rhizobium etli CFN 42]
          Length = 162

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 62/118 (52%), Gaps = 3/118 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
            TS+ LG+++RY   R  D ++R    S +  G  +   G +    S  A +      
Sbjct: 61  LTSLGLGILTRYEG-RPSDILNRIPATSGQGNGILDSLGGGAQAPASQPAGNGVPSSG 117


>gi|154148365|ref|YP_001405964.1| preprotein translocase, SecG subunit [Campylobacter hominis ATCC
           BAA-381]
 gi|153804374|gb|ABS51381.1| preprotein translocase, SecG subunit [Campylobacter hominis ATCC
           BAA-381]
          Length = 109

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 45/110 (40%), Gaps = 6/110 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M    +V+ +I  + +   +L+Q S      +  GS+ +    +  A  L +FTA++   
Sbjct: 1   MTTLFLVLQVIFTLVITVAVLLQKSTSIGLGAYSGSNESLFGAKGPAGFLAKFTAVMGIL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSV 106
           F   ++ALG    YT       +      +++ + + N  +   P +   
Sbjct: 61  FVLNTLALGYY--YTKDSKSSVLDNVDTGALEIKEDQNKSEPFVPLVPDA 108


>gi|291288869|ref|YP_003505685.1| preprotein translocase, SecG subunit [Denitrovibrio acetiphilus DSM
           12809]
 gi|290886029|gb|ADD69729.1| preprotein translocase, SecG subunit [Denitrovibrio acetiphilus DSM
           12809]
          Length = 107

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 17/104 (16%), Positives = 38/104 (36%), Gaps = 5/104 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDS-----SAFGSSSNFTSVRSTAHSLGRFTAILAF 55
           M   ++ +HL V   L+  +L+Q+        +  G   +     +  + + R T ++A 
Sbjct: 1   MYTIILALHLFVCFLLILAVLLQAGKGSSLGAAFGGGQGDVFGPGAPVNIMNRITTVVAI 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
            F  TS+ L ++S   +T    +              +     +
Sbjct: 61  LFMVTSLLLAVLSTQKTTNSVVDQFNVPAQQTVPAPVEIPAAPA 104


>gi|159045283|ref|YP_001534077.1| preprotein translocase subunit SecG [Dinoroseobacter shibae DFL 12]
 gi|157913043|gb|ABV94476.1| putative preprotein translocase [Dinoroseobacter shibae DFL 12]
          Length = 122

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 50/122 (40%), Gaps = 4/122 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M+  +++VHL++ + L+ V+L+Q S+    G          + RS A +LG+ T ILA  
Sbjct: 1   MENVILIVHLLLALALIGVVLLQRSEGGGLGMGGGGGGGAMTGRSAATALGKMTWILAVA 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           F  TSI L +++   S         +         ++     +S  L   +    +    
Sbjct: 61  FIGTSITLTILAAANSNNASVLDRLTDQPVPPPVESNEQLPPASDLLPPAATDQPALPPR 120

Query: 117 GK 118
             
Sbjct: 121 AD 122


>gi|327482028|gb|AEA85338.1| preprotein translocase subunit SecG [Pseudomonas stutzeri DSM 4166]
          Length = 127

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 56/126 (44%), Gaps = 9/126 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           +Q  ++VVHL+V +G+V ++L+Q    +        G+S+     + +A  L RFTAILA
Sbjct: 2   LQTVVIVVHLLVALGVVALVLLQQGKGADAGASFGSGASATVFGSQGSATFLSRFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS-VSAKSSSS 113
             FF TS+ L   ++  + +           ++ +           P L+    A ++  
Sbjct: 62  GVFFLTSLGLAFFAKQQADQLSQA--GLPDPAVLEVPASKPAVEDVPVLEQRKPADTAGD 119

Query: 114 VVAGKR 119
           +   + 
Sbjct: 120 LPEVEE 125


>gi|27365054|ref|NP_760582.1| preprotein translocase subunit SecG [Vibrio vulnificus CMCP6]
 gi|37680895|ref|NP_935504.1| preprotein translocase subunit SecG [Vibrio vulnificus YJ016]
 gi|320155438|ref|YP_004187817.1| preprotein translocase subunit SecG [Vibrio vulnificus MO6-24/O]
 gi|27361200|gb|AAO10109.1| preprotein translocase, SecG subunit [Vibrio vulnificus CMCP6]
 gi|37199645|dbj|BAC95475.1| preprotein translocase subunit SecG [Vibrio vulnificus YJ016]
 gi|319930750|gb|ADV85614.1| preprotein translocase subunit SecG [Vibrio vulnificus MO6-24/O]
          Length = 110

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 47/106 (44%), Gaps = 9/106 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +  G+S              + + L R TAILA
Sbjct: 1   MFSVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG +S + +              + +Q  DN  +  +
Sbjct: 61  TVFFIVSLTLGRMSTHKAE---SQWVDPTQGQVVEQVQDNVSEAPA 103


>gi|186476765|ref|YP_001858235.1| preprotein translocase subunit SecG [Burkholderia phymatum
          STM815]
 gi|184193224|gb|ACC71189.1| preprotein translocase, SecG subunit [Burkholderia phymatum
          STM815]
          Length = 130

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +  G+      S +      +A+ L R TAILA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAILA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF T++AL  +  Y S      +
Sbjct: 64 AVFFVTTLALTYLGAYHSKPSAGVL 88


>gi|78223156|ref|YP_384903.1| preprotein translocase subunit SecG [Geobacter metallireducens
           GS-15]
 gi|78194411|gb|ABB32178.1| protein translocase subunit secG [Geobacter metallireducens GS-15]
          Length = 131

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 46/131 (35%), Gaps = 6/131 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
           M I L ++H++V + L+ ++L+QS   +  G       S +          L + T   A
Sbjct: 1   MTILLTILHILVCIALIAIVLLQSGKGAEMGASFGAGGSQSVFGAGGGTTFLSKLTTGAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             F  TS+ L  +S  + T              K           +P+    S  +    
Sbjct: 61  IIFMLTSLTLAYLSGQSETSSIMPKGTVAPSPRKTAAPPTTQPTGTPQAPVQSTPTPQPS 120

Query: 115 VAGKRSSSRTK 125
                S+ +TK
Sbjct: 121 QRSSESAPQTK 131


>gi|86148841|ref|ZP_01067103.1| translocase [Vibrio sp. MED222]
 gi|85833368|gb|EAQ51564.1| translocase [Vibrio sp. MED222]
          Length = 110

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/106 (22%), Positives = 44/106 (41%), Gaps = 9/106 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG +S +     +          +  Q  D   +  +
Sbjct: 61  TTFFILSLVLGNMSTHK---TESQWIDPTQGQVIQQAEDAVSEVPA 103


>gi|253996974|ref|YP_003049038.1| preprotein translocase subunit SecG [Methylotenera mobilis JLW8]
 gi|253983653|gb|ACT48511.1| preprotein translocase, SecG subunit [Methylotenera mobilis JLW8]
          Length = 113

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 20/113 (17%), Positives = 49/113 (43%), Gaps = 7/113 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M+  ++V+H++   G++ ++L+Q    +  G+S       +   V  +++ + R TA   
Sbjct: 1   MENIVLVIHVLAACGVIGLVLLQHGKGADMGASFGSGASGSLFGVSGSSNFMSRATAGFV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
           F FF TS+ L  +S + +      +      ++    +       +   ++V 
Sbjct: 61  FVFFITSLTLAYLSSHKA-SSGSVVKAMSTQAVDAAKSAPAAATETTSTEAVP 112


>gi|227112559|ref|ZP_03826215.1| preprotein translocase subunit SecG [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 110

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 42/108 (38%), Gaps = 8/108 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V +GLV +I++Q    +  G+S      +       + + + R TAILA
Sbjct: 1   MYEALLVIFLLVSIGLVALIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF  S+ LG +S                    +Q        +   
Sbjct: 61  TLFFIISLILGNLSSLQKR--GGAWDNLSQPEKVEQTTTPAAPSTPAS 106


>gi|159184841|ref|NP_354613.2| preprotein translocase subunit SecG [Agrobacterium tumefaciens
          str. C58]
 gi|159140125|gb|AAK87398.2| protein-export membrane protein SECG [Agrobacterium tumefaciens
          str. C58]
          Length = 157

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 3/90 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V+HL++V+ LV V+LIQ S+    G      F S R TA++L R T ILA  FF
Sbjct: 1  MQTVLIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTGILAALFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
           TS+ LG+++RY S R  D ++R      +
Sbjct: 61 LTSLGLGLMTRYES-RPTDILNRIPATQGQ 89


>gi|188584387|ref|YP_001927832.1| preprotein translocase, SecG subunit [Methylobacterium populi
           BJ001]
 gi|179347885|gb|ACB83297.1| preprotein translocase, SecG subunit [Methylobacterium populi
           BJ001]
          Length = 156

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 7/127 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           MQ  L+VVHLI+V+ L+ V+L+Q S+               F + R  A++L R TAILA
Sbjct: 1   MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGGGGSGGVSGFMTGRGQANALTRATAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TSIAL +++ + S   +  +  +     + Q        +             + 
Sbjct: 61  ALFFTTSIALAILA-HRSAAPRSILDEAGTPQGQTQTQKPVNADNLLDTLRSGGAGQGAP 119

Query: 115 VAGKRSS 121
             G+ +S
Sbjct: 120 SGGQPAS 126


>gi|114799731|ref|YP_760497.1| preprotein translocase, SecG subunit [Hyphomonas neptunium ATCC
           15444]
 gi|114739905|gb|ABI78030.1| preprotein translocase, SecG subunit [Hyphomonas neptunium ATCC
           15444]
          Length = 151

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 50/120 (41%), Gaps = 6/120 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS----SNFTSVRSTAHSLGRFTAILAFF 56
           MQ  ++V+H++  + ++ ++L+Q S+    G      ++  S R  A +L R T I    
Sbjct: 1   MQNVILVIHILACLAMIGLVLVQKSEGGGLGIGGGAGNSLMSGRGAAGALVRTTMIFGAI 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD--SVSAKSSSSV 114
           FFATS+ L  I+   S             + +    D   D   P       ++ +S  V
Sbjct: 61  FFATSLILTSIANRQSDNRTGIERILDESNPQTAPQDGPVDLFDPSAPLLEETSPASPDV 120


>gi|86749908|ref|YP_486404.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
           HaA2]
 gi|86572936|gb|ABD07493.1| protein translocase subunit secG [Rhodopseudomonas palustris HaA2]
          Length = 130

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 32/114 (28%), Positives = 48/114 (42%), Gaps = 4/114 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           MQ  ++V+HL++V+GL+  +L+Q S+    G        F S R TA+ L R TA LA  
Sbjct: 1   MQTVIIVIHLMLVLGLIATVLLQKSEGGGLGVGGGGGGGFMSSRGTANLLTRTTAFLAVG 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
           FF TS+ L  ++ Y           +                    LDS+    
Sbjct: 61  FFITSLLLSWLATYNRKPTTILPTAAPTTQQAPGVPAPPVSQGGGLLDSLKQAD 114


>gi|52424784|ref|YP_087921.1| preprotein translocase subunit SecG [Mannheimia succiniciproducens
           MBEL55E]
 gi|52306836|gb|AAU37336.1| SecG protein [Mannheimia succiniciproducens MBEL55E]
          Length = 113

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 44/103 (42%), Gaps = 6/103 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M   L++V+L+V + L+  IL+Q    +  G+S              +A+ L R TAILA
Sbjct: 1   MYQVLLIVYLLVSIALIGFILVQQGKGADAGASFGGGASGTVFGSAGSANFLSRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGD 97
             FF  S+ +G I+ + +   +         + + Q       
Sbjct: 61  TIFFVISLVIGNINSHKNNVQQGTFDDLSQAAEQIQQKTVPAP 103


>gi|153875561|ref|ZP_02003309.1| preprotein translocase, SecG subunit [Beggiatoa sp. PS]
 gi|152067976|gb|EDN66692.1| preprotein translocase, SecG subunit [Beggiatoa sp. PS]
          Length = 135

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 49/127 (38%), Gaps = 8/127 (6%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAFFF 57
            L++ H+I+ + L+ +ILIQ    +        G+S+     + +   L R T +LA  F
Sbjct: 5   ILVIFHVILSLALIGLILIQHGKGADAGAAFGSGASATVFGSQGSGSFLTRTTGVLATLF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKD--QGNDNFGDGSSPKLDSVSAKSSSSVV 115
           F TS+ L   +              +        +      + +  +L  V    +S++ 
Sbjct: 65  FVTSLTLAYFTIQRIEPKSVLESSVVTQQPAPTTESEVPVTEKTDSELPPVENNETSTIP 124

Query: 116 AGKRSSS 122
           A +  + 
Sbjct: 125 ATETENP 131


>gi|134095032|ref|YP_001100107.1| IISP family preprotein translocase auxillary membrane component
           [Herminiimonas arsenicoxydans]
 gi|133738935|emb|CAL61982.1| Preprotein translocase SecG subunit [Herminiimonas arsenicoxydans]
          Length = 132

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 21/118 (17%), Positives = 48/118 (40%), Gaps = 6/118 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           +   ++VV ++  + ++ ++L+Q    +  G+S       +      +++ L +FT + A
Sbjct: 4   LHTIIVVVQVLSALTIIGLVLLQHGKGADMGASFGSGASGSLFGATGSSNFLSKFTGVAA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             FFA ++ L  IS   +      M    V ++      +     +P      A +S 
Sbjct: 64  AIFFAATLGLAFISNKPAQTSAGVMENLPVSAVPGAETKSAEVPGAPANVQPVAPASP 121


>gi|84387289|ref|ZP_00990310.1| translocase [Vibrio splendidus 12B01]
 gi|84377936|gb|EAP94798.1| translocase [Vibrio splendidus 12B01]
          Length = 110

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 45/109 (41%), Gaps = 8/109 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  +G++ ++LIQ    +  G+S              + + L R TA+ A
Sbjct: 1   MFTVLLVIYLLAALGVIGLVLIQQGKGADMGASFGAGASNTVFGAGGSGNFLTRMTAVFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKL 103
             FF  S+ LG +S + +      +  +    I+   +      +    
Sbjct: 61  TTFFILSLVLGNMSTHKTE--SQWIDPTQGQVIQQAEDAVSEVPTQGDE 107


>gi|294789673|ref|ZP_06754906.1| homoserine dehydrogenase [Simonsiella muelleri ATCC 29453]
 gi|294482385|gb|EFG30079.1| homoserine dehydrogenase [Simonsiella muelleri ATCC 29453]
          Length = 194

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 18/96 (18%), Positives = 38/96 (39%), Gaps = 7/96 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDS-------SAFGSSSNFTSVRSTAHSLGRFTAILA 54
           +  + ++++   + ++ ++LIQ              GS+         A+ L R T I A
Sbjct: 5   KTVIWIINIFASLAVIGLVLIQHGKGADAGANFGGSGSAQGVFGSGGNANFLTRITGIAA 64

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
             FFA+ +ALG I   ++ +        +  +    
Sbjct: 65  TIFFASCLALGYIHTKSNNKVGGLDFSDVQQTGSTP 100


>gi|90423972|ref|YP_532342.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
           BisB18]
 gi|90105986|gb|ABD88023.1| protein translocase subunit secG [Rhodopseudomonas palustris
           BisB18]
          Length = 128

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 33/130 (25%), Positives = 53/130 (40%), Gaps = 8/130 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           MQ  ++V+HL++V  L+  +L+Q S+  A G          F S R TA+ L R TA+LA
Sbjct: 1   MQTVIIVLHLMIVATLIATVLLQKSEGGALGMGGGGGGGGGFMSSRGTANLLTRTTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ L  I+ Y           +     +     + G G    L     + +   
Sbjct: 61  VGFFITSLLLSWIASYDRKPTTVI--DTPATQSQPAPPVSQGGGVLDTLKQQDQRDNQQA 118

Query: 115 VAGKRSSSRT 124
            +  +     
Sbjct: 119 PSAPQPPRSQ 128


>gi|197105215|ref|YP_002130592.1| preprotein translocase, SecG subunit [Phenylobacterium zucineum
           HLK1]
 gi|196478635|gb|ACG78163.1| preprotein translocase, SecG subunit [Phenylobacterium zucineum
           HLK1]
          Length = 149

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 4/118 (3%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSAFGS---SSNFTSVRSTAHSLGRFTAILAFFFFA 59
             L+V+ +IV   L+ V+L+Q S+  A G     S F + R     + R T IL   FF 
Sbjct: 4   TLLLVIEVIVAFFLIVVVLLQRSEGGALGMGGGPSGFMTARGAGDLMTRITWILGSVFFV 63

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
             + L +++          + R  VD+I     +      +P   +    +     A 
Sbjct: 64  LGLLLTIMAGREG-GSSSVVDRLKVDAIDPNSLNQSAPQPTPAAPAQGGPAPLQAPAP 120


>gi|262401662|ref|ZP_06078228.1| preprotein translocase subunit SecG [Vibrio sp. RC586]
 gi|262352079|gb|EEZ01209.1| preprotein translocase subunit SecG [Vibrio sp. RC586]
          Length = 110

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/106 (22%), Positives = 43/106 (40%), Gaps = 9/106 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+V++L+  V ++ ++LIQ    +  G+S              + + L R TAI A
Sbjct: 1   MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
             FF  S+ LG +S +     +          +  Q  D   +  +
Sbjct: 61  TIFFVISLVLGNMSTHK---TESQWVDPSQGQVIQQTGDTVSEAPA 103


>gi|319779193|ref|YP_004130106.1| Preprotein translocase subunit SecG [Taylorella equigenitalis MCE9]
 gi|317109217|gb|ADU91963.1| Preprotein translocase subunit SecG [Taylorella equigenitalis MCE9]
          Length = 242

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 51/127 (40%), Gaps = 15/127 (11%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILAFFF 57
            L+V+ +I  + ++ ++L+Q    +  GSS              +A+   R T   A  F
Sbjct: 8   ILVVIQVISSLAIIGLVLLQQGKGADMGSSFGGGSAGSLFGAAGSANFFSRMTKWAAVAF 67

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           FA+++ L  +S                    D G+   G  ++P +    + + S+VV G
Sbjct: 68  FASTLGLAWVSSGGG---------IKAPKPTDGGSVMEGYSATPVVPGAGSVAGSAVVGG 118

Query: 118 KRSSSRT 124
              +S T
Sbjct: 119 DEGNSTT 125


>gi|218885453|ref|YP_002434774.1| preprotein translocase subunit SecG [Desulfovibrio vulgaris str.
          'Miyazaki F']
 gi|218756407|gb|ACL07306.1| preprotein translocase, SecG subunit [Desulfovibrio vulgaris str.
          'Miyazaki F']
          Length = 114

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 18/89 (20%), Positives = 39/89 (43%), Gaps = 4/89 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFF 56
          MQ  ++ +H++  + L+ ++L+QS          G +++          L + TA LA  
Sbjct: 1  MQTLILTLHVVACLALIVLVLLQSGKEGMGVIFGGGNTSLFGSTGAGGMLAKLTAFLAVL 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVD 85
          F  TS++  +++    +     +   L D
Sbjct: 61 FIITSLSYNVLTSSRKSDDSTILDVKLED 89


>gi|33152359|ref|NP_873712.1| preprotein translocase subunit SecG [Haemophilus ducreyi 35000HP]
 gi|33148582|gb|AAP96101.1| preprotein translocase SecG subunit [Haemophilus ducreyi 35000HP]
          Length = 109

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 43/99 (43%), Gaps = 6/99 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
          M   L +++LIV + L+  +L+Q    +  G+S              +A+ L R TA LA
Sbjct: 1  MLNVLTIIYLIVAIILIGFVLMQQGKGADTGASFGAGASGTVFGSAGSANFLSRTTAFLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
            FFA S+ +G ++ + +         S +    +Q   
Sbjct: 61 TIFFALSLLIGNLNSHKTGNVSQFEDLSGIQQKVEQSTK 99


>gi|227328607|ref|ZP_03832631.1| preprotein translocase subunit SecG [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
 gi|290454896|emb|CBJ57154.1| preprotein translocase subunit SecG [Pectobacterium carotovorum]
          Length = 110

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 43/108 (39%), Gaps = 8/108 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V +GLV +I++Q    +  G+S      +       + + + R TAILA
Sbjct: 1   MYEALLVIFLLVSIGLVALIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF  S+ LG +S     +              +Q        +   
Sbjct: 61  TLFFIISLILGNLSSLQ--KKGGAWDNLSQPEKAEQTTTPAAPSTPAS 106


>gi|220925412|ref|YP_002500714.1| preprotein translocase subunit SecG [Methylobacterium nodulans
          ORS 2060]
 gi|219950019|gb|ACL60411.1| preprotein translocase, SecG subunit [Methylobacterium nodulans
          ORS 2060]
          Length = 135

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 47/81 (58%), Gaps = 5/81 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS-----SSNFTSVRSTAHSLGRFTAILAF 55
          MQ  L+VVHLI+V+ L+ V+L+Q S+           +  F + R  A++L R TAILA 
Sbjct: 1  MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGGGSSGTQGFLTGRGQANALTRATAILAA 60

Query: 56 FFFATSIALGMISRYTSTRYK 76
           FFATS+ L ++S  TS    
Sbjct: 61 LFFATSMVLAILSHRTSAPRS 81


>gi|37528351|ref|NP_931696.1| preprotein translocase subunit SecG [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36787789|emb|CAE16904.1| Protein-export membrane protein SecG (Preprotein translocase band 1
           subunit) (P12) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 112

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/110 (20%), Positives = 47/110 (42%), Gaps = 7/110 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV L+V +GL+ ++++Q    +  G+S      +       + + + R TA+ A
Sbjct: 1   MYGALLVVFLLVAIGLIALVMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG ++    T            +  ++  +     ++P  D
Sbjct: 61  TLFFIISLVLGNMTSNQ-TGASSKWENIGEPAKVEKSTEIPTAPAAPNSD 109


>gi|74317159|ref|YP_314899.1| preprotein translocase subunit SecG [Thiobacillus denitrificans
          ATCC 25259]
 gi|74056654|gb|AAZ97094.1| preprotein translocase SecG subunit [Thiobacillus denitrificans
          ATCC 25259]
          Length = 114

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 7/90 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILA 54
          M+  + V+H+IV + ++ ++L+Q    +  G++    S  S       A+ L R TAI+A
Sbjct: 1  METLVWVLHVIVAIAVIALVLLQHGKGADMGAAFGSGSSGSLFGASGSANFLSRSTAIVA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLV 84
            FF TS+ L         +    + R+ V
Sbjct: 61 TLFFLTSLGLAYFGLQQ-HKPASVLDRTQV 89


>gi|154248119|ref|YP_001419077.1| preprotein translocase, SecG subunit [Xanthobacter autotrophicus
           Py2]
 gi|154162204|gb|ABS69420.1| preprotein translocase, SecG subunit [Xanthobacter autotrophicus
           Py2]
          Length = 133

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 36/130 (27%), Positives = 60/130 (46%), Gaps = 9/130 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-------FTSVRSTAHSLGRFTAIL 53
           MQ  L+V+HL+VV+ L+ V+LIQ S+    G           F + R +A+ L R TA+L
Sbjct: 1   MQTVLIVIHLMVVLALIGVVLIQRSEGGGLGIGGGGGGGAGGFFTARGSANLLTRATAVL 60

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS--AKSS 111
           A  FF TS+AL +++ +           +       Q      D   P+  +    A ++
Sbjct: 61  ALIFFITSLALTIVAGWGRAPRSILQPATQSGPQVPQSGGTILDQIRPQGGAADQGAPAT 120

Query: 112 SSVVAGKRSS 121
            +V +G +  
Sbjct: 121 PAVPSGPQVP 130


>gi|221234727|ref|YP_002517163.1| protein translocase subunit SecG [Caulobacter crescentus NA1000]
 gi|220963899|gb|ACL95255.1| protein translocase subunit secG [Caulobacter crescentus NA1000]
          Length = 155

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 47/124 (37%), Gaps = 4/124 (3%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSS---AFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
            L+ ++++V +GL+ V+L+Q S+       G+S    + R     L R T IL   F   
Sbjct: 5   VLLAINIVVCLGLIGVVLLQRSEGGALGMGGNSGGLMTARGAGDLLTRITWILFSIFLTI 64

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120
           S+ L +++     +             K   N      +   L+S+ + +    +     
Sbjct: 65  SLVLTILTG-RLDKSGSVADSIKGLDAKTLQNVPAPTPAPGSLNSLPSSAQPGGIQAPTP 123

Query: 121 SSRT 124
              T
Sbjct: 124 QINT 127


>gi|308050587|ref|YP_003914153.1| protein translocase subunit secG [Ferrimonas balearica DSM 9799]
 gi|307632777|gb|ADN77079.1| protein translocase subunit secG [Ferrimonas balearica DSM 9799]
          Length = 106

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 50/105 (47%), Gaps = 6/105 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   LMVV+L+V +G++ ++LIQ    ++ G+S      +       + + L R TA+LA
Sbjct: 1   MFEILMVVYLLVALGIIGLVLIQQGQGASMGASFGAGASATLFGSSGSGNFLTRATALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
             FF  S+ LG +S +++   +     ++    +       GD  
Sbjct: 61  TAFFVLSLVLGRMSAHSAKPTEGWDEINVPVVEQPAETQPSGDVP 105


>gi|254467886|ref|ZP_05081292.1| preprotein translocase, SecG subunit [beta proteobacterium KB13]
 gi|207086696|gb|EDZ63979.1| preprotein translocase, SecG subunit [beta proteobacterium KB13]
          Length = 118

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 44/91 (48%), Gaps = 6/91 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV------RSTAHSLGRFTAILA 54
          M+  L+++HL+  +G++ ++L+Q+   +  GS+    +       + +++ + + TA   
Sbjct: 1  METILIILHLLASIGVIGLVLLQNGRGADAGSAFGGGNSSGSFGIQGSSNFMTKATAFCV 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVD 85
            FF TSI+L +++             S+  
Sbjct: 61 TLFFITSISLALVASNKHGDRSVVDASSIDT 91


>gi|290473444|ref|YP_003466311.1| preprotein translocase membrane protein transport across inner
           membrane [Xenorhabdus bovienii SS-2004]
 gi|289172744|emb|CBJ79515.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Xenorhabdus
           bovienii SS-2004]
          Length = 112

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 23/110 (20%), Positives = 44/110 (40%), Gaps = 7/110 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+ V L+  +G++ ++L+Q    +  G+S      +       +++ + R TAI A
Sbjct: 1   MYEALLGVFLLAGLGVIALVLLQQGKGADMGASFGAGASATLFGSSGSSNFMTRMTAIFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF  S+ LG +S    T               ++  +     + P  D
Sbjct: 61  TLFFVISLILGNMSSNR-TGSDSKWENLAEPVKVEKQAEVPASPAKPNSD 109


>gi|89095217|ref|ZP_01168140.1| Preprotein translocase SecG subunit [Oceanospirillum sp. MED92]
 gi|89080514|gb|EAR59763.1| Preprotein translocase SecG subunit [Oceanospirillum sp. MED92]
          Length = 130

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 49/122 (40%), Gaps = 6/122 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M+  ++++H+++   ++ +IL+Q    +  G+S              + + L R TAI+A
Sbjct: 1   METVVLIIHVLLAAAIIGLILLQQGKGAEAGASFGAGASQTVFGSTGSGNFLSRMTAIVA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
              FATS  L + ++  +    D    S          D        +L ++     + V
Sbjct: 61  AGIFATSFVLAVYAKNKADTVSDAGIPSAEVIESRAAADAAAAEDQAQLPALEESKPAEV 120

Query: 115 VA 116
            A
Sbjct: 121 PA 122


>gi|329893947|ref|ZP_08269982.1| Preprotein translocase subunit SecG (TC 3.A.5.1.1) [gamma
           proteobacterium IMCC3088]
 gi|328923402|gb|EGG30719.1| Preprotein translocase subunit SecG (TC 3.A.5.1.1) [gamma
           proteobacterium IMCC3088]
          Length = 124

 Score = 70.5 bits (171), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 49/122 (40%), Gaps = 6/122 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M+  ++VVHL+V + ++ +I+IQ    +  G+S              + ++L + T+ L 
Sbjct: 1   MEQIILVVHLLVALAIIGLIMIQQGKGADMGASFGAGASQTLLGSAGSGNALTKATSWLV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FFATS AL +++   +   +D      V+      +    D     +   S       
Sbjct: 61  AAFFATSFALAVVANEKTAPVEDLGIEIPVEVEAPASDLPVVDDEPEAMSPTSDLPIVPD 120

Query: 115 VA 116
             
Sbjct: 121 SG 122


>gi|116625814|ref|YP_827970.1| protein translocase subunit secG [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116228976|gb|ABJ87685.1| protein translocase subunit secG [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 142

 Score = 70.5 bits (171), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 42/113 (37%), Gaps = 6/113 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M I L +VH+IV + L+ V+L+QS  ++          S      R +A  L + T I A
Sbjct: 1   MYILLWIVHVIVCLFLIIVVLLQSGKAADLAGAFGGMGSQTAFGPRGSATLLSKATTISA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             F  TS++L +++   +      +  +   S                     
Sbjct: 61  ILFMITSLSLSILATRNAGLGTSVLETAPKTSAPKSAPTQTVPIPGQAPQGNP 113


>gi|217970155|ref|YP_002355389.1| preprotein translocase subunit SecG [Thauera sp. MZ1T]
 gi|217507482|gb|ACK54493.1| preprotein translocase, SecG subunit [Thauera sp. MZ1T]
          Length = 116

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 46/109 (42%), Gaps = 6/109 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
           +   ++ VH++V +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 5   LFSLVLTVHVLVGLGVIGLVLVQHGKGADMGAAFGSGASGSLFGASGSANFLSRTTAVLA 64

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKL 103
             FF TS+ L  ++          M  +      +       + S  + 
Sbjct: 65  TVFFLTSLGLSFLASNKPAAPGSVMEGAQTAPATNPAPAAPVESSPAQS 113


>gi|89067833|ref|ZP_01155277.1| preprotein translocase, SecG subunit [Oceanicola granulosus
           HTCC2516]
 gi|89046431|gb|EAR52487.1| preprotein translocase, SecG subunit [Oceanicola granulosus
           HTCC2516]
          Length = 120

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 51/121 (42%), Gaps = 4/121 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFF 57
           M+  +++VHL++ + L+ V+L+Q S+    G         + RS A +LG+ T  LA  F
Sbjct: 1   MENVILIVHLLLALSLIGVVLMQRSEGGGLGIGGGGGGMMTGRSAATALGKVTWGLAVAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
             TSIAL +++   S      + R          +     G    L   +  S   + A 
Sbjct: 61  IITSIALTIMAARDSA-SGSVLDRITDTPAGAASDALPDLGGESLLPPGADGSDGLLPAA 119

Query: 118 K 118
            
Sbjct: 120 D 120


>gi|239906469|ref|YP_002953210.1| protein-export membrane protein SecG [Desulfovibrio magneticus
           RS-1]
 gi|239796335|dbj|BAH75324.1| protein-export membrane protein SecG [Desulfovibrio magneticus
           RS-1]
          Length = 127

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 38/105 (36%), Gaps = 4/105 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   ++ VH++  V ++ ++L+QS          G S +          L + TA+    
Sbjct: 1   MTTLIITVHVLACVAVIILVLLQSGKEGMGVIFGGGSQSVFGSTGAGGLLVKLTALFGAI 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
           F  TS+A  + S       K  M  +    ++          + P
Sbjct: 61  FLITSLAYNVYSGSHKRSAKSVMMDASGAPVQIPAAVEGAKDAEP 105


>gi|322514511|ref|ZP_08067548.1| preprotein translocase subunit SecG [Actinobacillus ureae ATCC
          25976]
 gi|322119581|gb|EFX91659.1| preprotein translocase subunit SecG [Actinobacillus ureae ATCC
          25976]
          Length = 109

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 42/99 (42%), Gaps = 6/99 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
          M   L +++L+V + L+  IL+Q    +  G+S              +A+ L R TAILA
Sbjct: 1  MLNVLTIIYLVVAIALIGFILMQQGKGADAGASFGAGAAGTVFGSAGSANFLSRTTAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
            FF  S+ +G ++ +           S V    +Q   
Sbjct: 61 VIFFGISLLIGYLNSHQVAPKSQFEDLSGVQQKVEQPAK 99


>gi|148651970|ref|YP_001279063.1| preprotein translocase subunit SecG [Psychrobacter sp. PRwf-1]
 gi|148571054|gb|ABQ93113.1| protein translocase subunit secG [Psychrobacter sp. PRwf-1]
          Length = 105

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 42/105 (40%), Gaps = 6/105 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   ++ +H+IV + ++ +ILIQ    +  G+S              +A+ L R TAILA
Sbjct: 1   MFNIILAIHIIVAIAMIGLILIQHGKGADAGASFGAGASGTVFGAAGSANFLTRATAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
             FF TS+ L + +R  +         +   +             
Sbjct: 61  IIFFTTSLTLAVHARKQAEGQYRLDVPAASQAPVTAPEPTPAPAE 105


>gi|307611660|emb|CBX01351.1| protein-export membrane protein secG [Legionella pneumophila 130b]
          Length = 108

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 39/101 (38%), Gaps = 6/101 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M   ++++H+++ V L+ ++LIQ    +        G+S+     + T   L + T  LA
Sbjct: 1   MYQLILMIHVLIAVILIGLVLIQHGKGADIGAAFGSGASNTLFGSQGTGGFLFKLTGGLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF 95
             FF TS+ L  +    + +           +         
Sbjct: 61  MTFFITSLMLSYMVSTQNQKAGQLAIPQQTGAPVSSVPVPV 101


>gi|307730341|ref|YP_003907565.1| preprotein translocase, SecG subunit [Burkholderia sp. CCGE1003]
 gi|307584876|gb|ADN58274.1| preprotein translocase, SecG subunit [Burkholderia sp. CCGE1003]
          Length = 128

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF T++AL  +  Y        +
Sbjct: 64 AVFFVTTLALTYLGAYRVKPSAGVL 88


>gi|53805148|ref|YP_113188.1| preprotein translocase subunit SecG [Methylococcus capsulatus str.
           Bath]
 gi|53758909|gb|AAU93200.1| preprotein translocase, SecG subunit [Methylococcus capsulatus str.
           Bath]
          Length = 117

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 47/116 (40%), Gaps = 6/116 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV------RSTAHSLGRFTAILA 54
           M   L V H+++ + +V ++L+Q    +  G+     S       R  A  L R TAILA
Sbjct: 1   MIQALTVFHVLLALSIVGLVLLQQGRGADAGAGFGGGSSGSLFGARGAASFLSRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             FF TS+ L  +S +   +  D M    V   +        + +    D  +  +
Sbjct: 61  TLFFGTSLTLAYLSGHVDNKRLDIMDVPAVQQSQPDMPAVAPEPAKSGSDVPAQPA 116


>gi|260427354|ref|ZP_05781333.1| preprotein translocase subunit SecG [Citreicella sp. SE45]
 gi|260421846|gb|EEX15097.1| preprotein translocase subunit SecG [Citreicella sp. SE45]
          Length = 126

 Score = 70.1 bits (170), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 56/125 (44%), Gaps = 3/125 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  +++VHL++ + L+ V+L+Q S+    G        S R+ A +LG+ T ILA  F 
Sbjct: 1   MQNVILIVHLLLALSLIGVVLLQRSEGGGLGMGGGGGAMSQRAAATALGKITWILAICFI 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ L +++   ++     M R    +   +     G+  +  L    + S S      
Sbjct: 61  ATSLTLTILAAQDASGV-SVMDRLTGGAPAAEEPSTPGEIDTDSLLPPPSASGSETSPDA 119

Query: 119 RSSSR 123
               R
Sbjct: 120 PLVPR 124


>gi|255319715|ref|ZP_05360923.1| preprotein translocase iisp family, auxillary membrane component
           [Acinetobacter radioresistens SK82]
 gi|262380003|ref|ZP_06073158.1| preprotein translocase, SecG subunit [Acinetobacter radioresistens
           SH164]
 gi|255303244|gb|EET82453.1| preprotein translocase iisp family, auxillary membrane component
           [Acinetobacter radioresistens SK82]
 gi|262298197|gb|EEY86111.1| preprotein translocase, SecG subunit [Acinetobacter radioresistens
           SH164]
          Length = 109

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 27/109 (24%), Positives = 51/109 (46%), Gaps = 8/109 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M  F++V+H+I+ V ++ +IL+Q    +  G+S              + + + R TAIL 
Sbjct: 1   MHTFVLVIHIILAVLMIGLILVQHGKGADAGASFGGGGAATVFGASGSGNFMTRLTAILT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKL 103
             FF TS+ L + ++  +T       +S+  S+  Q        ++PK 
Sbjct: 61  ALFFVTSLTLAVFAKKQTTAAYSL--QSVQTSVPAQPVSPETSPTAPKT 107


>gi|88797620|ref|ZP_01113209.1| preprotein translocase, SecG subunit [Reinekea sp. MED297]
 gi|88779792|gb|EAR10978.1| preprotein translocase, SecG subunit [Reinekea sp. MED297]
          Length = 115

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 23/116 (19%), Positives = 48/116 (41%), Gaps = 19/116 (16%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAF 55
           +  ++++H+ + +G+V  +L+Q    +        G+S        + + L R TAIL  
Sbjct: 4   ENLILLIHVALAIGVVVFVLLQRGKGAEAGASFGGGASQTVFGSSGSGNFLTRTTAILVA 63

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
            FF TS+AL  +++  +    +              N    + ++P    V A + 
Sbjct: 64  GFFLTSMALAYVAKQRAEDMNNI-------------NVPVSEQAAPVESDVPASTD 106


>gi|104780025|ref|YP_606523.1| preprotein translocase subunit SecG [Pseudomonas entomophila L48]
 gi|95109012|emb|CAK13708.1| putative preprotein translocase SecG Subunit [Pseudomonas
           entomophila L48]
          Length = 130

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 54/131 (41%), Gaps = 10/131 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  + LV ++L+Q    +  G+S            + +A  L + TAILA
Sbjct: 2   LETVVVVFHLLAALALVVMVLLQQGKGAEAGASFGAGASNTVFGSQGSATFLSKVTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF T++ LG  ++  + +    + ++ +               +  +  +  + S + 
Sbjct: 62  ATFFLTALGLGYFAKQQAHQ----LTQAGLPDPAVLEVKEQKPAVNDDVPVLQQQKSETT 117

Query: 115 VAGKRSSSRTK 125
            +G       +
Sbjct: 118 NSGDVPPPAKE 128


>gi|50083626|ref|YP_045136.1| preprotein translocase subunit SecG [Acinetobacter sp. ADP1]
 gi|49529602|emb|CAG67314.1| preprotein translocase IISP family, auxillary membrane component
           [Acinetobacter sp. ADP1]
          Length = 109

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 46/105 (43%), Gaps = 6/105 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M  F++VVH+I+ V ++ ++LIQ    +  G+S              + + L R TA+L 
Sbjct: 1   MHTFVLVVHIILAVLIIGLVLIQHGKGADAGASFGGGGAATVFGASGSGNFLTRVTAVLT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
             FF TS++L + ++  +T           +S      +   +  
Sbjct: 61  ALFFVTSLSLAVFAKKQTTDAYSLKSVQTTNSAPASTPETSPNAP 105


>gi|325267827|ref|ZP_08134477.1| preprotein translocase subunit SecG [Kingella denitrificans ATCC
           33394]
 gi|324980708|gb|EGC16370.1| preprotein translocase subunit SecG [Kingella denitrificans ATCC
           33394]
          Length = 124

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 41/97 (42%), Gaps = 7/97 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDS-------SAFGSSSNFTSVRSTAHSLGRFTAILA 54
           +  + +V++   +G++ ++L+Q              GS+         A+ L R T++ A
Sbjct: 5   KNVIWIVNIFSSLGIIILVLMQHGKGADTGASFGGSGSAQGVFGSGGNANFLSRMTSLFA 64

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG 91
             FF++ +ALG I   T  +   +       + + Q 
Sbjct: 65  VIFFSSCLALGYIHSRTYGKGGMDFSDVKQSAPQTQP 101


>gi|323697870|ref|ZP_08109782.1| preprotein translocase, SecG subunit [Desulfovibrio sp. ND132]
 gi|323457802|gb|EGB13667.1| preprotein translocase, SecG subunit [Desulfovibrio desulfuricans
          ND132]
          Length = 116

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 18/85 (21%), Positives = 36/85 (42%), Gaps = 4/85 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFF 56
          M+  ++V+H++  + L+  +++QS          G SS           L + TA LA  
Sbjct: 1  METIVIVIHVLACIFLIGAVMLQSGHEGMGVIFGGGSSTMFGSTGAGGLLVKVTAGLATV 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHR 81
          F  TS+   +++    +     M +
Sbjct: 61 FLLTSLGYNILTGNKVSNVDSIMLQ 85


>gi|237751370|ref|ZP_04581850.1| export protein secG [Helicobacter bilis ATCC 43879]
 gi|229372736|gb|EEO23127.1| export protein secG [Helicobacter bilis ATCC 43879]
          Length = 142

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/118 (18%), Positives = 45/118 (38%), Gaps = 4/118 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L+V  +I+ + +V  +L+Q S      +  GS+ +    +  A+ + + T  L   
Sbjct: 1   MTSVLIVFQVILTIAIVIAVLLQKSSSIGLGAYSGSNESLFGAKGPANFMAKITMFLGLL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
           F   +IALG +    S+R    +    +         +     S  L   +  + +  
Sbjct: 61  FIINTIALGYLYNTKSSRSSSVLDGVEIPKALPLTPTDSTLPLSSPLLQGTQPALTPQ 118


>gi|82702219|ref|YP_411785.1| preprotein translocase subunit SecG [Nitrosospira multiformis
          ATCC 25196]
 gi|82410284|gb|ABB74393.1| protein translocase subunit secG [Nitrosospira multiformis ATCC
          25196]
          Length = 117

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 6/93 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILA 54
          M+  + ++H++   G++ ++L+Q    +  G++    S  S       A+ L R T +LA
Sbjct: 1  METLIWILHVLSAAGVIVLVLLQHGKGADMGAAFGSGSSGSLFGASGSANFLSRTTGVLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSI 87
            FF TS+ L  +S   S           + S+
Sbjct: 61 AVFFMTSLGLTYLSTNRSESGGVMDKAVPIQSV 93


>gi|296274576|ref|YP_003657207.1| preprotein translocase subunit SecG [Arcobacter nitrofigilis DSM
           7299]
 gi|296098750|gb|ADG94700.1| preprotein translocase, SecG subunit [Arcobacter nitrofigilis DSM
           7299]
          Length = 128

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/126 (17%), Positives = 44/126 (34%), Gaps = 11/126 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L+VV  I+ V L   IL+Q S      +  GS+ +    +   + L + T +L   
Sbjct: 1   MTSTLLVVQFILAVLLTICILLQKSSSMGLGAYSGSNESLFGAKGPGNFLTKATMVLGLI 60

Query: 57  FFATSIALGMI-------SRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
           F   ++ LG         S   + + +  + ++   +            +     +V A 
Sbjct: 61  FVLNTLVLGYFYNENRQRSAVDNVQTESLIPKTPEKAQAPAAPAAPVAPAEKTAPTVPAV 120

Query: 110 SSSSVV 115
            +    
Sbjct: 121 PTVPTT 126


>gi|323525435|ref|YP_004227588.1| preprotein translocase subunit SecG [Burkholderia sp. CCGE1001]
 gi|323382437|gb|ADX54528.1| preprotein translocase, SecG subunit [Burkholderia sp. CCGE1001]
          Length = 131

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF T++AL  +  Y        +
Sbjct: 64 AVFFVTTLALTYLGAYRVKPSAGVL 88


>gi|170743496|ref|YP_001772151.1| preprotein translocase, SecG subunit [Methylobacterium sp. 4-46]
 gi|168197770|gb|ACA19717.1| preprotein translocase, SecG subunit [Methylobacterium sp. 4-46]
          Length = 142

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 5/81 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS-----SSNFTSVRSTAHSLGRFTAILAF 55
          MQ  L+VVHLI+V+ L+ V+L+Q S+           +  F + R  A++L R TAILA 
Sbjct: 1  MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGGGGSGTQGFLTGRGQANALTRATAILAA 60

Query: 56 FFFATSIALGMISRYTSTRYK 76
           FF TS+ L ++S  T+    
Sbjct: 61 LFFTTSMVLAILSHRTAAPRS 81


>gi|291278563|ref|YP_003495398.1| preprotein translocase subunit G [Deferribacter desulfuricans SSM1]
 gi|290753265|dbj|BAI79642.1| preprotein translocase subunit G [Deferribacter desulfuricans SSM1]
          Length = 105

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 49/103 (47%), Gaps = 7/103 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRSTAHSLGRFTAILAF 55
           M   ++ +H+ V + L+  +L+QS       S+  G SS+     + A+ + + T IL  
Sbjct: 1   MYSIIIAIHVFVSILLILAVLLQSGKESDLGSAFGGGSSDSFGPATPANIMNKITTILVI 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
            FF TSI L ++S+  +      ++   V++  +Q N+     
Sbjct: 61  VFFFTSITLTIMSKNRTGE--SILNNIPVNAPVEQKNNLPQVP 101


>gi|260556302|ref|ZP_05828521.1| preprotein translocase, SecG subunit [Acinetobacter baumannii ATCC
           19606]
 gi|260410357|gb|EEX03656.1| preprotein translocase, SecG subunit [Acinetobacter baumannii ATCC
           19606]
          Length = 109

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 50/111 (45%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M  F++VVH+I+ V ++ +IL+Q    +  G+S              + + L R TAIL 
Sbjct: 1   MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNFLTRVTAILT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS+ L + ++  +T       +++  +   Q        ++PK   
Sbjct: 61  ALFFVTSLTLAIFAKKQTTEAYSL--KTVQTTAPAQTTSPETSPNAPKTGQ 109


>gi|74420895|gb|ABA05094.1| protein translocase subunit secG [Nitrobacter winogradskyi Nb-255]
          Length = 138

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 3/102 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  ++V+HLI+V  L  V+L+Q S+    G      F S R TA+ L R T+ LA  FF
Sbjct: 15  MQTAVIVIHLIIVATLTVVVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTSFLAAGFF 74

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
            TS+ L  ++     +    +  +     +         G  
Sbjct: 75  VTSLLLSWLAGVE-QKPGSILDTAPASQSQPATPVAPPSGGG 115


>gi|184156667|ref|YP_001845006.1| preprotein translocase subunit SecG [Acinetobacter baumannii ACICU]
 gi|294842031|ref|ZP_06786714.1| preprotein translocase subunit SecG [Acinetobacter sp. 6014059]
 gi|183208261|gb|ACC55659.1| Preprotein translocase subunit SecG [Acinetobacter baumannii ACICU]
 gi|323516433|gb|ADX90814.1| preprotein translocase subunit SecG [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 109

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 51/111 (45%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M  F++VVH+I+ V ++ +IL+Q    +  G+S              + + L R TAIL 
Sbjct: 1   MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNFLTRVTAILT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS+ L + ++  +T       +++  ++  Q        ++PK   
Sbjct: 61  ALFFVTSLTLAVFAKKQTTEAYSL--KTVQTTVPVQTTSPETSPNAPKTGQ 109


>gi|170696400|ref|ZP_02887529.1| preprotein translocase, SecG subunit [Burkholderia graminis
          C4D1M]
 gi|170138728|gb|EDT06927.1| preprotein translocase, SecG subunit [Burkholderia graminis
          C4D1M]
          Length = 128

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF T++ L  +  Y +      +
Sbjct: 64 AVFFVTTLTLTYLGAYRAKPSAGVL 88


>gi|260550519|ref|ZP_05824729.1| preprotein translocase subunit SecG [Acinetobacter sp. RUH2624]
 gi|260406434|gb|EEW99916.1| preprotein translocase subunit SecG [Acinetobacter sp. RUH2624]
          Length = 109

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 50/111 (45%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M  F++VVH+I+ V ++ +IL+Q    +  G+S              + + L R TA+L 
Sbjct: 1   MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNFLTRLTAVLT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS+ L + ++  +T       +++  +   Q        ++PK   
Sbjct: 61  ALFFVTSLTLAVFAKKQTTEAYSL--KTVQTTAPAQTTSPETSPNAPKTGQ 109


>gi|237808993|ref|YP_002893433.1| preprotein translocase, SecG subunit [Tolumonas auensis DSM 9187]
 gi|237501254|gb|ACQ93847.1| preprotein translocase, SecG subunit [Tolumonas auensis DSM 9187]
          Length = 115

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 49/115 (42%), Gaps = 7/115 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+VV+L+V + LV ++L+Q    ++ G+S              + + L + TAILA
Sbjct: 1   MYEVLLVVYLLVAIALVGLVLVQHGKGASMGASFGAGASNTVFGSSGSGNFLTKSTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF  S+ALG ++     +  DN       +  +Q  D   + +          
Sbjct: 61  ILFFVISLALGAMTNNR-NKPADNWSDLTKPATTEQTVDKPAEKAVDVKKDADVP 114


>gi|154174058|ref|YP_001409187.1| protein-export membrane protein [Campylobacter curvus 525.92]
 gi|153793041|gb|EAU00799.2| protein-export membrane protein [Campylobacter curvus 525.92]
          Length = 112

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 18/112 (16%), Positives = 42/112 (37%), Gaps = 6/112 (5%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
             +++  ++ V +   +L+Q S      +  GS+ +    +  A  L +FT ++   F  
Sbjct: 2   IFLILQFVLAVVITISVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFVVGILFIL 61

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
            ++ LG +      R    +     +S+         + S P + S     +
Sbjct: 62  NTLTLGYLYNKDMKR--SLIDSVDTNSLVAPKPAEPSEPSVPSVPSAPQTPA 111


>gi|260914405|ref|ZP_05920874.1| preprotein translocase [Pasteurella dagmatis ATCC 43325]
 gi|260631506|gb|EEX49688.1| preprotein translocase [Pasteurella dagmatis ATCC 43325]
          Length = 113

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 45/113 (39%), Gaps = 8/113 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+  ++I+   L+  IL+Q    +  G+S              + + L + TAILA
Sbjct: 1   MYHALLFGYVIISAVLIGFILLQQGKGADAGASFGAGASGTIFGAAGSGNFLSKTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMH--RSLVDSIKDQGNDNFGDGSSPKLDS 105
             FFA S+ +G I+ +     K       S  + ++ +      +  +  +  
Sbjct: 61  TVFFALSLVIGNINSHRDNVVKGKFDDLSSTAEQVQQKLEVPAVETKNSDIPQ 113


>gi|71064647|ref|YP_263374.1| preprotein translocase subunit SecG [Psychrobacter arcticus 273-4]
 gi|71037632|gb|AAZ17940.1| protein translocase subunit secG [Psychrobacter arcticus 273-4]
          Length = 102

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 6/101 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
           M  F++ +H+IV + ++ +ILIQ    +  G      SS        TA+ L R TA+L 
Sbjct: 1   MFTFILTLHIIVAIAMIGLILIQHGKGADAGASFGAGSSGTVFGAAGTANFLTRATAVLT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF 95
             FF TS++L + +R  +                     N 
Sbjct: 61  AIFFITSMSLAVHARKQAEDQFRLDAPVSAPQTPRPLTQNP 101


>gi|212702543|ref|ZP_03310671.1| hypothetical protein DESPIG_00562 [Desulfovibrio piger ATCC
          29098]
 gi|212673984|gb|EEB34467.1| hypothetical protein DESPIG_00562 [Desulfovibrio piger ATCC
          29098]
          Length = 156

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 37/87 (42%), Gaps = 4/87 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFF 56
          MQ  ++ +H+IV V LV +IL+Q+          G +++          L + TA +A  
Sbjct: 1  MQTLILTLHIIVCVVLVILILLQAGKEGMGVIFGGGNTSVFGSSGAGGMLAKMTAFMAVV 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSL 83
          F  TS++   ++    +     +    
Sbjct: 61 FVVTSLSYTYVTSSRPSDESAVLKVEP 87


>gi|323138444|ref|ZP_08073513.1| preprotein translocase, SecG subunit [Methylocystis sp. ATCC 49242]
 gi|322396240|gb|EFX98772.1| preprotein translocase, SecG subunit [Methylocystis sp. ATCC 49242]
          Length = 255

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 36/117 (30%), Positives = 53/117 (45%), Gaps = 5/117 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-FTSVRSTAHSLGRFTAILAFFFFA 59
           MQ  ++ +HL+VV  LV ++L Q S+  A G   +   + R  A++L R T ILA  FF 
Sbjct: 1   MQQVIIAIHLMVVTALVILVLYQKSEGGALGMGGSGVFTGRGQANALTRATGILATIFFI 60

Query: 60  TSIALGMISR--YTSTRYKDNMHRSLVDSI--KDQGNDNFGDGSSPKLDSVSAKSSS 112
           TSIAL ++      +    D       DSI  K+   ++ G           A   S
Sbjct: 61  TSIALTVLPAWERRAAGGDDWTKAIDQDSIKFKELKPEDKGAKPGEAAPVPEAGKDS 117


>gi|299771785|ref|YP_003733811.1| preprotein translocase subunit SecG [Acinetobacter sp. DR1]
 gi|298701873|gb|ADI92438.1| preprotein translocase subunit SecG [Acinetobacter sp. DR1]
          Length = 109

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M  F+++VH+I+ V ++ +IL+Q    +  G+S              +A+ L R TAIL 
Sbjct: 1   MHSFVLIVHIILAVLMIGLILVQHGKGADAGASFGGGGAATVFGASGSANFLTRLTAILT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS+ L + ++  +T       +S+  +   Q        ++PK   
Sbjct: 61  ALFFVTSLTLAVFAKKQTTEAYSL--KSVQTTAPIQTTSPETSPNAPKTGQ 109


>gi|50119650|ref|YP_048817.1| preprotein translocase subunit SecG [Pectobacterium atrosepticum
           SCRI1043]
 gi|49610176|emb|CAG73616.1| protein-export membrane protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 110

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/108 (24%), Positives = 45/108 (41%), Gaps = 8/108 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+V+ L+V +GLV +I++Q    +  G+S      +       +++ + R TAILA
Sbjct: 1   MYEALLVIFLLVSIGLVALIMLQQGKGADMGASFGAGASATLFGSSGSSNFMTRMTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF  S+ LG +S  T  +              +Q        +   
Sbjct: 61  TLFFIISLILGNLS--TLQKKGGAWDNLSQPEKVEQTTTPVAPSTPAS 106


>gi|162286751|ref|YP_001083397.2| preprotein translocase subunit SecG [Acinetobacter baumannii ATCC
           17978]
 gi|169634556|ref|YP_001708292.1| preprotein translocase subunit SecG [Acinetobacter baumannii SDF]
 gi|169797410|ref|YP_001715203.1| preprotein translocase subunit SecG [Acinetobacter baumannii AYE]
 gi|213155776|ref|YP_002317821.1| preprotein translocase iisp family auxillary membrane component
           [Acinetobacter baumannii AB0057]
 gi|215484849|ref|YP_002327086.1| preprotein translocase, SecG subunit [Acinetobacter baumannii
           AB307-0294]
 gi|239500934|ref|ZP_04660244.1| preprotein translocase subunit SecG [Acinetobacter baumannii AB900]
 gi|294837296|ref|ZP_06781979.1| preprotein translocase subunit SecG [Acinetobacter sp. 6013113]
 gi|294859186|ref|ZP_06796955.1| preprotein translocase subunit SecG [Acinetobacter sp. 6013150]
 gi|301345149|ref|ZP_07225890.1| preprotein translocase subunit SecG [Acinetobacter baumannii AB056]
 gi|301510690|ref|ZP_07235927.1| preprotein translocase subunit SecG [Acinetobacter baumannii AB058]
 gi|301594950|ref|ZP_07239958.1| preprotein translocase subunit SecG [Acinetobacter baumannii AB059]
 gi|169150337|emb|CAM88234.1| preprotein translocase IISP family, auxillary membrane component
           [Acinetobacter baumannii AYE]
 gi|169153348|emb|CAP02461.1| preprotein translocase IISP family, auxillary membrane component
           [Acinetobacter baumannii]
 gi|193076180|gb|ABO10795.2| preprotein translocase IISP family auxillary membrane component
           [Acinetobacter baumannii ATCC 17978]
 gi|213054936|gb|ACJ39838.1| preprotein translocase iisp family auxillary membrane component
           [Acinetobacter baumannii AB0057]
 gi|213987662|gb|ACJ57961.1| preprotein translocase, SecG subunit [Acinetobacter baumannii
           AB307-0294]
          Length = 109

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 50/111 (45%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M  F++VVH+I+ V ++ +IL+Q    +  G+S              + + L R TAIL 
Sbjct: 1   MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNFLTRVTAILT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS+ L + ++  +T       +++  +   Q        ++PK   
Sbjct: 61  ALFFVTSLTLAVFAKKQTTEAYSL--KTVQTTAPAQTTSPETSPNAPKTGQ 109


>gi|315122623|ref|YP_004063112.1| hypothetical protein CKC_04375 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496025|gb|ADR52624.1| hypothetical protein CKC_04375 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 126

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 64/107 (59%), Positives = 82/107 (76%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           MQIFLM  HLI+V+GLVC ILIQSSDSSAFG+SS+FTSVRS A+SL RFT+ILAF FF+T
Sbjct: 1   MQIFLMTAHLIIVIGLVCTILIQSSDSSAFGTSSSFTSVRSIAYSLARFTSILAFLFFST 60

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
           SIALG+ SRY S + K+++ +SL  +  ++ N N G+ +     SV 
Sbjct: 61  SIALGITSRYHSIKTKEDLRQSLASATNNKINYNSGNSNPNIDSSVP 107


>gi|258405668|ref|YP_003198410.1| preprotein translocase, SecG subunit [Desulfohalobium retbaense DSM
           5692]
 gi|257797895|gb|ACV68832.1| preprotein translocase, SecG subunit [Desulfohalobium retbaense DSM
           5692]
          Length = 118

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 46/116 (39%), Gaps = 4/116 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   ++ VH+IV V LV ++L+QS          GSS            L + TA  A  
Sbjct: 1   MNALILTVHIIVCVSLVTLVLLQSGKEGMGVIFGGSSGTVFGSSGAGGLLSKLTAGAATI 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
           F  TS+A   +S       ++++        +        + S+ +  S +  SSS
Sbjct: 61  FIITSLAFTYMSAQERQAPRESVVLEQPAQQQAPATAPGTEKSAGQEGSKAVNSSS 116


>gi|319901407|ref|YP_004161135.1| protein translocase subunit secG [Bacteroides helcogenes P 36-108]
 gi|319416438|gb|ADV43549.1| protein translocase subunit secG [Bacteroides helcogenes P 36-108]
          Length = 120

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 49/118 (41%), Gaps = 4/118 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M + L+++ +I  V +  ++LIQ+S        F SS+    VR T   L + T  LA  
Sbjct: 1   MYLLLIILMVIASVLMCFIVLIQNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWTLAAV 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
               SIA       +S +  D +        K    +     ++P+ ++ +A +   V
Sbjct: 61  MVVFSIASAYTIPSSSAKSGDVIMEQAQQEEKTNPYNMPVGTAAPQTEAPAAPTEQPV 118


>gi|91977295|ref|YP_569954.1| preprotein translocase subunit SecG [Rhodopseudomonas palustris
           BisB5]
 gi|91683751|gb|ABE40053.1| protein translocase subunit secG [Rhodopseudomonas palustris BisB5]
          Length = 128

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 53/126 (42%), Gaps = 6/126 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           MQ  ++V+HL++V+GL+  +L+Q S+    G        F S R TA+ L R TAILA  
Sbjct: 1   MQTVIIVIHLMLVLGLIGSVLLQKSEGGGLGVGGGGGGGFMSSRGTANLLTRTTAILAAG 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           FF TS+ L  ++ Y   R    +  S+                   LD++          
Sbjct: 61  FFVTSLLLSWLATY--NRKPTMLPTSVPTQQSPATPVPPVSQGGGLLDTLKQTDQQQNQQ 118

Query: 117 GKRSSS 122
               S 
Sbjct: 119 PAAPSP 124


>gi|93004902|ref|YP_579339.1| preprotein translocase subunit SecG [Psychrobacter cryohalolentis
           K5]
 gi|92392580|gb|ABE73855.1| protein translocase subunit secG [Psychrobacter cryohalolentis K5]
          Length = 102

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/101 (25%), Positives = 41/101 (40%), Gaps = 6/101 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
           M  F++ +H+IV + ++ +ILIQ    +  G      SS        TA+ L R TA+L 
Sbjct: 1   MFTFILALHIIVAIAMIGLILIQHGKGADAGASFGAGSSGTVFGAAGTANFLTRATAVLT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF 95
             FF TS+ L + +R  +                     N 
Sbjct: 61  AIFFITSMTLAVHARKQAEDQFRLDAPVSAPQTPRPLTQNP 101


>gi|83593223|ref|YP_426975.1| protein translocase subunit secG [Rhodospirillum rubrum ATCC 11170]
 gi|83576137|gb|ABC22688.1| protein translocase subunit secG [Rhodospirillum rubrum ATCC 11170]
          Length = 146

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 50/127 (39%), Gaps = 3/127 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV--RSTAHSLGRFTAILAFFFF 58
           M   ++V+HL++ + +V +IL+Q S+  A G       +  R   + L R T ILA  F 
Sbjct: 1   MITVILVIHLLIAIAMVTLILLQRSEGGALGIGGGGGFMTGRQAGNVLTRTTGILAAAFM 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD-SVSAKSSSSVVAG 117
            TS+ L +++      +   +    + SI         D           A  S +   G
Sbjct: 61  TTSMLLALLANKGEDGFSHILDSIDLPSINSLIGGESKDAPEAGTPVEAPAGDSGAAPVG 120

Query: 118 KRSSSRT 124
              +  +
Sbjct: 121 DAPAGDS 127


>gi|320536206|ref|ZP_08036254.1| preprotein translocase, SecG subunit [Treponema phagedenis F0421]
 gi|320146962|gb|EFW38530.1| preprotein translocase, SecG subunit [Treponema phagedenis F0421]
          Length = 128

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 42/121 (34%), Gaps = 10/121 (8%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDS----SAFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
            L+V  +I+   LV ++L+Q+ +       F   SN      + + L + T +L   FF 
Sbjct: 7   VLLVFFVIICFLLVGLVLLQNEEGDSLGGLFAGGSNSAFGSRSGNILTKTTYVLLALFFV 66

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           T+  L  +++  +      +      + + Q             +   A   +     K 
Sbjct: 67  TTFFLAWLNKSPA------IDDLQKAAQQQQTETATEWWKDNDTNQPDAAKPAEQTTPKA 120

Query: 120 S 120
            
Sbjct: 121 E 121


>gi|162147715|ref|YP_001602176.1| protein translocase subunit secG [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|209542339|ref|YP_002274568.1| preprotein translocase subunit SecG [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|161786292|emb|CAP55874.1| protein translocase subunit secG [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|209530016|gb|ACI49953.1| preprotein translocase, SecG subunit [Gluconacetobacter
          diazotrophicus PAl 5]
          Length = 111

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+ +HL V + L+  +LIQ S+    G        +F S R TA+ L R T++LA 
Sbjct: 1  MITVLLFLHLFVTLALIGTVLIQRSEGGGLGIGSSQGMGSFMSGRGTANLLTRTTSVLAG 60

Query: 56 FFFATSIALGMISRYTSTRYK 76
           F   S+ L +++R  ST   
Sbjct: 61 IFMILSLTLAVMNRGASTGSG 81


>gi|94968929|ref|YP_590977.1| protein translocase subunit secG [Candidatus Koribacter
          versatilis Ellin345]
 gi|94550979|gb|ABF40903.1| protein translocase subunit secG [Candidatus Koribacter
          versatilis Ellin345]
          Length = 99

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 39/97 (40%), Gaps = 6/97 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
          M   +  +H+ V   L+ V+L+QS  S+          S      R TA++L + T   A
Sbjct: 1  MIYLITTIHIAVCFFLIVVVLLQSGKSADLAAAFGGSGSQTAFGPRGTANALSKATTWSA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG 91
            F  TSI L +++   +      ++ +     +   
Sbjct: 61 VIFMLTSIILSVMAARHTGSAGSVLNGTKAAPTQQAP 97


>gi|317050329|ref|YP_004111445.1| preprotein translocase subunit SecG [Desulfurispirillum indicum
          S5]
 gi|316945413|gb|ADU64889.1| preprotein translocase, SecG subunit [Desulfurispirillum indicum
          S5]
          Length = 95

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 39/95 (41%), Gaps = 2/95 (2%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--VRSTAHSLGRFTAILAFFFF 58
          M   L+++H++  + ++  +LIQ    +  G      S      A+ L + TA  A  F 
Sbjct: 1  MTTLLVILHVLAAIAIIAFVLIQKGKGADMGMMGGSDSILGTGGANFLIKITAFAAVIFL 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
          AT + L M+     T     M  + V   + +  D
Sbjct: 61 ATGLILAMVQTRAYTEGGSVMDSAEVPQQQQRAAD 95


>gi|153009382|ref|YP_001370597.1| preprotein translocase subunit SecG [Ochrobactrum anthropi ATCC
           49188]
 gi|151561270|gb|ABS14768.1| preprotein translocase, SecG subunit [Ochrobactrum anthropi ATCC
           49188]
          Length = 153

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 58/116 (50%), Gaps = 2/116 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  ++V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVIIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
           ATS+ LG+++RY                 +       G G   +L   S++  ++ 
Sbjct: 61  ATSLILGIMARYGEKPTDILNRIPAATGSQSAPAGGNGGGILNQLGGESSRPDANQ 116


>gi|332111149|gb|EGJ11181.1| preprotein translocase subunit SecG [Rubrivivax benzoatilyticus
           JA2]
          Length = 127

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/119 (18%), Positives = 46/119 (38%), Gaps = 9/119 (7%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV------RSTAHSLGRFTAILAFF 56
             ++V+ ++  + ++ ++LIQ    +  G+S    S         +A+ L R TA  A  
Sbjct: 6   NLILVLQILSALAMIGLVLIQHGKGADMGASFGGGSSGSLFGATGSANFLSRSTAACATL 65

Query: 57  FFATSIALGMISRY---TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
           FF  ++AL  +S      S      + R+   +  +      G        +  A  ++
Sbjct: 66  FFCCTLALAFMSNSVRGPSQERGSVLDRAAPTAPAEPSAPATGAIPGALTPAAPASGAT 124


>gi|221134252|ref|ZP_03560557.1| hypothetical protein GHTCC_04935 [Glaciecola sp. HTCC2999]
          Length = 136

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/130 (22%), Positives = 53/130 (40%), Gaps = 6/130 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           +Q  L+V +LIV + L+ ++LIQ    +        G S+       + + L R TAILA
Sbjct: 2   LQEVLIVAYLIVALLLIGLVLIQQGKGADMGASLGGGGSNTVFGSSGSGNFLSRSTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ LG ++  +     +  +  +        +    D       ++S  S+ + 
Sbjct: 62  TLFFLISLLLGNLTASSEKAVDEWQNLEVPVVDAPVVDLPASDVPVATATTISDASTVND 121

Query: 115 VAGKRSSSRT 124
           V     +  T
Sbjct: 122 VPVSNENKET 131


>gi|223041484|ref|ZP_03611687.1| preprotein translocase subunit SecG [Actinobacillus minor 202]
 gi|223017742|gb|EEF16149.1| preprotein translocase subunit SecG [Actinobacillus minor 202]
          Length = 108

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/108 (25%), Positives = 47/108 (43%), Gaps = 6/108 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M   L +V+L+V + L+  ILIQ    +  G+S              +A+ L R TA+LA
Sbjct: 1   MLNILTIVYLLVAIALIGFILIQQGKGADAGASFGAGAAGTVFGSAGSANFLSRTTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FFA S+ +G ++ + +         S V    +Q      +   P+
Sbjct: 61  TIFFAISLVIGNLNSHQAKPTSQFDDLSGVQQKVEQPKTQTQNSDIPQ 108


>gi|187479131|ref|YP_787156.1| preprotein translocase subunit SecG [Bordetella avium 197N]
 gi|115423718|emb|CAJ50268.1| protein-export membrane protein [Bordetella avium 197N]
          Length = 142

 Score = 68.5 bits (166), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/137 (21%), Positives = 48/137 (35%), Gaps = 13/137 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+VV +I  + +V ++L+Q    +  GSS               A+ L R T   A
Sbjct: 4   MLTILLVVQVISALTIVVLVLLQQGKGADMGSSFGSGSAGSLFGASGAANFLSRSTKWAA 63

Query: 55  FFFFATSIALGMISRYTSTRY---KDNMHRSLVDSIKDQGNDNF--GDGSSPKLDSVS-- 107
             FFA++  L   S   ++        M      S+          G+ S P +      
Sbjct: 64  VVFFASTAFLAYASHKGNSSPAIESGVMQNFQDRSVPQAPGTPATGGEASVPAVPQAPGG 123

Query: 108 AKSSSSVVAGKRSSSRT 124
           A +   V A  +S    
Sbjct: 124 ASAVPQVPAAPQSPPAE 140


>gi|296532894|ref|ZP_06895559.1| preprotein translocase subunit SecG [Roseomonas cervicalis ATCC
          49957]
 gi|296266776|gb|EFH12736.1| preprotein translocase subunit SecG [Roseomonas cervicalis ATCC
          49957]
          Length = 89

 Score = 68.5 bits (166), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+V+HL V + L+ V+L+Q S+    G        +F + R TA+ L R TAILA 
Sbjct: 1  MMTVLLVLHLFVTLALIGVVLLQRSEGGGLGIGSSQGMGSFMTGRGTANLLTRTTAILAT 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLV 84
           F   ++A+ M+ R  + R          
Sbjct: 61 LFMGLALAMAMLGRGQAQRGSILDAPPPP 89


>gi|317153267|ref|YP_004121315.1| preprotein translocase subunit SecG [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316943518|gb|ADU62569.1| preprotein translocase, SecG subunit [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 115

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 37/102 (36%), Gaps = 4/102 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   ++V+H++  + L+  +++QS          G SS           L + TA LA  
Sbjct: 1   MDNLVIVIHVLACIFLIGAVMLQSGHEGMGVIFGGGSSTMFGSTGAGGILVKITAGLATV 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
           F  TS+   +I+    +     M +           D    G
Sbjct: 61  FLITSLTYNVITGNKVSTQDSLMLKGDGIVQPIVPADQQKPG 102


>gi|319638937|ref|ZP_07993695.1| preprotein translocase subunit SecG [Neisseria mucosa C102]
 gi|317399841|gb|EFV80504.1| preprotein translocase subunit SecG [Neisseria mucosa C102]
          Length = 119

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 45/111 (40%), Gaps = 9/111 (8%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA--------FGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5   KTLIWIINIISALFVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
           A FFFAT +A+  I  +++    D            +      + ++P   
Sbjct: 65  ATFFFATCMAMVYIHTHSNKHGLDFSD-VKQTQQAPKPATPAQNDTTPVAP 114


>gi|262280756|ref|ZP_06058539.1| preprotein translocase subunit SecG [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257656|gb|EEY76391.1| preprotein translocase subunit SecG [Acinetobacter calcoaceticus
           RUH2202]
          Length = 109

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/111 (22%), Positives = 51/111 (45%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M  F+++VH+I+ V ++ +IL+Q    +  G+S              +A+ L R TA+L 
Sbjct: 1   MHSFVLIVHIILAVLMIGLILVQHGKGADAGASFGGGGAATVFGASGSANFLTRLTAVLT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS+ L + ++  ++       +++  +   Q        ++PK   
Sbjct: 61  ALFFVTSLTLAVFAKKQTSEAYSL--KTVQTTAPIQTTSPETSPNAPKTSQ 109


>gi|240948661|ref|ZP_04753033.1| preprotein translocase subunit SecG [Actinobacillus minor NM305]
 gi|240296877|gb|EER47455.1| preprotein translocase subunit SecG [Actinobacillus minor NM305]
          Length = 108

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/108 (25%), Positives = 47/108 (43%), Gaps = 6/108 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M   L +V+L+V + L+  ILIQ    +  G+S              +A+ L R TA+LA
Sbjct: 1   MLNILTIVYLLVAIALIGFILIQQGKGADAGASFGAGAAGTVFGSAGSANFLSRTTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FFA S+ +G ++ + +         S V    +Q      +   P+
Sbjct: 61  TVFFAISLVIGNLNSHQAKPTSQFDDLSGVQQKVEQPKTQTQNSDIPQ 108


>gi|213422395|ref|ZP_03355461.1| hypothetical protein Salmonentericaenterica_33530 [Salmonella
          enterica subsp. enterica serovar Typhi str. E01-6750]
          Length = 82

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
          M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 4  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLA 63

Query: 55 FFFFATSIALGMISRYTST 73
            FF  S+ LG I+   + 
Sbjct: 64 TLFFIISLVLGNINSNKTN 82


>gi|145589235|ref|YP_001155832.1| preprotein translocase, SecG subunit [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047641|gb|ABP34268.1| protein translocase subunit secG [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 114

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 19/109 (17%), Positives = 39/109 (35%), Gaps = 6/109 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAF 55
           +  L+V+ +I  + ++ ++L+Q    +  G+      S +      +A+ L   TAI A 
Sbjct: 5   KTLLIVLQVISALSVILLVLLQQGKGADMGAAFGSGASGSLFGASGSANFLSHATAIFAA 64

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
            FF  +I +  +                  +          D S P + 
Sbjct: 65  VFFMCTIGITWVGNKKEVNPGVLSGTVAPAATPAAPVAPAQDPSKPAVP 113


>gi|295676036|ref|YP_003604560.1| preprotein translocase, SecG subunit [Burkholderia sp. CCGE1002]
 gi|295435879|gb|ADG15049.1| preprotein translocase, SecG subunit [Burkholderia sp. CCGE1002]
          Length = 131

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FFAT++AL  +  Y        +
Sbjct: 64 ALFFATTLALTYLGAYHVKPSAGVL 88


>gi|309972398|gb|ADO95599.1| Protein-export membrane protein SecG [Haemophilus influenzae
          R2846]
          Length = 113

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 6/88 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRS 82
            FF  ++ LG ++ +     K      
Sbjct: 61 TVFFVIALVLGNMNSHKGNVQKGAFDDL 88


>gi|113461454|ref|YP_719523.1| preprotein translocase subunit SecG [Haemophilus somnus 129PT]
 gi|170718439|ref|YP_001783657.1| preprotein translocase subunit SecG [Haemophilus somnus 2336]
 gi|112823497|gb|ABI25586.1| protein translocase subunit secG [Haemophilus somnus 129PT]
 gi|168826568|gb|ACA31939.1| preprotein translocase, SecG subunit [Haemophilus somnus 2336]
          Length = 114

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 44/114 (38%), Gaps = 6/114 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M   L++ +L++ + L+  ILIQ    +  G+S                + L R TAILA
Sbjct: 1   MYQVLLIAYLVIAIVLIGFILIQQGKGANAGASFGGGASGTVFGSAGAGNFLSRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FFA S+ +G I+ +++             + + Q           K   +  
Sbjct: 61  TAFFAISLLIGNINSHSNNVKSGKFDDLSKVAEQVQEKQQSIPTPDTKNSDIPQ 114


>gi|114764013|ref|ZP_01443254.1| preprotein translocase, SecG subunit [Pelagibaca bermudensis
           HTCC2601]
 gi|114543605|gb|EAU46619.1| preprotein translocase, SecG subunit [Roseovarius sp. HTCC2601]
          Length = 127

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  +++VHL++ + L+  +L+Q S+    G        S R+ A +LG+ T ILA  F 
Sbjct: 1   MQNVILIVHLLLALSLIGAVLLQRSEGGGLGMGGGGGAMSQRAAATALGKVTWILAIGFI 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
            TSI L +++   ++            S         G+  +  L    + S S      
Sbjct: 61  VTSITLTILAAQDASGVSVMDRLGGSGSAPATEQTAPGEIDTDALLPPPSASDSETAPDA 120

Query: 119 RSSSR 123
               R
Sbjct: 121 PLVPR 125


>gi|322419406|ref|YP_004198629.1| preprotein translocase subunit SecG [Geobacter sp. M18]
 gi|320125793|gb|ADW13353.1| preprotein translocase, SecG subunit [Geobacter sp. M18]
          Length = 131

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 38/104 (36%), Gaps = 8/104 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
           M I L+ +H+IV + L+ V+L+QS   +  G       S +          + + T   A
Sbjct: 1   MTILLVTLHVIVCLALIVVVLLQSGKGAEMGASFGASGSQSVFGAGGGNTFMSKLTTYAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
             F  TS++L  +S          M ++        G       
Sbjct: 61  IIFMLTSLSLAFVSGKGG--GSSIMSKAPKAKPAPMGGLPLQQP 102


>gi|167585970|ref|ZP_02378358.1| hypothetical protein BuboB_11570 [Burkholderia ubonensis Bu]
          Length = 116

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV ++  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQVLAALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRATAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL  +  Y ST     +
Sbjct: 64 TIFFVATLALTYLGSYKSTPSAGVL 88


>gi|329119695|ref|ZP_08248376.1| preprotein translocase subunit SecG [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464292|gb|EGF10596.1| preprotein translocase subunit SecG [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 112

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/107 (20%), Positives = 43/107 (40%), Gaps = 8/107 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA--------FGSSSNFTSVRSTAHSLGRFTAIL 53
           +  +M+++    + ++ ++L+Q    +          GS+        + + L R T I 
Sbjct: 5   KTLIMILNGFAGLAIILLVLMQHGKGADAGASFASGSGSAQGVFGSAGSGNFLSRSTYIA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
           A  FFAT +AL  I  ++     D  +      +K Q     G+G  
Sbjct: 65  ATVFFATCLALTYIYSHSGKGKLDFSNVQQSAPVKTQPAAPAGNGEV 111


>gi|118595100|ref|ZP_01552447.1| secretion protein SecG [Methylophilales bacterium HTCC2181]
 gi|118440878|gb|EAV47505.1| secretion protein SecG [Methylophilales bacterium HTCC2181]
          Length = 111

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/110 (21%), Positives = 50/110 (45%), Gaps = 9/110 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M+  +++VH++  +G++ ++LIQ    +  G++       +   V+ +A+ L R T+I  
Sbjct: 1   MENLILIVHILASLGVIGLVLIQHGKGADAGAAFGGGNSGSVFGVQGSANFLSRATSICV 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNM---HRSLVDSIKDQGNDNFGDGSSP 101
             FF TSIAL +++                    S+ ++ +   G    P
Sbjct: 61  TTFFCTSIALAVVASNKHGNSSVIDISPENDPSLSVSEESDTPLGAQDIP 110


>gi|332090680|gb|EGI95774.1| preprotein translocase, SecG subunit [Shigella boydii 3594-74]
          Length = 105

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 6/101 (5%)

Query: 6   MVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFA 59
           MVV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA  FF 
Sbjct: 1   MVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFFI 60

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
            S+ LG I+   + +  +  + S     +          +S
Sbjct: 61  ISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTS 101


>gi|257456480|ref|ZP_05621676.1| preprotein translocase subunit SecG [Treponema vincentii ATCC
           35580]
 gi|257446140|gb|EEV21187.1| preprotein translocase subunit SecG [Treponema vincentii ATCC
           35580]
          Length = 132

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 43/124 (34%), Gaps = 7/124 (5%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDS----SAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           L+V  +IV   +V ++L+Q+ +       F   SN      + + L R T  L   FF  
Sbjct: 8   LLVFFIIVAFLIVGLVLLQNEEGDSLGGLFSGGSNSAFGSRSGNILTRATYTLITLFFVV 67

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQ---GNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           +  L  +++           +        +         + +    ++ +   SS   A 
Sbjct: 68  TFFLAWLNKTPGDSGLQQDAQLQQAETATEWWKEGTPNSNETGNTENTETVPQSSEGTAA 127

Query: 118 KRSS 121
             +S
Sbjct: 128 DNTS 131


>gi|293610132|ref|ZP_06692433.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827364|gb|EFF85728.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325124305|gb|ADY83828.1| preprotein translocase subunit SecG [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 109

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 50/111 (45%), Gaps = 8/111 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M  F+++VH+I+ V ++ +IL+Q    +  G+S              + + L R TAIL 
Sbjct: 1   MHSFVLIVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNFLTRLTAILT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             FF TS+ L + ++  +T       +++  +   Q        ++PK   
Sbjct: 61  ALFFVTSLTLAVFAKKQTTDAYSL--KTVQTTAPVQTTSPETSPNAPKSSQ 109


>gi|261379458|ref|ZP_05984031.1| preprotein translocase, SecG subunit [Neisseria subflava NJ9703]
 gi|284797913|gb|EFC53260.1| preprotein translocase, SecG subunit [Neisseria subflava NJ9703]
          Length = 119

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 21/111 (18%), Positives = 45/111 (40%), Gaps = 9/111 (8%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA--------FGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5   KTLIWIINIISALFVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
           A FFFAT +A+  I  ++S    D            +      + ++P   
Sbjct: 65  ATFFFATCMAMVYIHTHSSKHGLDFSD-VKQTQQAPKPATPAQNNTTPVAP 114


>gi|257459906|ref|ZP_05625012.1| preprotein translocase, SecG subunit [Campylobacter gracilis
           RM3268]
 gi|257442758|gb|EEV17895.1| preprotein translocase, SecG subunit [Campylobacter gracilis
           RM3268]
          Length = 176

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 46/128 (35%), Gaps = 10/128 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M    +V+ ++  V +   +L+Q S      +  GS+ +    +  A  L +FTA +   
Sbjct: 1   MTTLFLVLQVVFAVIITISVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTAAMGIL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           F   ++ L     Y        + R  +    +         + P + S+ A  +    A
Sbjct: 61  FVINTLVLAYF--YQQDAKSSVVDRVKI----EANATKSVPNAVPGVPSIPASGAKPNFA 114

Query: 117 GKRSSSRT 124
              + S +
Sbjct: 115 PASTESNS 122


>gi|158520515|ref|YP_001528385.1| preprotein translocase, SecG subunit [Desulfococcus oleovorans
           Hxd3]
 gi|158509341|gb|ABW66308.1| preprotein translocase, SecG subunit [Desulfococcus oleovorans
           Hxd3]
          Length = 111

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 17/113 (15%), Positives = 41/113 (36%), Gaps = 8/113 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M I + ++H+IV   L+ ++L+Q+   +  G++               +  L + T   A
Sbjct: 1   MTILITIIHVIVCFALILIVLLQTGKGAGMGATFGGGGSQTLFGSTGGSTFLSKATTGAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             F  T ++L  +S +   +    M    + + +          +     +  
Sbjct: 61  VVFMVTCLSLAYVSTHR--QPASIMEGEKIPATQPAPEQTLPPDAPAGEPAAD 111


>gi|315919822|ref|ZP_07916062.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313693697|gb|EFS30532.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 130

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 49/126 (38%), Gaps = 4/126 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M +  +++ +I  + +  ++LIQ+S        F SS+    VR T   L + T  LA F
Sbjct: 1   MYLLFVILMVIAALLMCFIVLIQNSKGGGLASGFSSSNAIMGVRKTTDFLEKATWGLAIF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               SIA   +   ++      + ++  +   +  N   G  +       +   ++   A
Sbjct: 61  MVVMSIATAYVVPRSAVVKDAVLEQAQKEQQTNPYNLPAGTAAPQTEAPATNAPATETPA 120

Query: 117 GKRSSS 122
              + +
Sbjct: 121 PAETPA 126


>gi|15616984|ref|NP_240197.1| preprotein translocase subunit SecG [Buchnera aphidicola str. APS
          (Acyrthosiphon pisum)]
 gi|219681737|ref|YP_002468123.1| protein-export membrane protein SecG [Buchnera aphidicola str. 5A
          (Acyrthosiphon pisum)]
 gi|219682292|ref|YP_002468676.1| protein-export membrane protein SecG [Buchnera aphidicola str.
          Tuc7 (Acyrthosiphon pisum)]
 gi|257471437|ref|ZP_05635436.1| protein-export membrane protein SecG [Buchnera aphidicola str.
          LSR1 (Acyrthosiphon pisum)]
 gi|11134551|sp|P57460|SECG_BUCAI RecName: Full=Protein-export membrane protein secG
 gi|25306325|pir||C84974 protein-export membrane protein secG [imported] - Buchnera sp.
          (strain APS)
 gi|10039049|dbj|BAB13083.1| protein-export membrane protein secG [Buchnera aphidicola str.
          APS (Acyrthosiphon pisum)]
 gi|219622025|gb|ACL30181.1| protein-export membrane protein SecG [Buchnera aphidicola str.
          Tuc7 (Acyrthosiphon pisum)]
 gi|219624580|gb|ACL30735.1| protein-export membrane protein SecG [Buchnera aphidicola str. 5A
          (Acyrthosiphon pisum)]
 gi|311086116|gb|ADP66198.1| preprotein translocase subunit SecG [Buchnera aphidicola str.
          LL01 (Acyrthosiphon pisum)]
 gi|311086689|gb|ADP66770.1| preprotein translocase subunit SecG [Buchnera aphidicola str.
          TLW03 (Acyrthosiphon pisum)]
 gi|311087274|gb|ADP67354.1| preprotein translocase subunit SecG [Buchnera aphidicola str.
          JF99 (Acyrthosiphon pisum)]
 gi|311087788|gb|ADP67867.1| preprotein translocase subunit SecG [Buchnera aphidicola str.
          JF98 (Acyrthosiphon pisum)]
          Length = 109

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 33/80 (41%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M +F ++V + +   L+  IL+Q          S+      F +   T + + +   ILA
Sbjct: 1  MYLFFLIVFIFISFSLIFFILLQPGKGLNNTVHSHTKNNIKFFNSIGTNNFITKIIKILA 60

Query: 55 FFFFATSIALGMISRYTSTR 74
          FFF   SI L  I+      
Sbjct: 61 FFFLLISIILCNINSKRIDS 80


>gi|225075901|ref|ZP_03719100.1| hypothetical protein NEIFLAOT_00924 [Neisseria flavescens
           NRL30031/H210]
 gi|241759042|ref|ZP_04757154.1| preprotein translocase subunit SecG [Neisseria flavescens SK114]
 gi|224952757|gb|EEG33966.1| hypothetical protein NEIFLAOT_00924 [Neisseria flavescens
           NRL30031/H210]
 gi|241320863|gb|EER57096.1| preprotein translocase subunit SecG [Neisseria flavescens SK114]
          Length = 119

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 22/111 (19%), Positives = 45/111 (40%), Gaps = 9/111 (8%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA--------FGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + ++ ++L+Q    +          GS+         A+ L R TAI 
Sbjct: 5   KTLIWIINIISALAVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAIA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
           A FFFAT +A+  I  ++S    D            +      + ++P   
Sbjct: 65  ATFFFATCMAMVYIHTHSSKHGLDFSD-VKQTQQAPKPATPAQNNTTPVAP 114


>gi|304310504|ref|YP_003810102.1| Protein-export membrane protein [gamma proteobacterium HdN1]
 gi|301796237|emb|CBL44445.1| Protein-export membrane protein [gamma proteobacterium HdN1]
          Length = 169

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 49/131 (37%), Gaps = 24/131 (18%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++++ ++V + +  +ILIQ    +  G+S              + + L   TA+LA
Sbjct: 2   LETAVLILLIVVALIINGLILIQQGKGADMGASFGSGASNTVFGSAGSGNFLTHSTAVLA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF   +ALG  +   S                        D S+P  +S  A   + V
Sbjct: 62  AVFFVCCLALGWFAHNHSASRGSV------------------DFSAPATESKPAPIETDV 103

Query: 115 VAGKRSSSRTK 125
              K   + T+
Sbjct: 104 PRVKNDDASTE 114


>gi|239832025|ref|ZP_04680354.1| preprotein translocase, SecG subunit [Ochrobactrum intermedium LMG
           3301]
 gi|239824292|gb|EEQ95860.1| preprotein translocase, SecG subunit [Ochrobactrum intermedium LMG
           3301]
          Length = 153

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 58/116 (50%), Gaps = 2/116 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV V+LIQ S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
           ATS+ LG+++RY                 +       G G   +L   S++  ++ 
Sbjct: 61  ATSLILGIMARYGEKPTDILNRIPAATGSQTTPAGGNGGGILNQLGGESSRPDANQ 116


>gi|198284347|ref|YP_002220668.1| preprotein translocase subunit SecG [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218666041|ref|YP_002427009.1| preprotein translocase, SecG subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198248868|gb|ACH84461.1| preprotein translocase, SecG subunit [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218518254|gb|ACK78840.1| preprotein translocase, SecG subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 133

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 26/126 (20%), Positives = 42/126 (33%), Gaps = 9/126 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+VV +I+ + LV ++LIQ    +        G S      R   + L   TA++ 
Sbjct: 1   MYTVLLVVQIIICIVLVGLVLIQKGQGADIGAVFGGGGSQTIFGARGAGNFLSHTTAVIG 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  S+ L  +S               + S                     A ++S V
Sbjct: 61  ALFFLNSLGLAYLS---DHSSSSVFSGIALPSKAPVTTSAPVAPIVAAPAQSVASAASPV 117

Query: 115 VAGKRS 120
            +   S
Sbjct: 118 TSAASS 123


>gi|148827641|ref|YP_001292394.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittGG]
 gi|148718883|gb|ABR00011.1| protein-export membrane protein [Haemophilus influenzae PittGG]
          Length = 113

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 6/88 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRS 82
            FF  ++ LG ++ +     K      
Sbjct: 61 TAFFVIALVLGNMNSHKGNVQKGTFDDL 88


>gi|16272393|ref|NP_438606.1| preprotein translocase subunit SecG [Haemophilus influenzae Rd
          KW20]
 gi|260580492|ref|ZP_05848320.1| preprotein translocase SecG subunit [Haemophilus influenzae RdAW]
 gi|1173417|sp|P44713|SECG_HAEIN RecName: Full=Protein-export membrane protein secG
 gi|1573421|gb|AAC22104.1| protein-export membrane protein (secG) [Haemophilus influenzae Rd
          KW20]
 gi|260092834|gb|EEW76769.1| preprotein translocase SecG subunit [Haemophilus influenzae RdAW]
          Length = 112

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 6/88 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRS 82
            FF  ++ LG ++ +     K      
Sbjct: 61 TAFFVIALVLGNMNSHKGNVQKGTFDDL 88


>gi|68249045|ref|YP_248157.1| preprotein translocase subunit SecG [Haemophilus influenzae
          86-028NP]
 gi|145628816|ref|ZP_01784616.1| protein-export membrane protein [Haemophilus influenzae 22.1-21]
 gi|68057244|gb|AAX87497.1| protein-export membrane protein SecG [Haemophilus influenzae
          86-028NP]
 gi|144979286|gb|EDJ88972.1| protein-export membrane protein [Haemophilus influenzae 22.1-21]
 gi|301169145|emb|CBW28742.1| preprotein translocase membrane subunit [Haemophilus influenzae
          10810]
 gi|309750139|gb|ADO80123.1| Protein-export membrane protein SecG [Haemophilus influenzae
          R2866]
          Length = 113

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 6/88 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRS 82
            FF  ++ LG ++ +     K      
Sbjct: 61 TAFFVIALVLGNMNSHKGNVQKGTFDDL 88


>gi|298369758|ref|ZP_06981075.1| preprotein translocase, SecG subunit [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298282315|gb|EFI23803.1| preprotein translocase, SecG subunit [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 120

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 46/115 (40%), Gaps = 10/115 (8%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA--------FGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + ++ ++L+Q    +          GS+         A+ L   TAI 
Sbjct: 5   KTVIWIINIISALAVIVLVLLQHGKGADAGATFGSGTGSAQGVFGSGGNANFLSHATAIA 64

Query: 54  AFFFFATSIALGMISRYTSTRYK--DNMHRSLVDSIKDQGNDNFGDGSSPKLDSV 106
           A FFFAT +A+  I   T+       N+ +SL    +    +     + P     
Sbjct: 65  ATFFFATCMAMVYIHSNTTRHGLDFSNVKQSLPAKTQQAPTNGGKTDTVPAAPKQ 119


>gi|149914502|ref|ZP_01903032.1| adenylosuccinate synthetase [Roseobacter sp. AzwK-3b]
 gi|149811295|gb|EDM71130.1| adenylosuccinate synthetase [Roseobacter sp. AzwK-3b]
          Length = 121

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 52/116 (44%), Gaps = 4/116 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA---HSLGRFTAILAFFF 57
           M+  ++ VHL++ + L+ V+L+Q S+    G         +      +LG+ T ILA  F
Sbjct: 1   MENVVLTVHLLLALALIGVVLLQRSEGGGLGMGGGGGGAMTGRAAATALGKVTWILAIAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             TS+ L +++   +      + R     ++++  D    G+   L   SA  ++ 
Sbjct: 61  IITSLTLTVLAAQKAG-GSSVLDRITDAPLREEPADPVLPGTGGDLLPPSADDTAP 115


>gi|187923339|ref|YP_001894981.1| preprotein translocase subunit SecG [Burkholderia phytofirmans
           PsJN]
 gi|187714533|gb|ACD15757.1| preprotein translocase, SecG subunit [Burkholderia phytofirmans
           PsJN]
          Length = 125

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 54/121 (44%), Gaps = 6/121 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
           ++  ++VV L+  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 4   LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF T++ L  +  Y +      +  ++   +          GS+    S ++  ++ V
Sbjct: 64  AVFFVTTLTLTYLGAYRAKPSAGVLGAAVTAPVAASAASAPAAGSAVLPASAASVPATDV 123

Query: 115 V 115
            
Sbjct: 124 P 124


>gi|152979365|ref|YP_001344994.1| preprotein translocase subunit SecG [Actinobacillus succinogenes
           130Z]
 gi|150841088|gb|ABR75059.1| preprotein translocase, SecG subunit [Actinobacillus succinogenes
           130Z]
          Length = 117

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 48/117 (41%), Gaps = 6/117 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+ V+LI+ + ++ +ILIQ    +        G+S        +A+ L R T++LA
Sbjct: 1   MYSVLLFVYLIISIVMIGLILIQQGKGADTGASFGGGASGTVFGSAGSANFLSRSTSLLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
             FF  SI +G I+ + +   +         + + +         + +  +     +
Sbjct: 61  VAFFVISIVIGNINAHRNNVEQGKFDDLSQAAQQVEQQQQKTVAPAVENKNADIPQN 117


>gi|187251586|ref|YP_001876068.1| preprotein translocase subunit SecG [Elusimicrobium minutum
          Pei191]
 gi|186971746|gb|ACC98731.1| Pre-protein translocase, SecG subunit [Elusimicrobium minutum
          Pei191]
          Length = 100

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 42/98 (42%), Gaps = 6/98 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
          M   ++V+H +  + L+  +L+QS   SA G            +  +  + L RFTA++A
Sbjct: 1  MYTLILVIHFLACILLILSVLMQSGKGSAAGIFGGGGGSDALFAGPTAFNFLNRFTAVVA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
             F TSI L +++         +  +  V   +   N
Sbjct: 61 ITLFCTSITLTVLTAKRGASSVVDNVKVPVTQTQPVNN 98


>gi|145634558|ref|ZP_01790267.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittAA]
 gi|229844395|ref|ZP_04464535.1| preprotein translocase subunit SecG [Haemophilus influenzae
          6P18H1]
 gi|145268103|gb|EDK08098.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittAA]
 gi|229812644|gb|EEP48333.1| preprotein translocase subunit SecG [Haemophilus influenzae
          6P18H1]
          Length = 113

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 6/88 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRS 82
            FF  ++ LG ++ +     K      
Sbjct: 61 TAFFVIALVLGNMNSHKGNVQKGAFDDL 88


>gi|145632690|ref|ZP_01788424.1| protein-export membrane protein [Haemophilus influenzae 3655]
 gi|144986885|gb|EDJ93437.1| protein-export membrane protein [Haemophilus influenzae 3655]
          Length = 113

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 6/88 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGADAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRS 82
            FF  ++ LG ++ +     K      
Sbjct: 61 TAFFVIALVLGNMNSHKGNVQKGAFDDL 88


>gi|158424692|ref|YP_001525984.1| preprotein translocase SecG subunit [Azorhizobium caulinodans ORS
           571]
 gi|158331581|dbj|BAF89066.1| preprotein translocase SecG subunit [Azorhizobium caulinodans ORS
           571]
          Length = 138

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 5/107 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
           MQ  L+V+HL+VV+ L+ V+LIQ S+    G         F + R TA+ L R TA+LA 
Sbjct: 1   MQTVLIVIHLLVVLALIGVVLIQRSEGGGLGIGGGGGGGGFFTARGTANVLTRATAVLAA 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
            FF TS+ L +++ +           S           +  D   P+
Sbjct: 61  LFFITSLGLTILAGWGRAPTSILGPSSGQSGPSVPTGGSILDQIRPQ 107


>gi|115378716|ref|ZP_01465863.1| preprotein translocase, SecG subunit [Stigmatella aurantiaca
          DW4/3-1]
 gi|310822473|ref|YP_003954831.1| preprotein translocase subunit SecG [Stigmatella aurantiaca
          DW4/3-1]
 gi|115364266|gb|EAU63354.1| preprotein translocase, SecG subunit [Stigmatella aurantiaca
          DW4/3-1]
 gi|309395545|gb|ADO73004.1| Preprotein translocase, SecG [Stigmatella aurantiaca DW4/3-1]
          Length = 143

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
          M  F  +VH+++ V ++ VIL+Q    +        G++++    R     L + T + A
Sbjct: 1  MLTFFTIVHVLLCVFMIFVILLQPGKDAGMGSALGGGAATSAFGGRGAVTFLSKLTGVCA 60

Query: 55 FFFFATSIALGMISRYTS 72
            FF TS+ L  +   +S
Sbjct: 61 ALFFLTSLGLSFVGLRSS 78


>gi|145640413|ref|ZP_01795997.1| protein-export membrane protein [Haemophilus influenzae R3021]
 gi|319898034|ref|YP_004136231.1| protein-export membrane protein secg [Haemophilus influenzae
          F3031]
 gi|145274999|gb|EDK14861.1| protein-export membrane protein [Haemophilus influenzae 22.4-21]
 gi|317433540|emb|CBY81924.1| protein-export membrane protein SecG [Haemophilus influenzae
          F3031]
          Length = 113

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 6/88 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRS 82
            FF  ++ LG ++ +     K      
Sbjct: 61 TAFFVIALVLGNMNSHKGNVQKGAFDDL 88


>gi|163760081|ref|ZP_02167164.1| protein-export membrane protein [Hoeflea phototrophica DFL-43]
 gi|162282480|gb|EDQ32768.1| protein-export membrane protein [Hoeflea phototrophica DFL-43]
          Length = 129

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 3/125 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++V+ LV ++L+Q S+    G      F S R  A++L R T ILA  FF
Sbjct: 1   MQTVLIVIHLMIVLALVGIVLVQRSEGGGLGIGGGSGFMSARGAANALTRTTGILAAAFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
            TS+ALG+++RY      D + +  V +           G +P   + +  ++  + A  
Sbjct: 61  VTSLALGILARY-GDSPTDIIDQISVPTQGTGSGVLDQLGGAPTPAAPAQGAAGDIPAAP 119

Query: 119 RSSSR 123
            + S 
Sbjct: 120 AAPSD 124


>gi|319794669|ref|YP_004156309.1| preprotein translocase, secg subunit [Variovorax paradoxus EPS]
 gi|315597132|gb|ADU38198.1| preprotein translocase, SecG subunit [Variovorax paradoxus EPS]
          Length = 136

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 22/102 (21%), Positives = 41/102 (40%), Gaps = 6/102 (5%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILAFF 56
             L+ V ++  + ++ +IL+Q    +  G      S+ +      +A+ L R TA+LA  
Sbjct: 6   NLLVGVQMLAALAMIGLILVQHGKGADMGAAFGSGSAGSLFGASGSANFLSRTTAVLAAV 65

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
           FFA ++ L   S          + R+ V +         G  
Sbjct: 66  FFACTLLLAYFSHARPAGGGSLLERAAVGTPAAPAKPASGAA 107


>gi|303246610|ref|ZP_07332888.1| preprotein translocase, SecG subunit [Desulfovibrio fructosovorans
           JJ]
 gi|302491950|gb|EFL51828.1| preprotein translocase, SecG subunit [Desulfovibrio fructosovorans
           JJ]
          Length = 130

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 21/127 (16%), Positives = 42/127 (33%), Gaps = 10/127 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   ++ VH++  V ++ ++L+QS          G S +          L + TA+    
Sbjct: 1   MTTLIITVHVLACVAVIVLVLLQSGKEGMGVIFGGGSQSVFGSTGAGGLLVKLTALFGAI 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHR------SLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
           F  TS+A  + +       K  M        +    +  +   +         + V AK 
Sbjct: 61  FLITSLAYNVYTGSHERNAKSVMIDASGAPIAPPAGVAPEATKDAQPKKGVTFEDVPAKQ 120

Query: 111 SSSVVAG 117
           +      
Sbjct: 121 APQKPDA 127


>gi|218779204|ref|YP_002430522.1| preprotein translocase, SecG subunit [Desulfatibacillum
           alkenivorans AK-01]
 gi|218760588|gb|ACL03054.1| preprotein translocase, SecG subunit [Desulfatibacillum
           alkenivorans AK-01]
          Length = 155

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 39/101 (38%), Gaps = 6/101 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M I + V+H++V + L+ ++L+Q+   +        GSS         A  L + T + A
Sbjct: 7   MTILVTVIHIVVCIALILIVLLQTGKGADMGAAFGGGSSQTVFGSSGPAGFLSKGTTVAA 66

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF 95
             F  TS+ L + S     R          + +      + 
Sbjct: 67  VLFMCTSLFLAIPSDSAMERRAVAPEPITQEEMDQAMPTDV 107


>gi|296314574|ref|ZP_06864515.1| preprotein translocase, SecG subunit [Neisseria polysaccharea ATCC
           43768]
 gi|296838667|gb|EFH22605.1| preprotein translocase, SecG subunit [Neisseria polysaccharea ATCC
           43768]
          Length = 116

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 45/109 (41%), Gaps = 8/109 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA--------FGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5   KTLIWIINIISALAVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
           A FFFAT +A+  I  +T+    D  +           N+       P+
Sbjct: 65  ATFFFATCMAMVYIHTHTTKHGLDFSNVQQTQQAPKPVNNTEPSAPVPQ 113


>gi|255261282|ref|ZP_05340624.1| preprotein translocase subunit SecG [Thalassiobium sp. R2A62]
 gi|255103617|gb|EET46291.1| preprotein translocase subunit SecG [Thalassiobium sp. R2A62]
          Length = 121

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 49/114 (42%), Gaps = 5/114 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
           M+  +++VHL++ + L+  +L+Q S+    G           S RS A +LG+ T ILA 
Sbjct: 1   MENVVLIVHLLLALSLIGAVLLQRSEGGGLGMGGGGGGGGAMSNRSAATALGKVTWILAI 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
            F  TS+AL +I+   S             ++    +   GD   P     S  
Sbjct: 61  AFICTSVALTIIAASNSAGSSVIDRLGDAPAVSGDADVPEGDSLLPPSADDSTP 114


>gi|152991580|ref|YP_001357302.1| preprotein translocase subunit G [Nitratiruptor sp. SB155-2]
 gi|151423441|dbj|BAF70945.1| preprotein translocase subunit G [Nitratiruptor sp. SB155-2]
          Length = 113

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 22/113 (19%), Positives = 40/113 (35%), Gaps = 5/113 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L ++ +++ + L  VIL+Q S      +  GS+ +    +     L R T  LA  
Sbjct: 1   MIKVLFILQIVLAIILTIVILLQKSSSIGLGAYSGSNESVFGAKGPQGFLARLTFFLATV 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
           F   +I LG +     T+   +  +               +  S  +    A 
Sbjct: 61  FVFNTILLGYLYNKNYTKSVVDTIKVQKTVPIPTVPTPITEQKS-NVPEAPAA 112


>gi|224438527|ref|ZP_03659447.1| preprotein translocase subunit SecG [Helicobacter cinaedi CCUG
           18818]
 gi|313144954|ref|ZP_07807147.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
 gi|313129985|gb|EFR47602.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
          Length = 131

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 50/128 (39%), Gaps = 4/128 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L VV +++ + +  ++L+Q S      +  GS+ +    +  A  L +FT  L   
Sbjct: 1   MTTTLFVVQIVLAIFITIMVLLQKSSSIGLGAYSGSNESVFGAKGPAGFLAKFTMFLGLL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           F   +IAL       + +   +   S       Q  D   + ++  +D  +A ++  V  
Sbjct: 61  FVLNTIALSYSYNKQTEKSILDSLPSTQAPTTPQTADTATNPNAFIVDENAAPTAPLVAP 120

Query: 117 GKRSSSRT 124
              S +  
Sbjct: 121 LDSSQNNQ 128


>gi|153809264|ref|ZP_01961932.1| hypothetical protein BACCAC_03576 [Bacteroides caccae ATCC 43185]
 gi|149128034|gb|EDM19255.1| hypothetical protein BACCAC_03576 [Bacteroides caccae ATCC 43185]
          Length = 132

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 48/114 (42%), Gaps = 4/114 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M +  +++ +I  + +  ++LIQ+S        F SS+    VR T   L + T  LA F
Sbjct: 1   MYLLFVILMVIAALLMCFIVLIQNSKGGGLASGFSSSNAIMGVRKTTDFLEKATWGLAIF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
               SIA   +  ++S      + ++  +   +  N   G  +     +  A+S
Sbjct: 61  MVIMSIATAYVVPHSSAVKDAVLEQAQKEQQTNPYNLPAGTAAPQTDATAPAES 114


>gi|257453565|ref|ZP_05618855.1| preprotein translocase subunit SecG [Enhydrobacter aerosaccus
          SK60]
 gi|257449023|gb|EEV23976.1| preprotein translocase subunit SecG [Enhydrobacter aerosaccus
          SK60]
          Length = 106

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
          M   ++VVH+IV + ++ +IL+Q    +  G       S+       +A+ L R TA+L 
Sbjct: 1  MYNAILVVHIIVAISMIGLILVQHGKGADAGASFGAGGSATVFGASGSANFLTRLTAVLT 60

Query: 55 FFFFATSIALGMISRYTSTRYKDN 78
            FF TS+ L + ++  S   +  
Sbjct: 61 AIFFITSMTLAVFAKQQSLSSRTL 84


>gi|148264115|ref|YP_001230821.1| preprotein translocase subunit SecG [Geobacter uraniireducens Rf4]
 gi|146397615|gb|ABQ26248.1| protein translocase subunit secG [Geobacter uraniireducens Rf4]
          Length = 134

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 20/127 (15%), Positives = 42/127 (33%), Gaps = 6/127 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
           M   L+++H+ V + L+ ++L+QS   +  G       S +          L + T   A
Sbjct: 1   MTTLLIILHIFVSLALIVIVLLQSGKGAEMGASFGAGGSQSVFGAGGGTTFLSKLTTSAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             F  TS+ L  +S    +    +   +     K              L +   ++    
Sbjct: 61  VIFMLTSLTLAFVSGKGGSSSIMSSKDATKAVQKKSAAPMQPPAQGKPLSTEPVQTKPVQ 120

Query: 115 VAGKRSS 121
              +  +
Sbjct: 121 QVPQAPA 127


>gi|145636286|ref|ZP_01791955.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittHH]
 gi|145270451|gb|EDK10385.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittHH]
          Length = 113

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 6/88 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRS 82
            FF  ++ LG ++ +     K      
Sbjct: 61 TAFFVIALVLGNMNSHKGNVQKGTFDDL 88


>gi|239816484|ref|YP_002945394.1| preprotein translocase subunit SecG [Variovorax paradoxus S110]
 gi|239803061|gb|ACS20128.1| preprotein translocase, SecG subunit [Variovorax paradoxus S110]
          Length = 137

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 23/106 (21%), Positives = 42/106 (39%), Gaps = 6/106 (5%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILAFF 56
             L+ V ++  + ++ +ILIQ    +  G      S+ +      +A+ L R TA+LA  
Sbjct: 6   NLLVGVQMLSALAMIGLILIQHGKGADMGAAFGSGSAGSLFGASGSANFLSRTTAVLAAV 65

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
           FFA ++ L   S          + R+ V +     +   G      
Sbjct: 66  FFACTLLLAYFSHARPAGGGSLLERAAVGTPATPASGAAGQIPGGT 111


>gi|94309871|ref|YP_583081.1| preprotein translocase subunit SecG [Cupriavidus metallidurans
          CH34]
 gi|93353723|gb|ABF07812.1| preprotein translocase membrane subunit [Cupriavidus
          metallidurans CH34]
          Length = 122

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  L++V ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA 
Sbjct: 5  KTLLVIVQVLSALGVIGLVLLQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAVLAA 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++ L ++  Y  +     M
Sbjct: 65 LFFCCTLGLTLLGNYKPSASLGVM 88


>gi|163752376|ref|ZP_02159571.1| preprotein translocase, SecG subunit [Shewanella benthica KT99]
 gi|161327748|gb|EDP98935.1| preprotein translocase, SecG subunit [Shewanella benthica KT99]
          Length = 106

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 44/106 (41%), Gaps = 6/106 (5%)

Query: 6   MVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFA 59
           MVV+L+V +GLV +ILIQ    +  G+S      +         + L R TA+LA  FFA
Sbjct: 1   MVVYLLVAIGLVGLILIQQGKGADMGASFGAGASATLFGSSGAGNFLTRSTAVLAIGFFA 60

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
            S+ +G +S   +         S   +            +  K+  
Sbjct: 61  LSLIIGNLSANHTRSEDAWNDLSNDAAQVVDQVSEEVQQTEDKIPD 106


>gi|53712376|ref|YP_098368.1| preprotein translocase subunit SecG [Bacteroides fragilis YCH46]
 gi|60680545|ref|YP_210689.1| preprotein translocase subunit SecG [Bacteroides fragilis NCTC
           9343]
 gi|253563587|ref|ZP_04841044.1| preprotein translocase subunit SecG [Bacteroides sp. 3_2_5]
 gi|265762568|ref|ZP_06091136.1| preprotein translocase subunit SecG [Bacteroides sp. 2_1_16]
 gi|52215241|dbj|BAD47834.1| putative protein-export membrane protein [Bacteroides fragilis
           YCH46]
 gi|60491979|emb|CAH06740.1| possible protein-export transmembrane protein [Bacteroides fragilis
           NCTC 9343]
 gi|251947363|gb|EES87645.1| preprotein translocase subunit SecG [Bacteroides sp. 3_2_5]
 gi|263255176|gb|EEZ26522.1| preprotein translocase subunit SecG [Bacteroides sp. 2_1_16]
 gi|301162082|emb|CBW21626.1| possible protein-export transmembrane protein [Bacteroides fragilis
           638R]
          Length = 126

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/126 (20%), Positives = 54/126 (42%), Gaps = 4/126 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M + L+++ +I  + +  ++LIQ+S        F SS+    VR T   L + T  LA F
Sbjct: 1   MYLLLVILMVIAAILMCFIVLIQNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWGLAAF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               SIA   +   +S++ +D +        +    +     ++PK D+ +   + +   
Sbjct: 61  MVVMSIATAYVVPTSSSKTQDVIMEQAQQEEQTNPYNLPVGTTAPKTDAAAPVEAPATET 120

Query: 117 GKRSSS 122
               ++
Sbjct: 121 PATPAN 126


>gi|220934161|ref|YP_002513060.1| preprotein translocase, SecG subunit [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995471|gb|ACL72073.1| preprotein translocase, SecG subunit [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 112

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 34/94 (36%), Gaps = 6/94 (6%)

Query: 17  VCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY 70
           + +IL+Q    +        G+SS     R +A+ L R TAILA  FF  S+ L  +   
Sbjct: 18  IALILMQHGKGADAGAAFGSGASSTVFGARGSANFLSRTTAILATVFFVNSMGLAYLVSN 77

Query: 71  TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
                        ++       +    G+   + 
Sbjct: 78  QPAPTSVIDRLPAIEQPAPVRPEPVEPGAPADVP 111


>gi|260582289|ref|ZP_05850082.1| preprotein translocase SecG subunit [Haemophilus influenzae
          NT127]
 gi|319775628|ref|YP_004138116.1| protein-export membrane protein SecG [Haemophilus influenzae
          F3047]
 gi|329122323|ref|ZP_08250911.1| preprotein translocase subunit SecG [Haemophilus aegyptius ATCC
          11116]
 gi|260094657|gb|EEW78552.1| preprotein translocase SecG subunit [Haemophilus influenzae
          NT127]
 gi|317450219|emb|CBY86435.1| protein-export membrane protein SecG [Haemophilus influenzae
          F3047]
 gi|327473884|gb|EGF19301.1| preprotein translocase subunit SecG [Haemophilus aegyptius ATCC
          11116]
          Length = 113

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 6/88 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRS 82
            FF  ++ LG ++ +     K      
Sbjct: 61 TAFFVIALVLGNMNSHKGNIQKGAFDDL 88


>gi|119386420|ref|YP_917475.1| preprotein translocase subunit SecG [Paracoccus denitrificans
           PD1222]
 gi|119377015|gb|ABL71779.1| protein translocase subunit secG [Paracoccus denitrificans PD1222]
          Length = 176

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 50/131 (38%), Gaps = 11/131 (8%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFFF 58
           +  ++ VHLI+ V L+ V+L+Q S+    G         + R  A++L R T I A  F 
Sbjct: 3   ENIVLTVHLILAVLLIGVVLLQRSEGGGLGMGGGGGGVMTGRQAANALSRLTWIFAIGFI 62

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN--------DNFGDGSSPKLDSVSAKS 110
            TS+ L +I+   ++        +L  + +                    P +       
Sbjct: 63  ITSMTLTLIAAQNASSGSIVDQLNLGGTEQAPATDLPGIGDYTPPPGAGQPVVPGAGQPV 122

Query: 111 SSSVVAGKRSS 121
           +    AG+  +
Sbjct: 123 APPAPAGETPA 133


>gi|313145591|ref|ZP_07807784.1| preprotein translocase subunit SecG [Bacteroides fragilis 3_1_12]
 gi|313134358|gb|EFR51718.1| preprotein translocase subunit SecG [Bacteroides fragilis 3_1_12]
          Length = 126

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 26/108 (24%), Positives = 48/108 (44%), Gaps = 4/108 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M + L+++ +I  + +  ++LIQ+S        F SS+    VR T   L + T  LA F
Sbjct: 1   MYLLLVILMVIAAILMCFIVLIQNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWGLAAF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
               SIA   +   +S++ +D +        +    +     ++PK D
Sbjct: 61  MVVMSIATAYVVPTSSSKTQDVIMEQAQQEEQTNPYNLPVGTTAPKTD 108


>gi|262370083|ref|ZP_06063410.1| preprotein translocase subunit SecG [Acinetobacter johnsonii SH046]
 gi|262315122|gb|EEY96162.1| preprotein translocase subunit SecG [Acinetobacter johnsonii SH046]
          Length = 109

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 46/105 (43%), Gaps = 6/105 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           MQ F++VVH+I+ V ++ +IL+Q    +  G+S              + + L R TA+L 
Sbjct: 1   MQTFVLVVHIILAVLMIVLILVQHGKGADAGASFGGGGAATVFGASGSGNFLTRLTAVLT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
             FF TS++L + ++  +T            S   Q  +      
Sbjct: 61  ALFFITSLSLAVFAKKQTTDAYSLKSVQTTSSAPAQSTETSPAAP 105


>gi|163746028|ref|ZP_02153387.1| preprotein translocase, SecG subunit, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161380773|gb|EDQ05183.1| preprotein translocase, SecG subunit, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 118

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 52/120 (43%), Gaps = 4/120 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           M+  ++++HLI+ +GL+ V+L+Q S+    G        S RS A +LG+ T ILA  F 
Sbjct: 1   MENVVLIIHLILALGLIAVVLLQRSEGGGLGMGGGGGAVSGRSAATALGKITWILAAGFI 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
            TSI L +I+   S          L  +   Q            L   +  ++  V A  
Sbjct: 61  VTSITLTIIAAEKSAGSSVIDR--LSATPPAQNGSPALPAGDDLLPPSADGNTPLVPAAD 118


>gi|270619599|ref|ZP_06221819.1| Protein-export membrane protein secG [Haemophilus influenzae
          HK1212]
 gi|270720306|ref|ZP_06223380.1| Protein-export membrane protein secG [Haemophilus influenzae
          HK1212]
 gi|270315322|gb|EFA27624.1| Protein-export membrane protein secG [Haemophilus influenzae
          HK1212]
 gi|270317831|gb|EFA29186.1| Protein-export membrane protein secG [Haemophilus influenzae
          HK1212]
          Length = 113

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 6/88 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRS 82
            FF  ++ LG ++ +     K      
Sbjct: 61 TAFFVIALVLGNMNSHKGNIQKGAFDDL 88


>gi|229846531|ref|ZP_04466639.1| preprotein translocase subunit SecG [Haemophilus influenzae
          7P49H1]
 gi|229810624|gb|EEP46342.1| preprotein translocase subunit SecG [Haemophilus influenzae
          7P49H1]
          Length = 112

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 6/88 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRS 82
            FF  ++ LG ++ +     K      
Sbjct: 61 TAFFVIALVLGNMNSHKGNIQKGAFDDL 88


>gi|157273527|gb|ABV27426.1| preprotein translocase SecG subunit [Candidatus Chloracidobacterium
           thermophilum]
          Length = 170

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 41/136 (30%), Gaps = 14/136 (10%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDS---SAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
            L V+ +IV + L+ V+L+Q          G S      R     L R T +L   F A 
Sbjct: 7   VLFVLFVIVCLLLIGVVLLQPGKGDIALFGGGSQTAFGPRGAQKPLERVTFVLGGLFMAL 66

Query: 61  SIALGMISRYTSTRYKDNMHRSLVD-----------SIKDQGNDNFGDGSSPKLDSVSAK 109
           +    +            +                   + +     G+ +S      +  
Sbjct: 67  AFTFSIPGILLPRSAAAGIKDEPPPSKKEEKQKEETQPEAKKETGAGEATSESTPDKATP 126

Query: 110 SSSSVVAGKRSSSRTK 125
           S+    A K+  S  K
Sbjct: 127 STGEENAAKQGQSDQK 142


>gi|110833187|ref|YP_692046.1| protein-export membrane protein [Alcanivorax borkumensis SK2]
 gi|110646298|emb|CAL15774.1| Protein-export membrane protein [Alcanivorax borkumensis SK2]
          Length = 147

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 23/127 (18%), Positives = 42/127 (33%), Gaps = 17/127 (13%)

Query: 15  GLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMIS 68
           GL+ ++LIQ    +  G+S              +A+ L R TA+LA  FF TS+ L  ++
Sbjct: 15  GLIGLVLIQHGKGADAGASFGGGGSQTVFGSAGSANFLTRATAVLAALFFVTSLVLAWMA 74

Query: 69  RYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK----LDSVSAK-------SSSSVVAG 117
           R  +   +  +        +D    +      P     +             S       
Sbjct: 75  RQEADSSRSFLPELETVEHQDVPVVDESPSEVPAGMTEVPVAPDANEEQKEVSDVPQAEV 134

Query: 118 KRSSSRT 124
           +  +   
Sbjct: 135 ESPAPTE 141


>gi|251793005|ref|YP_003007731.1| preprotein translocase subunit SecG [Aggregatibacter aphrophilus
           NJ8700]
 gi|247534398|gb|ACS97644.1| protein-export membrane protein [Aggregatibacter aphrophilus
           NJ8700]
          Length = 116

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 42/104 (40%), Gaps = 6/104 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M   L++++L+V + L+  IL+Q    +  G+S                + L R TA+LA
Sbjct: 1   MYSALLIIYLVVSIALIAFILLQQGKGADAGASFGGGASGTVFGSAGAGNFLSRTTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
             FF  SI +G ++ + +   +         + + Q        
Sbjct: 61  TIFFIISIVIGNLNSHKNNVKQGAFDDLSGTAEQIQQQQQKAPA 104


>gi|92115192|ref|YP_575120.1| protein translocase subunit secG [Chromohalobacter salexigens DSM
           3043]
 gi|91798282|gb|ABE60421.1| protein translocase subunit secG [Chromohalobacter salexigens DSM
           3043]
          Length = 119

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 43/105 (40%), Gaps = 6/105 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M I +++VH+ + + LV ++L+Q    +  G++            + + + L + T +LA
Sbjct: 1   MYIGVLLVHVAIAIALVVLVLLQQGKGAEAGAAFGGGASQTVFGSQGSGNFLAKLTGVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
             FFATS+ L           ++ +  +     +        +  
Sbjct: 61  AVFFATSLGLAYFVSQAGDAPQEGIPDAQAVEQQKSAATLDEEEE 105


>gi|240127406|ref|ZP_04740067.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268685781|ref|ZP_06152643.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268626065|gb|EEZ58465.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae
           SK-93-1035]
          Length = 116

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 45/109 (41%), Gaps = 8/109 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA--------FGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5   KTLIWIINIISALAVIVLVLLQHGKGADAGTTFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
           A FFFAT +A+  I  +T+    D  +           ++       P+
Sbjct: 65  ATFFFATCMAMVYIHTHTTKHGLDFSNIRQTQQAPKPVSNTEPSAPVPQ 113


>gi|126664886|ref|ZP_01735870.1| preprotein translocase, SecG subunit [Marinobacter sp. ELB17]
 gi|126631212|gb|EBA01826.1| preprotein translocase, SecG subunit [Marinobacter sp. ELB17]
          Length = 117

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/110 (21%), Positives = 48/110 (43%), Gaps = 7/110 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M+  ++V+H+++ V LV ++LIQ    +  G++            + +   L RFT  LA
Sbjct: 4   METLIVVLHVVIAVALVGLVLIQQGKGADAGAAFGGGASQTVFGSQGSGSFLTRFTTFLA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FF TS +L + ++  +    +     + +S      D   +    + D
Sbjct: 64  IAFFVTSFSLAIFAKQRAEVAGEAGIPMVQESA-PAATDPVSETDGGQSD 112


>gi|294674241|ref|YP_003574857.1| preprotein translocase subunit SecG [Prevotella ruminicola 23]
 gi|294473153|gb|ADE82542.1| preprotein translocase, SecG subunit [Prevotella ruminicola 23]
          Length = 126

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 34/103 (33%), Gaps = 5/103 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M    +++ ++  + ++ ++LIQ S        F   +    VR T   + + T  LA F
Sbjct: 1   MYTLFVILIVVAALLMIGIVLIQESKGGGLASQFSGYNQIGGVRKTTDFIEKATWFLAGF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
               S+    ++          M      +        FG   
Sbjct: 61  MVLVSVCCAYVAPQAGGDT-SVMENYQAPATNPNNLPGFGASQ 102


>gi|148825275|ref|YP_001290028.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittEE]
 gi|148715435|gb|ABQ97645.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittEE]
          Length = 112

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 6/88 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q    +  G+S                + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRS 82
            FF  ++ LG ++ +     K      
Sbjct: 61 TAFFVIALVLGNMNSHKGNVQKGAFDDL 88


>gi|59800485|ref|YP_207197.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae FA 1090]
 gi|194097611|ref|YP_002000647.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae
           NCCP11945]
 gi|239998147|ref|ZP_04718071.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae 35/02]
 gi|240013329|ref|ZP_04720242.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae DGI18]
 gi|240015774|ref|ZP_04722314.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae FA6140]
 gi|240079910|ref|ZP_04724453.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae FA19]
 gi|240112117|ref|ZP_04726607.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae MS11]
 gi|240114863|ref|ZP_04728925.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID18]
 gi|240117066|ref|ZP_04731128.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID1]
 gi|240120402|ref|ZP_04733364.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID24-1]
 gi|240122704|ref|ZP_04735660.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID332]
 gi|240124894|ref|ZP_04737780.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae
           SK-92-679]
 gi|254492926|ref|ZP_05106097.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae 1291]
 gi|260441322|ref|ZP_05795138.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae DGI2]
 gi|268593999|ref|ZP_06128166.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae 35/02]
 gi|268596053|ref|ZP_06130220.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae FA19]
 gi|268598178|ref|ZP_06132345.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae MS11]
 gi|268600523|ref|ZP_06134690.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID18]
 gi|268602756|ref|ZP_06136923.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID1]
 gi|268681305|ref|ZP_06148167.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID332]
 gi|268683476|ref|ZP_06150338.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae
           SK-92-679]
 gi|291044677|ref|ZP_06570386.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae DGI2]
 gi|293397784|ref|ZP_06641990.1| preprotein translocase SecG subunit [Neisseria gonorrhoeae F62]
 gi|59717380|gb|AAW88785.1| putative protein-export protein [Neisseria gonorrhoeae FA 1090]
 gi|193932901|gb|ACF28725.1| putative protein-export protein [Neisseria gonorrhoeae NCCP11945]
 gi|226511966|gb|EEH61311.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae 1291]
 gi|268547388|gb|EEZ42806.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae 35/02]
 gi|268549841|gb|EEZ44860.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae FA19]
 gi|268582309|gb|EEZ46985.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae MS11]
 gi|268584654|gb|EEZ49330.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID18]
 gi|268586887|gb|EEZ51563.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID1]
 gi|268621589|gb|EEZ53989.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae PID332]
 gi|268623760|gb|EEZ56160.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae
           SK-92-679]
 gi|291011571|gb|EFE03567.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae DGI2]
 gi|291611730|gb|EFF40799.1| preprotein translocase SecG subunit [Neisseria gonorrhoeae F62]
 gi|317163439|gb|ADV06980.1| preprotein translocase subunit SecG [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 116

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 45/109 (41%), Gaps = 8/109 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA--------FGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5   KTLIWIINIISALAVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
           A FFFAT +A+  I  +T+    D  +           ++       P+
Sbjct: 65  ATFFFATCMAMVYIHTHTTKHGLDFSNIRQTQQAPKPVSNTEPSAPVPQ 113


>gi|296160628|ref|ZP_06843443.1| preprotein translocase, SecG subunit [Burkholderia sp. Ch1-1]
 gi|295889154|gb|EFG68957.1| preprotein translocase, SecG subunit [Burkholderia sp. Ch1-1]
          Length = 125

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 54/121 (44%), Gaps = 6/121 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
           ++  ++VV L+  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 4   LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF T++ L  +  Y +      +  ++   +          GS+    S ++  ++ V
Sbjct: 64  AVFFVTTLTLTYLGAYRAKPSAGVLGAAVTAPVAASAASAAAGGSAVLPASAASIPATDV 123

Query: 115 V 115
            
Sbjct: 124 P 124


>gi|86136597|ref|ZP_01055176.1| preprotein translocase, SecG subunit [Roseobacter sp. MED193]
 gi|85827471|gb|EAQ47667.1| preprotein translocase, SecG subunit [Roseobacter sp. MED193]
          Length = 124

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 51/125 (40%), Gaps = 6/125 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV-----RSTAHSLGRFTAILAF 55
           M+  ++++HL++ +GL+ V+L+Q S+    G  S          RS A +LG+ T +LA 
Sbjct: 1   MENVVLIIHLLLALGLIAVVLLQRSEGGGLGMGSGGGGGGAMSGRSAATALGKVTWVLAI 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            F  TSI L +++   S          L  + +                   A+  ++ +
Sbjct: 61  CFICTSITLTVLAAKKSA-GSSVADGILPSTTESGNAPAAPIAPLGSDLLPPAEGDNAPL 119

Query: 116 AGKRS 120
                
Sbjct: 120 VPSAD 124


>gi|108761254|ref|YP_631035.1| preprotein translocase subunit SecG [Myxococcus xanthus DK 1622]
 gi|108465134|gb|ABF90319.1| preprotein translocase, SecG subunit [Myxococcus xanthus DK 1622]
          Length = 132

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M  F+ +VH++V V ++ VIL+Q    +        G++++    R     L + T + A
Sbjct: 1   MLTFVTIVHVLVCVFMIFVILLQPGKDAGMGSALGGGAATSAFGGRGAVTFLSKLTGVFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF +S+ L  +   +S     ++              +    S+P     +A  S   
Sbjct: 61  ALFFFSSLGLSFVGLRSSVAAGGSV-------------ASPPAQSAPATSGDAAPGSMEQ 107

Query: 115 VAGKRSSSRTK 125
             G++S+   +
Sbjct: 108 PRGEQSTPPAE 118


>gi|126739990|ref|ZP_01755680.1| preprotein translocase, SecG subunit [Roseobacter sp. SK209-2-6]
 gi|126718809|gb|EBA15521.1| preprotein translocase, SecG subunit [Roseobacter sp. SK209-2-6]
          Length = 122

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 51/123 (41%), Gaps = 4/123 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFF 57
           M+  ++++HL++ +GL+ V+L+Q S+    G         + RS A +L + T  LA  F
Sbjct: 1   MENVVLIIHLLLALGLIAVVLLQRSEGGGLGMGGGGGGAMTGRSAATALSKVTWALAIAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
             TS+ L +++   S        R       D+G  +             A+  ++ +  
Sbjct: 61  ICTSVTLTVLAAQKSA-GSSVTDRIEATDGADEGAASAPAAPLGSDLLPPAEGDNAPLVP 119

Query: 118 KRS 120
              
Sbjct: 120 AAD 122


>gi|262377015|ref|ZP_06070241.1| preprotein translocase, SecG subunit [Acinetobacter lwoffii SH145]
 gi|262308053|gb|EEY89190.1| preprotein translocase, SecG subunit [Acinetobacter lwoffii SH145]
          Length = 109

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 46/105 (43%), Gaps = 6/105 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           MQ F++VVH+I+ V ++ +IL+Q    +  G+S              + + + R TAI  
Sbjct: 1   MQTFVLVVHIILAVLMIVLILVQHGKGADAGASFGGGGAATVFGASGSGNFMTRLTAIFT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
             FF TS+ L ++++  ++            +   Q N+      
Sbjct: 61  ALFFVTSLTLAILAKQQTSNAYSLGSVQSAPTTPVQSNETSPTAP 105


>gi|218513883|ref|ZP_03510723.1| preprotein translocase subunit SecG [Rhizobium etli 8C-3]
          Length = 99

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 36/86 (41%), Positives = 53/86 (61%), Gaps = 3/86 (3%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFFATSI 62
          ++V+HL++V+ LV V+LIQ S+    G      F S R TA++L R TAILA  FF TS+
Sbjct: 1  MIVIHLMIVLALVGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILATLFFLTSL 60

Query: 63 ALGMISRYTSTRYKDNMHRSLVDSIK 88
           LG+++RY   R  D ++R    S +
Sbjct: 61 GLGILTRYEG-RPSDILNRIPATSGQ 85


>gi|78067047|ref|YP_369816.1| preprotein translocase subunit SecG [Burkholderia sp. 383]
 gi|77967792|gb|ABB09172.1| protein translocase subunit secG [Burkholderia sp. 383]
          Length = 125

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +  G+      S +      +A+ L R T ILA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y ST     +
Sbjct: 65 IFFVATLALTYLGSYKSTPSAGVL 88


>gi|322435147|ref|YP_004217359.1| preprotein translocase, SecG subunit [Acidobacterium sp. MP5ACTX9]
 gi|321162874|gb|ADW68579.1| preprotein translocase, SecG subunit [Acidobacterium sp. MP5ACTX9]
          Length = 102

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 38/94 (40%), Gaps = 6/94 (6%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAFFF 57
            L+ +H+IV + L+ V+L+Q+  S+          S      R  A+ L + TA     F
Sbjct: 7   LLVALHVIVSLFLIGVVLLQTGKSADLAGAFGGQGSQTAFGPRGAANVLTKLTAYSTVIF 66

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG 91
              S +L ++   TS+R    +  +         
Sbjct: 67  MILSFSLTIMFSRTSSRDHSVLSGTPTQQSAPAS 100


>gi|261378217|ref|ZP_05982790.1| preprotein translocase, SecG subunit [Neisseria cinerea ATCC 14685]
 gi|269145689|gb|EEZ72107.1| preprotein translocase, SecG subunit [Neisseria cinerea ATCC 14685]
          Length = 119

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/113 (19%), Positives = 44/113 (38%), Gaps = 9/113 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA--------FGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + ++ ++L+Q    +          GS+         A+ L R TAI 
Sbjct: 5   KTLIWIINIISALAVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAIA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSV 106
           A FFFAT +A+  I  +T+    D            +      + + P     
Sbjct: 65  ATFFFATCMAMVYIHTHTTKHGLD-FSSVQQTQQAPKPAVPVKNNTEPAAPVP 116


>gi|171316302|ref|ZP_02905523.1| preprotein translocase, SecG subunit [Burkholderia ambifaria
          MEX-5]
 gi|171098528|gb|EDT43329.1| preprotein translocase, SecG subunit [Burkholderia ambifaria
          MEX-5]
          Length = 125

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +  G+      S +      +A+ L R T +LA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGVLAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y ST     +
Sbjct: 65 IFFVATLALTYLGSYKSTPSAGVL 88


>gi|115352339|ref|YP_774178.1| preprotein translocase subunit SecG [Burkholderia ambifaria AMMD]
 gi|170698108|ref|ZP_02889188.1| preprotein translocase, SecG subunit [Burkholderia ambifaria
          IOP40-10]
 gi|172061210|ref|YP_001808862.1| preprotein translocase subunit SecG [Burkholderia ambifaria
          MC40-6]
 gi|115282327|gb|ABI87844.1| protein translocase subunit secG [Burkholderia ambifaria AMMD]
 gi|170136966|gb|EDT05214.1| preprotein translocase, SecG subunit [Burkholderia ambifaria
          IOP40-10]
 gi|171993727|gb|ACB64646.1| preprotein translocase, SecG subunit [Burkholderia ambifaria
          MC40-6]
          Length = 125

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +  G+      S +      +A+ L R T +LA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGVLAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y ST     +
Sbjct: 65 IFFVATLALTYLGSYKSTPSAGVL 88


>gi|238757573|ref|ZP_04618758.1| Protein-export membrane protein secG [Yersinia aldovae ATCC 35236]
 gi|238704335|gb|EEP96867.1| Protein-export membrane protein secG [Yersinia aldovae ATCC 35236]
          Length = 105

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/104 (19%), Positives = 41/104 (39%), Gaps = 6/104 (5%)

Query: 8   VHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATS 61
           + L++ +GLV +I++Q    +  G+S      +       + + + R TA+LA  FF  S
Sbjct: 2   IFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLATLFFVIS 61

Query: 62  IALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
           + LG +S     +  +  +       +           S  +  
Sbjct: 62  LILGNMSTNQGHKGSEWENLGQPAQSEQTTAPVAPAKPSSDIPQ 105


>gi|167569421|ref|ZP_02362295.1| preprotein translocase subunit SecG [Burkholderia oklahomensis
          C6786]
          Length = 124

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAFFF 57
           ++VV L+  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA  F
Sbjct: 7  LIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLATIF 66

Query: 58 FATSIALGMISRYTSTRYKDNM 79
          F  ++AL  +  Y S      +
Sbjct: 67 FVATLALTYLGSYKSAPSVGVL 88


>gi|167562176|ref|ZP_02355092.1| preprotein translocase subunit SecG [Burkholderia oklahomensis
          EO147]
          Length = 124

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAFFF 57
           ++VV L+  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA  F
Sbjct: 7  LIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLATIF 66

Query: 58 FATSIALGMISRYTSTRYKDNM 79
          F  ++AL  +  Y S      +
Sbjct: 67 FVATLALTYLGSYKSAPSVGVL 88


>gi|167836048|ref|ZP_02462931.1| preprotein translocase subunit SecG [Burkholderia thailandensis
          MSMB43]
          Length = 125

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV L+  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL  +  Y S      +
Sbjct: 64 TIFFIATLALTYLGSYKSAPSVGVL 88


>gi|182678433|ref|YP_001832579.1| preprotein translocase, SecG subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634316|gb|ACB95090.1| preprotein translocase, SecG subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 139

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 36/137 (26%), Positives = 54/137 (39%), Gaps = 14/137 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS--TAHSLGRFTAILAFFFF 58
           MQ  L+V+HLIVV+ LV  +L+Q S+  A G       +     A+ L R TAILA  FF
Sbjct: 1   MQTVLIVIHLIVVIALVITVLLQRSEGGALGVGGGGGFMTGRGQANVLTRATAILAALFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKL-----------DSVS 107
            TS+AL +++       K     ++  +                L            S  
Sbjct: 61  TTSLALTILANLH-RAPKSIFEGTVPATQAPVQGKAPEQSQGNLLDQLRQMEDRRQPSAP 119

Query: 108 AKSSSSVVAGKRSSSRT 124
           A  +    +    S+ T
Sbjct: 120 APLTPPEPSPVTPSAPT 136


>gi|15677723|ref|NP_274884.1| preprotein translocase subunit SecG [Neisseria meningitidis MC58]
 gi|218767534|ref|YP_002342046.1| preprotein translocase subunit SecG [Neisseria meningitidis Z2491]
 gi|254804290|ref|YP_003082511.1| preprotein translocase SecG subunit [Neisseria meningitidis
           alpha14]
 gi|304388432|ref|ZP_07370538.1| preprotein translocase subunit SecG [Neisseria meningitidis ATCC
           13091]
 gi|7227147|gb|AAF42222.1| protein-export membrane protein SecG [Neisseria meningitidis MC58]
 gi|121051542|emb|CAM07840.1| putative protein-export integral membrane protein [Neisseria
           meningitidis Z2491]
 gi|254667832|emb|CBA03834.1| preprotein translocase SecG subunit [Neisseria meningitidis
           alpha14]
 gi|254673861|emb|CBA09641.1| preprotein translocase SecG subunit [Neisseria meningitidis
           alpha275]
 gi|261393225|emb|CAX50844.1| preprotein translocase SecG subunit [Neisseria meningitidis 8013]
 gi|304337549|gb|EFM03712.1| preprotein translocase subunit SecG [Neisseria meningitidis ATCC
           13091]
 gi|308389985|gb|ADO32305.1| preprotein translocase subunit SecG [Neisseria meningitidis
           alpha710]
 gi|316985503|gb|EFV64450.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           H44/76]
 gi|319409798|emb|CBY90106.1| preprotein translocase SecG subunit [Neisseria meningitidis WUE
           2594]
 gi|325127464|gb|EGC50393.1| preprotein translocase, SecG subunit [Neisseria meningitidis N1568]
 gi|325129504|gb|EGC52332.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           OX99.30304]
 gi|325133531|gb|EGC56194.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           M13399]
 gi|325135482|gb|EGC58100.1| preprotein translocase, SecG subunit [Neisseria meningitidis M0579]
 gi|325139545|gb|EGC62085.1| preprotein translocase, SecG subunit [Neisseria meningitidis CU385]
 gi|325143781|gb|EGC66098.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           M01-240013]
 gi|325200943|gb|ADY96398.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           H44/76]
 gi|325201474|gb|ADY96928.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           M01-240149]
 gi|325204842|gb|ADZ00296.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           M01-240355]
 gi|325206798|gb|ADZ02251.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           M04-240196]
 gi|325207454|gb|ADZ02906.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           NZ-05/33]
          Length = 116

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 45/109 (41%), Gaps = 8/109 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA--------FGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + +V++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5   KTLIWIVNIISALAVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
           A FFFAT +A+  I  +T+    D  +           ++       P+
Sbjct: 65  ATFFFATCMAMVYIHTHTTKHGLDFSNVQQTQQAPKPVSNTEPSAPVPQ 113


>gi|77918938|ref|YP_356753.1| preprotein translocase subunit SecG [Pelobacter carbinolicus DSM
          2380]
 gi|77545021|gb|ABA88583.1| protein translocase subunit secG [Pelobacter carbinolicus DSM
          2380]
          Length = 117

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 35/98 (35%), Gaps = 8/98 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+++H++V V L+ ++L+Q    +        G S         A  + + T   A
Sbjct: 1  MLTLLIILHVLVCVALIVIVLLQGGKGAEVGAAFGGGGSQTVFGATGGASFMSKLTTGAA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
            F  TS+ L     Y        M  ++      +  
Sbjct: 61 IVFMLTSLILAYF--YKIPGVDSVMPETMGTPTVQEQT 96


>gi|148260240|ref|YP_001234367.1| preprotein translocase, SecG subunit [Acidiphilium cryptum JF-5]
 gi|326403426|ref|YP_004283507.1| protein translocase subunit SecG [Acidiphilium multivorum AIU301]
 gi|146401921|gb|ABQ30448.1| protein translocase subunit secG [Acidiphilium cryptum JF-5]
 gi|325050287|dbj|BAJ80625.1| protein translocase subunit SecG [Acidiphilium multivorum AIU301]
          Length = 160

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+V+   + + L+ V+LIQ S+    G        +F + R TA+ L R TA+LA 
Sbjct: 1  MITVLLVLQAFITIALIGVVLIQRSEGGGLGLGTSQGMGSFMTGRGTANLLTRVTAVLAT 60

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           F   S+ L ++ R+      +++
Sbjct: 61 LFMVLSLVLALLYRHGGGGSAESI 84


>gi|150005145|ref|YP_001299889.1| preprotein translocase subunit SecG [Bacteroides vulgatus ATCC
           8482]
 gi|254883280|ref|ZP_05255990.1| preprotein translocase subunit SecG [Bacteroides sp. 4_3_47FAA]
 gi|294778956|ref|ZP_06744372.1| preprotein translocase, SecG subunit [Bacteroides vulgatus PC510]
 gi|319642655|ref|ZP_07997301.1| hypothetical protein HMPREF9011_02901 [Bacteroides sp. 3_1_40A]
 gi|149933569|gb|ABR40267.1| putative protein-export membrane protein [Bacteroides vulgatus ATCC
           8482]
 gi|254836073|gb|EET16382.1| preprotein translocase subunit SecG [Bacteroides sp. 4_3_47FAA]
 gi|294447265|gb|EFG15849.1| preprotein translocase, SecG subunit [Bacteroides vulgatus PC510]
 gi|317385743|gb|EFV66676.1| hypothetical protein HMPREF9011_02901 [Bacteroides sp. 3_1_40A]
          Length = 121

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 46/121 (38%), Gaps = 7/121 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M + L+ + ++  + +  V+LIQ+S       +F SS+    VR T   + + T  LA F
Sbjct: 1   MYLLLIGLIVLAALLMCFVVLIQNSKGGGLASSFASSNQIMGVRKTTDFIEKLTWGLAAF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN---FGDGSSPKLDSVSAKSSSS 113
             A S+          T     M  ++ +   +  N         ++       A S S+
Sbjct: 61  MVACSVLTAYFVPAAHTDSSVIMEEAVKEGATNPLNAPSGFAAPQTNDAATETPAPSDSA 120

Query: 114 V 114
            
Sbjct: 121 Q 121


>gi|83719049|ref|YP_441613.1| preprotein translocase subunit SecG [Burkholderia thailandensis
          E264]
 gi|167580421|ref|ZP_02373295.1| preprotein translocase subunit SecG [Burkholderia thailandensis
          TXDOH]
 gi|167618530|ref|ZP_02387161.1| preprotein translocase subunit SecG [Burkholderia thailandensis
          Bt4]
 gi|257139691|ref|ZP_05587953.1| preprotein translocase subunit SecG [Burkholderia thailandensis
          E264]
 gi|83652874|gb|ABC36937.1| Preprotein translocase SecG subunit, putative [Burkholderia
          thailandensis E264]
          Length = 125

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV L+  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL  +  Y S      +
Sbjct: 64 TIFFVATLALTYLGSYKSAPSVGVL 88


>gi|134296434|ref|YP_001120169.1| preprotein translocase subunit SecG [Burkholderia vietnamiensis
          G4]
 gi|134139591|gb|ABO55334.1| protein translocase subunit secG [Burkholderia vietnamiensis G4]
          Length = 128

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 42/84 (50%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y +T     +
Sbjct: 65 VFFIATLALTYLGSYKATPSAGVL 88


>gi|110679196|ref|YP_682203.1| preprotein translocase subunit SecG [Roseobacter denitrificans OCh
           114]
 gi|109455312|gb|ABG31517.1| preprotein translocase, SecG subunit, putative [Roseobacter
           denitrificans OCh 114]
          Length = 121

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 51/118 (43%), Gaps = 3/118 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA---HSLGRFTAILAFFF 57
           M+  ++++HLI+ +GL+ V+L+Q S+    G         +      +LG+ T +LA  F
Sbjct: 1   MENVVLIIHLILALGLIAVVLLQRSEGGGLGMGGGGGGAMTGRAAATALGKVTWLLAIAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
             TSI L + +   ++         +     D+G       S   L   + +++  V 
Sbjct: 61  ICTSITLTIFAAENASGSSVIDRLGVTPPAADRGETPALPDSDLLLPPSADENAPLVP 118


>gi|206560704|ref|YP_002231469.1| preprotein translocase subunit SecG [Burkholderia cenocepacia
          J2315]
 gi|198036746|emb|CAR52646.1| protein-export membrane protein SecG [Burkholderia cenocepacia
          J2315]
          Length = 125

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +  G+      S +      +A+ L R T ILA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y ST     +
Sbjct: 65 IFFVATLALTYLGSYKSTPSAGVL 88


>gi|89055671|ref|YP_511122.1| preprotein translocase subunit SecG [Jannaschia sp. CCS1]
 gi|88865220|gb|ABD56097.1| protein translocase subunit secG [Jannaschia sp. CCS1]
          Length = 123

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 50/122 (40%), Gaps = 6/122 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M+  ++V+HLI+ + L+ V+L+Q S+    G            + R  A +LG+ T   A
Sbjct: 1   MENVILVIHLILAICLIGVVLLQRSEGGGLGMGGGGGGGGGVMTGRQAATALGKLTWFFA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             F ATSI L +I+   S           + +++   +       S      +   +   
Sbjct: 61  VAFLATSITLTVIAAQNSAGSSLLDDLGGLPAVEGDADSALPPIDSMLPPIGTDGPALPP 120

Query: 115 VA 116
           V+
Sbjct: 121 VS 122


>gi|107023189|ref|YP_621516.1| preprotein translocase subunit SecG [Burkholderia cenocepacia AU
          1054]
 gi|116690271|ref|YP_835894.1| preprotein translocase subunit SecG [Burkholderia cenocepacia
          HI2424]
 gi|105893378|gb|ABF76543.1| protein translocase subunit secG [Burkholderia cenocepacia AU
          1054]
 gi|116648360|gb|ABK09001.1| protein translocase subunit secG [Burkholderia cenocepacia
          HI2424]
          Length = 125

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +  G+      S +      +A+ L R T ILA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y ST     +
Sbjct: 65 IFFVATLALTYLGSYKSTPSAGVL 88


>gi|254427158|ref|ZP_05040865.1| preprotein translocase SecG subunit, putative [Alcanivorax sp.
           DG881]
 gi|196193327|gb|EDX88286.1| preprotein translocase SecG subunit, putative [Alcanivorax sp.
           DG881]
          Length = 147

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 43/125 (34%), Gaps = 17/125 (13%)

Query: 15  GLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMIS 68
           GLV ++LIQ    +  G+S              +A+ L R TA+LA  FF TS+ L  ++
Sbjct: 15  GLVGLVLIQHGKGADAGASFGGGGSQTVFGSAGSANFLTRATAVLAAVFFVTSLVLAWMA 74

Query: 69  RYTSTRYKDNMHRSLVDSIK-------DQGNDNFGDGSSPKLDSVSAK----SSSSVVAG 117
           R  +   +  +        +        Q +   G    P     +      S       
Sbjct: 75  RQEADSTRSFLPELETVEHQDVPVVDEPQSDVPAGMTEVPVAPEANEGQKEVSDVPQAEV 134

Query: 118 KRSSS 122
           +  + 
Sbjct: 135 ESPAP 139


>gi|160887194|ref|ZP_02068197.1| hypothetical protein BACOVA_05210 [Bacteroides ovatus ATCC 8483]
 gi|237715682|ref|ZP_04546163.1| preprotein translocase subunit SecG [Bacteroides sp. D1]
 gi|237721464|ref|ZP_04551945.1| preprotein translocase subunit SecG [Bacteroides sp. 2_2_4]
 gi|262408690|ref|ZP_06085236.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|293370811|ref|ZP_06617356.1| preprotein translocase, SecG subunit [Bacteroides ovatus SD CMC 3f]
 gi|294646660|ref|ZP_06724286.1| preprotein translocase, SecG subunit [Bacteroides ovatus SD CC 2a]
 gi|294807287|ref|ZP_06766101.1| preprotein translocase, SecG subunit [Bacteroides xylanisolvens SD
           CC 1b]
 gi|298481519|ref|ZP_06999711.1| preprotein translocase SecG subunit [Bacteroides sp. D22]
 gi|156107605|gb|EDO09350.1| hypothetical protein BACOVA_05210 [Bacteroides ovatus ATCC 8483]
 gi|229444391|gb|EEO50182.1| preprotein translocase subunit SecG [Bacteroides sp. D1]
 gi|229449260|gb|EEO55051.1| preprotein translocase subunit SecG [Bacteroides sp. 2_2_4]
 gi|262353555|gb|EEZ02649.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|292634027|gb|EFF52571.1| preprotein translocase, SecG subunit [Bacteroides ovatus SD CMC 3f]
 gi|292637999|gb|EFF56391.1| preprotein translocase, SecG subunit [Bacteroides ovatus SD CC 2a]
 gi|294445585|gb|EFG14238.1| preprotein translocase, SecG subunit [Bacteroides xylanisolvens SD
           CC 1b]
 gi|298272383|gb|EFI13952.1| preprotein translocase SecG subunit [Bacteroides sp. D22]
          Length = 131

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 48/126 (38%), Gaps = 4/126 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M +  +++ +I  + +  ++LIQ+S        F SS+    VR T   L + T  LA F
Sbjct: 1   MYLLFVILMVIAALLMCFIVLIQNSKGGGLASGFSSSNAIMGVRKTTDFLEKATWGLAIF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               SIA   +   ++      + ++  +   +  N   G  +       +   ++   A
Sbjct: 61  MVVMSIATAYVVPRSAVAKDAVLEQAQKEQQTNPYNLPAGTAAPQTEAPATNAPATETPA 120

Query: 117 GKRSSS 122
               + 
Sbjct: 121 PATETP 126


>gi|95930089|ref|ZP_01312828.1| preprotein translocase, SecG subunit [Desulfuromonas acetoxidans
          DSM 684]
 gi|95133783|gb|EAT15443.1| preprotein translocase, SecG subunit [Desulfuromonas acetoxidans
          DSM 684]
          Length = 99

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/81 (20%), Positives = 34/81 (41%), Gaps = 6/81 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M  FL+ VH++V + L+ ++L+Q+   +  G+S                  + + T   A
Sbjct: 1  MIPFLLTVHVLVCIALIVIVLLQAGKGAEAGASFGAGASQTVFGASGGRSFMSKMTTFAA 60

Query: 55 FFFFATSIALGMISRYTSTRY 75
            F  TS++L  +     +  
Sbjct: 61 CLFMLTSLSLAYLYGKPGSDS 81


>gi|157165673|ref|YP_001467728.1| AraC family transcriptional regulator [Campylobacter concisus
           13826]
 gi|112800315|gb|EAT97659.1| protein-export membrane protein [Campylobacter concisus 13826]
          Length = 109

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/112 (16%), Positives = 44/112 (39%), Gaps = 8/112 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M +  +++  ++ V +   +L+Q S      +  GS+ +    +  A  L +FT ++   
Sbjct: 1   MSLIFLILQFVLAVVITIAVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFVVGVL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
           F   ++ALG        R    +      S+    +++    ++P      A
Sbjct: 61  FILNTLALGYFYNKDLKR--SIVDSVDSKSLVIPKSNDV--PAAPSAPQNPA 108


>gi|117925181|ref|YP_865798.1| protein translocase subunit secG [Magnetococcus sp. MC-1]
 gi|117608937|gb|ABK44392.1| protein translocase subunit secG [Magnetococcus sp. MC-1]
          Length = 124

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/115 (20%), Positives = 44/115 (38%), Gaps = 9/115 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDS------SAFGSSSNFTSVRSTAHSLGRFTAILA 54
           M + + V+H++  + L+ V+L+Q             GSS +          +G+FTA +A
Sbjct: 1   MTLLITVLHVMACLILISVVLLQKGSGTDMGAAFGGGSSQSVFGASGGGSFMGKFTAGVA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             F  +S+ L  IS   S      M      + ++Q          P +   +  
Sbjct: 61  AIFLLSSMTLTFISTKGSN-ASSVMDGVKAPTAQEQKL--PAAPELPLVPKEAKP 112


>gi|224418729|ref|ZP_03656735.1| preprotein translocase subunit SecG [Helicobacter canadensis MIT
           98-5491]
 gi|253826743|ref|ZP_04869628.1| protein-export membrane protein secG [Helicobacter canadensis MIT
           98-5491]
 gi|313142246|ref|ZP_07804439.1| preprotein translocase subunit SecG [Helicobacter canadensis MIT
           98-5491]
 gi|253510149|gb|EES88808.1| protein-export membrane protein secG [Helicobacter canadensis MIT
           98-5491]
 gi|313131277|gb|EFR48894.1| preprotein translocase subunit SecG [Helicobacter canadensis MIT
           98-5491]
          Length = 115

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 44/121 (36%), Gaps = 11/121 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L+++  ++ V +  ++L+Q S      +  GS+ +    +  A  L + T +L F 
Sbjct: 1   MSGILLIIQFVLAVIITIIVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKTTFVLGFL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           F   +IALG    YT       +    + +     N      + P         +     
Sbjct: 61  FVVNTIALGYF--YTKDSQSSILDNVEIPA-----NPTPATPAVPTAPVAPQSDTQPNQQ 113

Query: 117 G 117
           G
Sbjct: 114 G 114


>gi|296116176|ref|ZP_06834794.1| preprotein translocase, SecG subunit [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295977282|gb|EFG84042.1| preprotein translocase, SecG subunit [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 101

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 42/100 (42%), Gaps = 5/100 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
           M   L+++HL V V L+  ILIQ S+    G        +F S R TA  L R TA+L  
Sbjct: 1   MITVLLLLHLFVTVALIGTILIQRSEGGGLGIGSSQGMGSFMSGRGTATLLTRSTAVLGT 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF 95
            F   S+ L +++R  S+    ++                
Sbjct: 61  IFMVLSLTLAIMNRGASSGVGHDILAQPAAPSVPATTTPA 100


>gi|121634200|ref|YP_974445.1| preprotein translocase subunit SecG [Neisseria meningitidis FAM18]
 gi|161869327|ref|YP_001598494.1| preprotein translocase subunit SecG [Neisseria meningitidis 053442]
 gi|120865906|emb|CAM09643.1| putative protein-export integral membrane protein [Neisseria
           meningitidis FAM18]
 gi|161594880|gb|ABX72540.1| protein-export integral membrane protein [Neisseria meningitidis
           053442]
 gi|325131529|gb|EGC54236.1| preprotein translocase, SecG subunit [Neisseria meningitidis M6190]
 gi|325139217|gb|EGC61763.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           ES14902]
 gi|325141582|gb|EGC64048.1| preprotein translocase, SecG subunit [Neisseria meningitidis
           961-5945]
 gi|325197614|gb|ADY93070.1| preprotein translocase, SecG subunit [Neisseria meningitidis G2136]
          Length = 116

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 45/109 (41%), Gaps = 8/109 (7%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA--------FGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + +V++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5   KTLIWIVNIISALAVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
           A FFFAT +A+  I  +T+    D  +           ++       P+
Sbjct: 65  ATFFFATCMAMVYIHTHTTKYGLDFSNVQQTQQAPKPISNTEPSAPVPQ 113


>gi|254511065|ref|ZP_05123132.1| preprotein translocase, SecG subunit [Rhodobacteraceae bacterium
           KLH11]
 gi|221534776|gb|EEE37764.1| preprotein translocase, SecG subunit [Rhodobacteraceae bacterium
           KLH11]
          Length = 122

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 46/109 (42%), Gaps = 3/109 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA---HSLGRFTAILAFFF 57
           M+  ++++HL++ +GL+ V+L+Q S+    G         +      +LG+ T ILA  F
Sbjct: 1   MENVVLIIHLLLALGLIAVVLMQRSEGGGLGMGGGGGGAMTGRAAATALGKLTWILAACF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSV 106
             TS+ L +++   S+         +      + +      +   L   
Sbjct: 61  IVTSMTLTILAAQKSSGSSVIDRLGVPAPASAEESTPAVPSAEDLLPPS 109


>gi|299148695|ref|ZP_07041757.1| preprotein translocase, SecG subunit [Bacteroides sp. 3_1_23]
 gi|298513456|gb|EFI37343.1| preprotein translocase, SecG subunit [Bacteroides sp. 3_1_23]
          Length = 131

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 48/126 (38%), Gaps = 4/126 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M +  +++ +I  + +  ++LIQ+S        F SS+    VR T   L + T  LA F
Sbjct: 1   MYLLFVILMVIAALLMCFIVLIQNSKGGGLASGFSSSNAIMGVRKTTDFLEKATWGLAIF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               SIA   +   ++      + ++  +   +  N   G  +       +   ++   A
Sbjct: 61  MVVMSIATAYVVPRSAVVKDAVLEQAQKEQQTNPYNLPAGTAAPQTEAPATNAPATETPA 120

Query: 117 GKRSSS 122
               + 
Sbjct: 121 PATETP 126


>gi|121602235|ref|YP_988844.1| preprotein translocase subunit SecG [Bartonella bacilliformis
           KC583]
 gi|120614412|gb|ABM45013.1| preprotein translocase, SecG subunit [Bartonella bacilliformis
           KC583]
          Length = 149

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 45/127 (35%), Positives = 68/127 (53%), Gaps = 4/127 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+H ++V+ LV V+LIQ S+    G      F S R T ++L R TAILA  FF
Sbjct: 1   MQTVLIVIHFLIVIVLVGVVLIQPSEGGGLGVGGGSGFMSTRGTRNTLTRLTAILAICFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
            TSIAL ++    S    D ++R  V+S ++  N N  +G  P   + +  S    + G 
Sbjct: 61  VTSIALIVVGSI-SNSNLDILNRIPVNSEQNSINKNASEG-VPSPGNGTQPSILEQLGGA 118

Query: 119 RSSSRTK 125
            +SS+ +
Sbjct: 119 STSSQEQ 125


>gi|83644098|ref|YP_432533.1| preprotein translocase subunit SecG [Hahella chejuensis KCTC 2396]
 gi|83632141|gb|ABC28108.1| preprotein translocase, SecG subunit [Hahella chejuensis KCTC 2396]
          Length = 132

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 49/126 (38%), Gaps = 6/126 (4%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILAF 55
           +  +++VH+IV  G++ ++LIQ    +  G+S              +   L   T  LA 
Sbjct: 5   ETLIVIVHVIVAAGVIGLVLIQQGKGADMGASFGGGASQTVFGSSGSGSFLTNMTTTLAI 64

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            FF +S AL  +++  +++   +    +          +     +   ++   + ++   
Sbjct: 65  VFFLSSFALAYVAKQKASQVTASGVPVIETVSGSSSESDELSIDADSTNAGEVQGAAEAP 124

Query: 116 AGKRSS 121
           +  +  
Sbjct: 125 SDSKPE 130


>gi|212694610|ref|ZP_03302738.1| hypothetical protein BACDOR_04138 [Bacteroides dorei DSM 17855]
 gi|237711124|ref|ZP_04541605.1| preprotein translocase subunit SecG [Bacteroides sp. 9_1_42FAA]
 gi|237727490|ref|ZP_04557971.1| preprotein translocase subunit SecG [Bacteroides sp. D4]
 gi|265750711|ref|ZP_06086774.1| preprotein translocase subunit SecG [Bacteroides sp. 3_1_33FAA]
 gi|212663111|gb|EEB23685.1| hypothetical protein BACDOR_04138 [Bacteroides dorei DSM 17855]
 gi|229434346|gb|EEO44423.1| preprotein translocase subunit SecG [Bacteroides dorei 5_1_36/D4]
 gi|229454968|gb|EEO60689.1| preprotein translocase subunit SecG [Bacteroides sp. 9_1_42FAA]
 gi|263237607|gb|EEZ23057.1| preprotein translocase subunit SecG [Bacteroides sp. 3_1_33FAA]
          Length = 120

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 44/120 (36%), Gaps = 6/120 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M + L+ + ++  + +  V+LIQ+S       +F SS+    VR T   + + T  LA F
Sbjct: 1   MYLLLIGLIVLAALLMCFVVLIQNSKGGGLASSFASSNQIMGVRKTTDFIEKLTWGLAAF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF--GDGSSPKLDSVSAKSSSSV 114
             A S+          T     M  ++ +   +  N         +       A   S+ 
Sbjct: 61  MVACSVLTAYFVPTAHTDSSIIMEEAVKEGATNPLNAPSGFAAPQTNDAAETPAPGDSAQ 120


>gi|83754004|pdb|2AKH|X Chain X, Normal Mode-Based Flexible Fitted Coordinates Of A Non-
          Translocating Secyeg Protein-Conducting Channel Into
          The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome
          Complex From E. Coli
 gi|83754007|pdb|2AKH|A Chain A, Normal Mode-Based Flexible Fitted Coordinates Of A Non-
          Translocating Secyeg Protein-Conducting Channel Into
          The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome
          Complex From E. Coli
 gi|83754010|pdb|2AKI|X Chain X, Normal Mode-Based Flexible Fitted Coordinates Of A
          Translocating Secyeg Protein-Conducting Channel Into
          The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome
          Complex From E. Coli
 gi|83754013|pdb|2AKI|A Chain A, Normal Mode-Based Flexible Fitted Coordinates Of A
          Translocating Secyeg Protein-Conducting Channel Into
          The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome
          Complex From E. Coli
          Length = 77

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
          M   L+VV LIV +GLV +I++Q    +  G+S      +       + + + R TA+LA
Sbjct: 1  MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA 60

Query: 55 FFFFATSIALGMISRYT 71
            FF  S+ LG I+   
Sbjct: 61 TLFFIISLVLGNINSNK 77


>gi|161524203|ref|YP_001579215.1| preprotein translocase subunit SecG [Burkholderia multivorans
          ATCC 17616]
 gi|189351040|ref|YP_001946668.1| preprotein translocase subunit SecG [Burkholderia multivorans
          ATCC 17616]
 gi|221199655|ref|ZP_03572699.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD2M]
 gi|221205445|ref|ZP_03578460.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD2]
 gi|221211734|ref|ZP_03584713.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD1]
 gi|160341632|gb|ABX14718.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          ATCC 17616]
 gi|189335062|dbj|BAG44132.1| preprotein translocase SecG subunit [Burkholderia multivorans
          ATCC 17616]
 gi|221169095|gb|EEE01563.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD1]
 gi|221174283|gb|EEE06715.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD2]
 gi|221180940|gb|EEE13343.1| preprotein translocase, SecG subunit [Burkholderia multivorans
          CGD2M]
          Length = 125

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 6/93 (6%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
           FF  ++AL  I  Y ST     +         
Sbjct: 65 VFFVATLALTYIGSYKSTPSAGVLGGVATAPAP 97


>gi|254516620|ref|ZP_05128679.1| preprotein translocase, SecG subunit [gamma proteobacterium NOR5-3]
 gi|219675043|gb|EED31410.1| preprotein translocase, SecG subunit [gamma proteobacterium NOR5-3]
          Length = 150

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/138 (15%), Positives = 51/138 (36%), Gaps = 15/138 (10%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILAF 55
           +  ++V HL++ + ++ +I++Q    +  G+S              + + L R TA +  
Sbjct: 7   EQLVLVTHLLLSLAIIGLIILQQGKGADAGASFGAGASQTVFGSTGSGNVLTRATAWMVT 66

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND---------NFGDGSSPKLDSV 106
            FF TS  L +I++  ++   +       +S     +             +   P +D  
Sbjct: 67  LFFVTSFGLAVIAKNKTSAVDEFAIPVPTNSAPATLDAGMEAVDDMRPASESDLPVVDDS 126

Query: 107 SAKSSSSVVAGKRSSSRT 124
               S+        +++ 
Sbjct: 127 MPVMSAEGFEADGKAAQE 144


>gi|53718846|ref|YP_107832.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          K96243]
 gi|53725826|ref|YP_103435.1| preprotein translocase subunit SecG [Burkholderia mallei ATCC
          23344]
 gi|67642193|ref|ZP_00440953.1| preprotein translocase, SecG subunit [Burkholderia mallei GB8
          horse 4]
 gi|76810602|ref|YP_332843.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          1710b]
 gi|121599984|ref|YP_992468.1| preprotein translocase subunit SecG [Burkholderia mallei SAVP1]
 gi|124384029|ref|YP_001026729.1| preprotein translocase subunit SecG [Burkholderia mallei NCTC
          10229]
 gi|126441687|ref|YP_001058337.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          668]
 gi|126448705|ref|YP_001079986.1| preprotein translocase subunit SecG [Burkholderia mallei NCTC
          10247]
 gi|126451944|ref|YP_001065576.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          1106a]
 gi|134283962|ref|ZP_01770658.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          305]
 gi|167000369|ref|ZP_02266187.1| preprotein translocase, SecG subunit [Burkholderia mallei PRL-20]
 gi|167823451|ref|ZP_02454922.1| preprotein translocase subunit SecG [Burkholderia pseudomallei 9]
 gi|167893544|ref|ZP_02480946.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          7894]
 gi|167910226|ref|ZP_02497317.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          112]
 gi|167918259|ref|ZP_02505350.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          BCC215]
 gi|217419953|ref|ZP_03451459.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          576]
 gi|226195388|ref|ZP_03790977.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          Pakistan 9]
 gi|237811581|ref|YP_002896032.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          MSHR346]
 gi|242314803|ref|ZP_04813819.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1106b]
 gi|254175392|ref|ZP_04882052.1| preprotein translocase, SecG subunit [Burkholderia mallei ATCC
          10399]
 gi|254181188|ref|ZP_04887785.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1655]
 gi|254190551|ref|ZP_04897058.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          Pasteur 52237]
 gi|254195092|ref|ZP_04901521.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          S13]
 gi|254202111|ref|ZP_04908474.1| preprotein translocase, SecG subunit [Burkholderia mallei FMH]
 gi|254207441|ref|ZP_04913791.1| preprotein translocase, SecG subunit [Burkholderia mallei JHU]
 gi|254260244|ref|ZP_04951298.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1710a]
 gi|254298532|ref|ZP_04965984.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          406e]
 gi|254359863|ref|ZP_04976133.1| preprotein translocase, SecG subunit [Burkholderia mallei
          2002721280]
 gi|52209260|emb|CAH35205.1| general secretory pathway, protein-export membrane protein
          [Burkholderia pseudomallei K96243]
 gi|52429249|gb|AAU49842.1| preprotein translocase, SecG subunit [Burkholderia mallei ATCC
          23344]
 gi|76580055|gb|ABA49530.1| Preprotein translocase SecG subunit, putative [Burkholderia
          pseudomallei 1710b]
 gi|121228794|gb|ABM51312.1| preprotein translocase, SecG subunit [Burkholderia mallei SAVP1]
 gi|124292049|gb|ABN01318.1| preprotein translocase, SecG subunit [Burkholderia mallei NCTC
          10229]
 gi|126221180|gb|ABN84686.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          668]
 gi|126225586|gb|ABN89126.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1106a]
 gi|126241575|gb|ABO04668.1| preprotein translocase, SecG subunit [Burkholderia mallei NCTC
          10247]
 gi|134244751|gb|EBA44849.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          305]
 gi|147746358|gb|EDK53435.1| preprotein translocase, SecG subunit [Burkholderia mallei FMH]
 gi|147751335|gb|EDK58402.1| preprotein translocase, SecG subunit [Burkholderia mallei JHU]
 gi|148029103|gb|EDK87008.1| preprotein translocase, SecG subunit [Burkholderia mallei
          2002721280]
 gi|157808196|gb|EDO85366.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          406e]
 gi|157938226|gb|EDO93896.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          Pasteur 52237]
 gi|160696436|gb|EDP86406.1| preprotein translocase, SecG subunit [Burkholderia mallei ATCC
          10399]
 gi|169651840|gb|EDS84533.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          S13]
 gi|184211726|gb|EDU08769.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1655]
 gi|217397257|gb|EEC37273.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          576]
 gi|225932590|gb|EEH28588.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          Pakistan 9]
 gi|237503238|gb|ACQ95556.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          MSHR346]
 gi|238523289|gb|EEP86728.1| preprotein translocase, SecG subunit [Burkholderia mallei GB8
          horse 4]
 gi|242138042|gb|EES24444.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1106b]
 gi|243063703|gb|EES45889.1| preprotein translocase, SecG subunit [Burkholderia mallei PRL-20]
 gi|254218933|gb|EET08317.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei
          1710a]
          Length = 125

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV L+  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL  +  Y S      +
Sbjct: 64 TIFFVATLALTYLGSYKSAPSVGVL 88


>gi|289667381|ref|ZP_06488456.1| preprotein translocase subunit SecG [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 156

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/113 (17%), Positives = 44/113 (38%), Gaps = 6/113 (5%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA  F
Sbjct: 5   ILNVVYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLAVVF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
           F+ S+ +   + + +     N+      +              PK  + +  +
Sbjct: 65  FSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAGELTQPLPKAPAGAVPT 117


>gi|218129793|ref|ZP_03458597.1| hypothetical protein BACEGG_01372 [Bacteroides eggerthii DSM 20697]
 gi|317475861|ref|ZP_07935118.1| preprotein translocase [Bacteroides eggerthii 1_2_48FAA]
 gi|217987903|gb|EEC54228.1| hypothetical protein BACEGG_01372 [Bacteroides eggerthii DSM 20697]
 gi|316908021|gb|EFV29718.1| preprotein translocase [Bacteroides eggerthii 1_2_48FAA]
          Length = 120

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 49/120 (40%), Gaps = 5/120 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M + L+++ +I  + +  ++LIQ+S        F SS+    VR T   L + T  LA F
Sbjct: 1   MYLLLVILMVIASLLMCFIVLIQNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWGLAVF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               S+A   +    S +  D +        K    +     ++P+ ++  A +     A
Sbjct: 61  LVVMSVASAYVIPSASHKGGDVILEQAQQEEKTNPYNMPVGTAAPQAET-PAPAVGDSAA 119


>gi|304322179|ref|YP_003855822.1| hypothetical protein PB2503_13214 [Parvularcula bermudensis
           HTCC2503]
 gi|303301081|gb|ADM10680.1| hypothetical protein PB2503_13214 [Parvularcula bermudensis
           HTCC2503]
          Length = 138

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 47/123 (38%), Gaps = 3/123 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS---NFTSVRSTAHSLGRFTAILAFFF 57
           M   L+ +H ++V+ LV V+L+Q S+  A G      NF S R TA  L R T  L   F
Sbjct: 1   MTAVLLTLHTLIVIALVGVVLLQRSEGGALGMGGGGGNFLSGRGTADVLTRSTTALGAAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           FATS+ L + S    +  +        +                     +  + +   A 
Sbjct: 61  FATSLLLAITSDRGISAVELRQELIGEEEAAPTDPSEIDASDIFDFGDEAPTAPTPNPAA 120

Query: 118 KRS 120
             +
Sbjct: 121 DPA 123


>gi|29654740|ref|NP_820432.1| protein translocase subunit [Coxiella burnetii RSA 493]
 gi|153207275|ref|ZP_01946039.1| preprotein translocase, SecG subunit [Coxiella burnetii 'MSU Goat
          Q177']
 gi|154707766|ref|YP_001423955.1| protein translocase subunit [Coxiella burnetii Dugway 5J108-111]
 gi|161831118|ref|YP_001597294.1| preprotein translocase, SecG subunit [Coxiella burnetii RSA 331]
 gi|165918781|ref|ZP_02218867.1| preprotein translocase, SecG subunit [Coxiella burnetii RSA 334]
 gi|212212181|ref|YP_002303117.1| protein translocase subunit [Coxiella burnetii CbuG_Q212]
 gi|212218211|ref|YP_002304998.1| protein translocase subunit [Coxiella burnetii CbuK_Q154]
 gi|29542008|gb|AAO90946.1| protein translocase subunit [Coxiella burnetii RSA 493]
 gi|120576763|gb|EAX33387.1| preprotein translocase, SecG subunit [Coxiella burnetii 'MSU Goat
          Q177']
 gi|154357052|gb|ABS78514.1| protein translocase subunit [Coxiella burnetii Dugway 5J108-111]
 gi|161762985|gb|ABX78627.1| preprotein translocase, SecG subunit [Coxiella burnetii RSA 331]
 gi|165917505|gb|EDR36109.1| preprotein translocase, SecG subunit [Coxiella burnetii RSA 334]
 gi|212010591|gb|ACJ17972.1| protein translocase subunit [Coxiella burnetii CbuG_Q212]
 gi|212012473|gb|ACJ19853.1| protein translocase subunit [Coxiella burnetii CbuK_Q154]
          Length = 98

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 39/96 (40%), Gaps = 6/96 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
          MQ  ++++H+++ V L+ ++L+Q    +        GSS+           L + T  LA
Sbjct: 1  MQSIILIIHVLIAVCLIALVLLQHGKGADAGAAFGSGSSNTMFGSVGATPFLMKITIFLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
            FFATSI L  ++          +  +        
Sbjct: 61 AAFFATSIGLSYLASRHPGTMAPPLPSTQTAPPSVP 96


>gi|85708715|ref|ZP_01039781.1| hypothetical protein NAP1_05730 [Erythrobacter sp. NAP1]
 gi|85690249|gb|EAQ30252.1| hypothetical protein NAP1_05730 [Erythrobacter sp. NAP1]
          Length = 140

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 46/129 (35%), Gaps = 5/129 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG---SSSNFTSVRSTAHSLGRFTAILAFFF 57
           + I   V+  IV   LV V+L+Q S+    G   + S     R  A  L + T  LA  F
Sbjct: 3   LFIIFTVIQAIVAAALVGVVLMQRSEGGGLGIGGNPSGALGARGAADFLTKSTRWLAIAF 62

Query: 58  FATSIALGMISRYTST--RYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            A SI L  ++   S+      ++ R +                     + S  +    +
Sbjct: 63  VALSIFLAALAVSESSMGDVSTDLERDVNAPSAADLLGEGAPAGVSPDGAASDPADLEDL 122

Query: 116 AGKRSSSRT 124
            G+  ++  
Sbjct: 123 LGENPANTE 131


>gi|167765097|ref|ZP_02437210.1| hypothetical protein BACSTE_03483 [Bacteroides stercoris ATCC
           43183]
 gi|167696725|gb|EDS13304.1| hypothetical protein BACSTE_03483 [Bacteroides stercoris ATCC
           43183]
 gi|290770015|gb|ADD61781.1| putative protein [uncultured organism]
          Length = 131

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 25/109 (22%), Positives = 45/109 (41%), Gaps = 4/109 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M + L+++ +I  + +  ++LIQ+S        F SS+    VR T   L + T  LA F
Sbjct: 1   MYLLLVILMVIASILMCFIVLIQNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWSLAVF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
               S+A   +    S +  D +        K    +     ++PK + 
Sbjct: 61  LVVMSVASAYVIPSASHKGGDVILEQAQQEEKTNPYNMPVGTAAPKAEQ 109


>gi|296136707|ref|YP_003643949.1| preprotein translocase, SecG subunit [Thiomonas intermedia K12]
 gi|294340862|emb|CAZ89257.1| putative Preprotein translocase SecG subunit [Thiomonas sp. 3As]
 gi|295796829|gb|ADG31619.1| preprotein translocase, SecG subunit [Thiomonas intermedia K12]
          Length = 141

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/127 (15%), Positives = 48/127 (37%), Gaps = 7/127 (5%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFF 56
              +VV ++  + ++ ++L+Q    +  G+S       +      +A+ L R TA+ A  
Sbjct: 6   TLTLVVQILSALVMIVLVLMQHGKGADMGASFGSGASGSLFGATGSANFLSRSTAVAATL 65

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF-GDGSSPKLDSVSAKSSSSVV 115
           FF T++ +       ++     M +    +            G   ++  V +  S +  
Sbjct: 66  FFVTTLMMAYFGNRANSGDGGLMEKLAAPAPVASVAAPAKPAGPISEIPGVPSAVSKASQ 125

Query: 116 AGKRSSS 122
           A  +  +
Sbjct: 126 ATTQPKT 132


>gi|209518516|ref|ZP_03267337.1| preprotein translocase, SecG subunit [Burkholderia sp. H160]
 gi|209501061|gb|EEA01096.1| preprotein translocase, SecG subunit [Burkholderia sp. H160]
          Length = 128

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 45/96 (46%), Gaps = 6/96 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
            FFAT++AL  +  Y        +  +    +   
Sbjct: 64 ALFFATTLALTYLGAYHVKPSAGLLGAAATAPVATS 99


>gi|325524620|gb|EGD02634.1| preprotein translocase subunit SecG [Burkholderia sp. TJI49]
          Length = 117

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y ST     +
Sbjct: 65 IFFVATLALTYLGSYKSTPSAGVL 88


>gi|254491798|ref|ZP_05104977.1| preprotein translocase, SecG subunit [Methylophaga thiooxidans
           DMS010]
 gi|224463276|gb|EEF79546.1| preprotein translocase, SecG subunit [Methylophaga thiooxydans
           DMS010]
          Length = 110

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/108 (21%), Positives = 44/108 (40%), Gaps = 11/108 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV-----------RSTAHSLGRF 49
           M   ++ +H+IV + LV  +LIQ    +  G++                 + +A  L R 
Sbjct: 1   MHALILTIHIIVCLMLVGFVLIQHGKGADAGAAFGGGGGGGGASGSLFGSQGSASFLSRT 60

Query: 50  TAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGD 97
           +AILA  FF TS+ L   S     + +     +  +   ++   +  +
Sbjct: 61  SAILAAIFFMTSLTLAYFSVDRPDKVQSVTQTAPAEQKIEETPADLPE 108


>gi|315499881|ref|YP_004088684.1| preprotein translocase, secg subunit [Asticcacaulis excentricus
          CB 48]
 gi|315417893|gb|ADU14533.1| preprotein translocase, SecG subunit [Asticcacaulis excentricus
          CB 48]
          Length = 180

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 3/83 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS---SSNFTSVRSTAHSLGRFTAILAFFF 57
          + + L+ + +++ + LV +IL+Q S+  A G     S F S R   + L + T+ILAF F
Sbjct: 2  LFVILLSIQILIGIALVGLILVQRSEGGALGMGGGPSGFMSARGAGNFLTKATSILAFLF 61

Query: 58 FATSIALGMISRYTSTRYKDNMH 80
          FA  IAL ++S            
Sbjct: 62 FANCIALTVVSNLDRRGTSVVDQ 84


>gi|52842988|ref|YP_096787.1| preprotein translocase subunit SecG [Legionella pneumophila
          subsp. pneumophila str. Philadelphia 1]
 gi|52630099|gb|AAU28840.1| preprotein translocase, SecG subunit [Legionella pneumophila
          subsp. pneumophila str. Philadelphia 1]
          Length = 101

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 35/94 (37%), Gaps = 6/94 (6%)

Query: 8  VHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAFFFFATS 61
          +H+++ V L+ ++LIQ    +        G+S+     + T   L + T  LA  FF TS
Sbjct: 2  IHVLIAVILIGLVLIQHGKGADIGAAFGSGASNTLFGSQGTGGFLFKLTGGLAITFFITS 61

Query: 62 IALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF 95
          + L  +    + +           +         
Sbjct: 62 LMLSYMVSTQNQKAGQLAIPQQTGAPVSSVPVPV 95


>gi|33591973|ref|NP_879617.1| preprotein translocase subunit SecG [Bordetella pertussis Tohama I]
 gi|33571617|emb|CAE41107.1| protein-export membrane protein [Bordetella pertussis Tohama I]
          Length = 148

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 19/116 (16%), Positives = 37/116 (31%), Gaps = 9/116 (7%)

Query: 15  GLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMIS 68
            ++ ++L+Q    +  GS+       +       A+ L R T   A  FF ++  L  ++
Sbjct: 18  AIIVLVLLQQGKGADMGSAFGSGSAGSLFGATGAANFLSRTTKWAAVVFFVSTAGLAYVT 77

Query: 69  RYTSTRY---KDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSS 121
               +        M     D    Q   +   GS   +         +  A   +S
Sbjct: 78  HKGPSGPAIDSGVMQNFPQDRSVPQAPGSAPAGSGSSVPQAPGSGVPAAPAQPDAS 133


>gi|46204719|ref|ZP_00209534.1| COG1314: Preprotein translocase subunit SecG [Magnetospirillum
          magnetotacticum MS-1]
          Length = 98

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 32/98 (32%), Positives = 49/98 (50%), Gaps = 7/98 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          MQ  L+VVHLI+V+ L+ V+L+Q S+               F + R  A++L R TAILA
Sbjct: 1  MQTVLIVVHLIIVLALIAVVLLQRSEGGLGLGVGVGGGVSGFMTGRGQANALTRSTAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
            FF TSI L ++S + S   +  +  +         +
Sbjct: 61 ALFFTTSITLAIMS-HRSAAPRSILDGTGQQGQTQATS 97


>gi|91782611|ref|YP_557817.1| preprotein translocase subunit SecG [Burkholderia xenovorans
          LB400]
 gi|91686565|gb|ABE29765.1| protein translocase subunit secG [Burkholderia xenovorans LB400]
          Length = 128

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 41/81 (50%), Gaps = 6/81 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          ++  ++VV L+  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 4  LKTLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRY 75
            FF T++ L  +  Y +   
Sbjct: 64 AVFFITTLTLTYLGAYRAKPS 84


>gi|170733610|ref|YP_001765557.1| preprotein translocase subunit SecG [Burkholderia cenocepacia
          MC0-3]
 gi|169816852|gb|ACA91435.1| preprotein translocase, SecG subunit [Burkholderia cenocepacia
          MC0-3]
          Length = 120

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +  G+      S +      +A+ L R T ILA 
Sbjct: 5  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y ST     +
Sbjct: 65 IFFVATLALTYLGSYKSTPSAGVL 88


>gi|162139843|ref|YP_318446.2| preprotein translocase subunit SecG [Nitrobacter winogradskyi
           Nb-255]
          Length = 124

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 3/102 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  ++V+HLI+V  L  V+L+Q S+    G      F S R TA+ L R T+ LA  FF
Sbjct: 1   MQTAVIVIHLIIVATLTVVVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTSFLAAGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
            TS+ L  ++     +    +  +     +         G  
Sbjct: 61  VTSLLLSWLAGVE-QKPGSILDTAPASQSQPATPVAPPSGGG 101


>gi|254247656|ref|ZP_04940977.1| Preprotein translocase subunit SecG [Burkholderia cenocepacia
          PC184]
 gi|124872432|gb|EAY64148.1| Preprotein translocase subunit SecG [Burkholderia cenocepacia
          PC184]
          Length = 128

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAF 55
          +  ++VV ++  +G++ ++L+Q    +  G+      S +      +A+ L R T ILA 
Sbjct: 8  KTLIIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTGILAT 67

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL  +  Y ST     +
Sbjct: 68 IFFVATLALTYLGSYKSTPSAGVL 91


>gi|149194779|ref|ZP_01871874.1| hypothetical protein CMTB2_05342 [Caminibacter mediatlanticus TB-2]
 gi|149135202|gb|EDM23683.1| hypothetical protein CMTB2_05342 [Caminibacter mediatlanticus TB-2]
          Length = 107

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 15/109 (13%), Positives = 42/109 (38%), Gaps = 7/109 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   LM++ +++V+ +  ++L+Q S+     +   S+++        + L + T  L   
Sbjct: 1   MTGILMIIQIVLVIAITILVLLQRSESMGLGAYSSSNNSVFGAGGPMNFLTKATMTLGLL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
           F   ++ L  +    +      +    +  I+          + P+  +
Sbjct: 61  FVLNTLTLVYLYNKQAN--TSALDNVNIKKIEKTTPTPQV-PTVPQTPT 106


>gi|222055982|ref|YP_002538344.1| preprotein translocase, SecG subunit [Geobacter sp. FRC-32]
 gi|221565271|gb|ACM21243.1| preprotein translocase, SecG subunit [Geobacter sp. FRC-32]
          Length = 128

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/108 (18%), Positives = 40/108 (37%), Gaps = 6/108 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
           M   L+++H+IV + L+ ++L+QS   +  G       S +          L + T   A
Sbjct: 1   MTTLLVILHIIVSLALIVIVLLQSGKGAEMGASFGAGGSQSVFGAGGGTTFLSKLTTSAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             F  TS+ L  +S    +    +  +    + +           S +
Sbjct: 61  IIFMLTSLTLAFLSGKGGSSSIMSSKQKAKPAQQVPAQAPAQKQPSGQ 108


>gi|166712615|ref|ZP_02243822.1| preprotein translocase subunit SecG [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 157

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 44/114 (38%), Gaps = 6/114 (5%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA  F
Sbjct: 5   ILNVVYVLVALAMIALILMQRGAGAAAGSGFGAAASGTVFGSQGASNFLSKSTKWLAVVF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
           F+ S+ +   + + +     N+      +              P+  +  A  +
Sbjct: 65  FSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAGELTQPLPQAPAAGAVPT 118


>gi|189424678|ref|YP_001951855.1| preprotein translocase subunit SecG [Geobacter lovleyi SZ]
 gi|189420937|gb|ACD95335.1| preprotein translocase, SecG subunit [Geobacter lovleyi SZ]
          Length = 112

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 15/94 (15%), Positives = 38/94 (40%), Gaps = 6/94 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
          M   + ++H+++ + ++ V+L+QS   +  G       S +        + + + T   A
Sbjct: 1  MTTLIAILHVLISLFIIGVVLLQSGKGAEMGASFGSGGSQSVFGAGGGGNFMTKLTTAAA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
            F  TS+ L  +S +       +  ++   +  
Sbjct: 61 IIFMLTSLTLAYLSGHMPASSIMSGKQAQKPAPA 94


>gi|311104463|ref|YP_003977316.1| preprotein translocase, SecG subunit [Achromobacter xylosoxidans
           A8]
 gi|310759152|gb|ADP14601.1| preprotein translocase, SecG subunit [Achromobacter xylosoxidans
           A8]
          Length = 168

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 42/117 (35%), Gaps = 9/117 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+ V +I  + ++ ++L+Q    +  GS+       +       A+ L R T   A
Sbjct: 4   MLKILLAVQVISALAIIVLVLLQQGKGADMGSAFGSGSAGSLFGATGAANFLSRATKWAA 63

Query: 55  FFFFATSIALGMISRYTSTRY---KDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             FFA++  L  +S   ++        M     D    Q        +   +   S+
Sbjct: 64  VVFFASTAGLAYVSHKGTSGPAVDSGVMQSFPADRSVPQVPGAAPAPAGSSVPGASS 120


>gi|325921412|ref|ZP_08183269.1| protein translocase subunit secG [Xanthomonas gardneri ATCC 19865]
 gi|325548170|gb|EGD19167.1| protein translocase subunit secG [Xanthomonas gardneri ATCC 19865]
          Length = 157

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/116 (17%), Positives = 45/116 (38%), Gaps = 6/116 (5%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA  F
Sbjct: 5   ILNVVYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLAVVF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
           F+ S+ +   + + +     N+      +              P+  +  A  ++ 
Sbjct: 65  FSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAGELTQPLPQAPAAGAVPTAP 120


>gi|225025168|ref|ZP_03714360.1| hypothetical protein EIKCOROL_02062 [Eikenella corrodens ATCC
           23834]
 gi|224942129|gb|EEG23338.1| hypothetical protein EIKCOROL_02062 [Eikenella corrodens ATCC
           23834]
          Length = 114

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 40/110 (36%), Gaps = 6/110 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAF 55
           +  +M++     + ++ ++L+Q    +        GS+        +A+ L R TAI A 
Sbjct: 5   KTLIMIIGGFASIAVIGLVLMQQGKGADAGAAFGTGSAQGVFGSAGSANFLSRSTAIAAT 64

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
            FF   +AL +IS    +  K  +                   S P +  
Sbjct: 65  VFFCCCLALSIISSKQGSGNKLGLDAPAAAQHHAPAASQPATASQPVIPE 114


>gi|29349786|ref|NP_813289.1| preprotein translocase subunit SecG [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29341697|gb|AAO79483.1| putative protein-export membrane protein [Bacteroides
           thetaiotaomicron VPI-5482]
          Length = 131

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 25/126 (19%), Positives = 51/126 (40%), Gaps = 4/126 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M +  +++ +I  + +  ++LIQ+S        F SS+    VR T   L + T  LA F
Sbjct: 1   MYLLFIILMVIAALLMCFIVLIQNSKGGGLASGFSSSNAIMGVRKTTDFLEKATWGLAIF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               S+A   +   +S      + ++  +   +  N   G  +     +  A+S+ +  A
Sbjct: 61  MVVMSVATAYVVPSSSAAKDVLLEQAQKEQQTNPYNMPTGTAAPQTDATAPAESAPATEA 120

Query: 117 GKRSSS 122
               + 
Sbjct: 121 PATETP 126


>gi|329956943|ref|ZP_08297511.1| preprotein translocase, SecG subunit [Bacteroides clarus YIT 12056]
 gi|328523700|gb|EGF50792.1| preprotein translocase, SecG subunit [Bacteroides clarus YIT 12056]
          Length = 131

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 25/109 (22%), Positives = 45/109 (41%), Gaps = 4/109 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M + L+++ +I  V +  ++LIQ+S        F SS+    VR T   L + T  LA F
Sbjct: 1   MYLLLVILMVIASVLMCFIVLIQNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWSLAVF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
               S+A   +    S +  D +        K    +     ++P+ + 
Sbjct: 61  LVVMSVASAYVIPSVSHKGGDVILEQAQQEEKTNPYNMPVGTAAPQAEQ 109


>gi|113867069|ref|YP_725558.1| preprotein translocase subunit SecG [Ralstonia eutropha H16]
 gi|113525845|emb|CAJ92190.1| preprotein translocase subunit SecG [Ralstonia eutropha H16]
          Length = 124

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  L+V+ ++  +G++ ++LIQ    +        G+S +      +A+ L R TA+LA 
Sbjct: 5  KTLLVVLQVLSALGVIGLVLIQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAVLAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL ++  Y        M
Sbjct: 65 LFFVCTLALTLLGNYKPAASLGVM 88


>gi|149375758|ref|ZP_01893526.1| preprotein translocase, SecG subunit [Marinobacter algicola DG893]
 gi|149359883|gb|EDM48339.1| preprotein translocase, SecG subunit [Marinobacter algicola DG893]
          Length = 126

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/110 (18%), Positives = 48/110 (43%), Gaps = 6/110 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAF 55
           +  ++V+H+++ V LV ++L+Q    +  G++              ++  L R T +LA 
Sbjct: 5   ETLVVVLHVLIAVALVTLVLLQQGKGANAGAAFGGGASQTVFGSEGSSSFLTRATTLLAI 64

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
            FF TS +L + ++  +    +     + +S            S+ + ++
Sbjct: 65  VFFVTSFSLAVFAKQRAEVAGEAGIPVVQESPAASDAGQAEGDSATESEA 114


>gi|257424899|ref|ZP_05601326.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 55/2053]
 gi|257427567|ref|ZP_05603966.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 65-1322]
 gi|257430198|ref|ZP_05606582.1| preprotein translocase [Staphylococcus aureus subsp. aureus
          68-397]
 gi|257432899|ref|ZP_05609259.1| preprotein translocase [Staphylococcus aureus subsp. aureus
          E1410]
 gi|257435803|ref|ZP_05611851.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus M876]
 gi|257794900|ref|ZP_05643879.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A9781]
 gi|258418217|ref|ZP_05682482.1| preprotein translocase subunit SecG [Staphylococcus aureus A9763]
 gi|258421514|ref|ZP_05684439.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A9719]
 gi|258423428|ref|ZP_05686319.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A9635]
 gi|258439143|ref|ZP_05690187.1| translocase [Staphylococcus aureus A9299]
 gi|258440929|ref|ZP_05690764.1| translocase [Staphylococcus aureus A8115]
 gi|258445759|ref|ZP_05693936.1| preprotein translocase [Staphylococcus aureus A6300]
 gi|258449571|ref|ZP_05697673.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A6224]
 gi|282895074|ref|ZP_06303295.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A8117]
 gi|282903410|ref|ZP_06311301.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus C160]
 gi|282905189|ref|ZP_06313046.1| preprotein translocase SecG subunit [Staphylococcus aureus subsp.
          aureus Btn1260]
 gi|282908168|ref|ZP_06315999.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus WW2703/97]
 gi|282910426|ref|ZP_06318230.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus WBG10049]
 gi|282913622|ref|ZP_06321411.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus M899]
 gi|282916122|ref|ZP_06323885.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus D139]
 gi|282918573|ref|ZP_06326310.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus C427]
 gi|282922077|ref|ZP_06329774.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A9765]
 gi|282923539|ref|ZP_06331219.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus C101]
 gi|282926646|ref|ZP_06334276.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A10102]
 gi|283769942|ref|ZP_06342834.1| protein-export membrane protein secG [Staphylococcus aureus
          subsp. aureus H19]
 gi|283957612|ref|ZP_06375065.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus A017934/97]
 gi|293500664|ref|ZP_06666515.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 58-424]
 gi|293509613|ref|ZP_06668324.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus M809]
 gi|293524199|ref|ZP_06670886.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus M1015]
 gi|87127136|gb|ABD21650.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus USA300_FPR3757]
 gi|87202119|gb|ABD29929.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus NCTC 8325]
 gi|257272469|gb|EEV04592.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 55/2053]
 gi|257275760|gb|EEV07233.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 65-1322]
 gi|257279395|gb|EEV09996.1| preprotein translocase [Staphylococcus aureus subsp. aureus
          68-397]
 gi|257282314|gb|EEV12449.1| preprotein translocase [Staphylococcus aureus subsp. aureus
          E1410]
 gi|257284994|gb|EEV15113.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus M876]
 gi|257788872|gb|EEV27212.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A9781]
 gi|257839010|gb|EEV63489.1| preprotein translocase subunit SecG [Staphylococcus aureus A9763]
 gi|257842440|gb|EEV66864.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A9719]
 gi|257846489|gb|EEV70512.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A9635]
 gi|257847715|gb|EEV71712.1| translocase [Staphylococcus aureus A9299]
 gi|257852443|gb|EEV76364.1| translocase [Staphylococcus aureus A8115]
 gi|257855335|gb|EEV78273.1| preprotein translocase [Staphylococcus aureus A6300]
 gi|257857079|gb|EEV79978.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A6224]
 gi|282314407|gb|EFB44797.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus C101]
 gi|282317707|gb|EFB48079.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus C427]
 gi|282320070|gb|EFB50417.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus D139]
 gi|282322654|gb|EFB52976.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus M899]
 gi|282325818|gb|EFB56126.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus WBG10049]
 gi|282327833|gb|EFB58115.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus WW2703/97]
 gi|282331596|gb|EFB61108.1| preprotein translocase SecG subunit [Staphylococcus aureus subsp.
          aureus Btn1260]
 gi|282591539|gb|EFB96611.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A10102]
 gi|282593735|gb|EFB98727.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A9765]
 gi|282596365|gb|EFC01326.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus C160]
 gi|282762570|gb|EFC02709.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A8117]
 gi|283460089|gb|EFC07179.1| protein-export membrane protein secG [Staphylococcus aureus
          subsp. aureus H19]
 gi|283791063|gb|EFC29878.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus A017934/97]
 gi|290921162|gb|EFD98223.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus M1015]
 gi|291095669|gb|EFE25930.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 58-424]
 gi|291467710|gb|EFF10225.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus M809]
          Length = 91

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 31/76 (40%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M  FL+V+ +I  + L+ V+L+Q         +  G +         R     L R T I
Sbjct: 15 MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII 74

Query: 53 LAFFFFATSIALGMIS 68
          L+  FF   I +  + 
Sbjct: 75 LSILFFVLMICISYLG 90


>gi|194289158|ref|YP_002005065.1| preprotein translocase subunit SecG [Cupriavidus taiwanensis LMG
          19424]
 gi|193222993|emb|CAQ68998.1| preprotein translocase membrane subunit [Cupriavidus taiwanensis
          LMG 19424]
          Length = 124

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  L+V+ ++  +G++ ++LIQ    +        G+S +      +A+ L R TA+LA 
Sbjct: 5  KTLLVVLQVLSALGVIGLVLIQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAVLAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  ++AL ++  Y        M
Sbjct: 65 LFFVCTLALTLLGNYKPAASLGVM 88


>gi|325281005|ref|YP_004253547.1| preprotein translocase, SecG subunit [Odoribacter splanchnicus DSM
           20712]
 gi|324312814|gb|ADY33367.1| preprotein translocase, SecG subunit [Odoribacter splanchnicus DSM
           20712]
          Length = 120

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/110 (18%), Positives = 37/110 (33%), Gaps = 4/110 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   + V+  I+ V L+ ++L+Q+S       +F SS+    VR T   L + T  LA  
Sbjct: 1   MYTAISVLIFIICVLLILIVLVQNSKGGGLASSFASSNQIMGVRKTTDFLEKATWTLAGG 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSV 106
                +             K  +   +      Q        +    ++ 
Sbjct: 61  MMILCVLATFFIPRGENAVKSAIQEQIEAQPVQQQTIPTFPTNPGAGENA 110


>gi|167737851|ref|ZP_02410625.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          14]
          Length = 100

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV L+  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL  +  Y S      +
Sbjct: 64 TIFFVATLALTYLGSYKSAPSVGVL 88


>gi|288958210|ref|YP_003448551.1| SecG protein [Azospirillum sp. B510]
 gi|288910518|dbj|BAI72007.1| SecG protein [Azospirillum sp. B510]
          Length = 107

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 44/82 (53%), Gaps = 4/82 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT----SVRSTAHSLGRFTAILAFF 56
          M+  ++V+HL++ VGLV VILIQ S+    G          S R TA+ L R T ILA  
Sbjct: 1  MESVILVIHLLIAVGLVGVILIQRSEGGGLGIGGGTMGGMMSTRGTANLLTRTTGILAGC 60

Query: 57 FFATSIALGMISRYTSTRYKDN 78
          FFATSI L +++   S      
Sbjct: 61 FFATSIVLAILAGGHSRPASII 82


>gi|58582860|ref|YP_201876.1| preprotein translocase subunit SecG [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|162319797|ref|YP_452097.2| preprotein translocase subunit SecG [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|58427454|gb|AAW76491.1| protein-export membrane protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 153

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 45/114 (39%), Gaps = 6/114 (5%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA  F
Sbjct: 5   ILNVVYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLAVVF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
           F+ S+ +   + + +     N+      ++             P+  +  A  +
Sbjct: 65  FSISLFMAWYATHGARPTDQNLGVMSQSAMPAPAAAGELTQPLPQAPAAGAVPT 118


>gi|253569850|ref|ZP_04847259.1| preprotein translocase subunit SecG [Bacteroides sp. 1_1_6]
 gi|298384055|ref|ZP_06993616.1| preprotein translocase SecG subunit [Bacteroides sp. 1_1_14]
 gi|251840231|gb|EES68313.1| preprotein translocase subunit SecG [Bacteroides sp. 1_1_6]
 gi|298263659|gb|EFI06522.1| preprotein translocase SecG subunit [Bacteroides sp. 1_1_14]
          Length = 131

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 25/126 (19%), Positives = 51/126 (40%), Gaps = 4/126 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M +  +++ +I  + +  ++LIQ+S        F SS+    VR T   L + T  LA F
Sbjct: 1   MYLLFIILMVIAALLMCFIVLIQNSKGGGLASGFSSSNAIMGVRKTTDFLEKATWGLAIF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               S+A   +   +S      + ++  +   +  N   G  +     +  A+S+ +  A
Sbjct: 61  MVVMSVATAYVVPSSSAAKDVLLEQAQKEQQTNPYNMPTGTAAPQTDATAPAESAPATEA 120

Query: 117 GKRSSS 122
               + 
Sbjct: 121 PATETP 126


>gi|224538719|ref|ZP_03679258.1| hypothetical protein BACCELL_03613 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224519661|gb|EEF88766.1| hypothetical protein BACCELL_03613 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 125

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 47/106 (44%), Gaps = 4/106 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M +FL+++ ++  + +  ++LIQ+S        F SS+    VR T   L + T  LA F
Sbjct: 1   MYLFLVILMVVASLLMCFIVLIQNSKGGGLASGFSSSNQIMGVRKTTDFLEKGTWFLAGF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
               SIA   +   +S++  D +        K    +     ++P+
Sbjct: 61  MVVMSIATAYVVPTSSSKGGDVILEQAQKEEKTNPYNMPTGTAAPQ 106


>gi|294083770|ref|YP_003550527.1| preprotein translocase SecG subunit [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663342|gb|ADE38443.1| preprotein translocase SecG subunit [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 103

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 43/102 (42%), Gaps = 5/102 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
           MQ  ++ +H+++ +GLV  +L+Q S+    G         F + R TA+ + R T +LA 
Sbjct: 1   MQTLVLTIHILIALGLVGAVLLQRSEGGGLGIGGGGSGGGFMTARGTANLMTRVTTVLAA 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGD 97
            FF TSI L +++                      G     D
Sbjct: 61  GFFTTSIILAIMAGAGKESVSIVDDVINNTPAPVSGPAVPTD 102


>gi|163733287|ref|ZP_02140730.1| preprotein translocase, SecG subunit, putative [Roseobacter
           litoralis Och 149]
 gi|161393075|gb|EDQ17401.1| preprotein translocase, SecG subunit, putative [Roseobacter
           litoralis Och 149]
          Length = 121

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 50/118 (42%), Gaps = 3/118 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA---HSLGRFTAILAFFF 57
           M+  ++++HLI+ +GL+ V+L+Q S+    G         +      +LG+ T  LA  F
Sbjct: 1   MENVVLIIHLILALGLIAVVLLQRSEGGGLGMGGGGGGAMTGRAAATALGKVTWALAIAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
             TS+ L + +   ++         +     D+ +      S   L   + +++  V 
Sbjct: 61  ICTSMTLTIFAAENASGSSVIDRLGVTPPAADRSDTPGVPESDLLLPPSADENAPLVP 118


>gi|255693927|ref|ZP_05417602.1| putative Preprotein translocase SecG subunit [Bacteroides
           finegoldii DSM 17565]
 gi|260620238|gb|EEX43109.1| putative Preprotein translocase SecG subunit [Bacteroides
           finegoldii DSM 17565]
          Length = 131

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 48/126 (38%), Gaps = 4/126 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M +  +++ +I  + +  ++LIQ+S        F SS+    VR T   L + T  LA F
Sbjct: 1   MYLLFVILMVIAALLMCFIVLIQNSKGGGLASGFSSSNAIMGVRKTTDFLEKTTWGLAIF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               SIA   +   ++      + ++  +   +  N   G  +       +   ++   A
Sbjct: 61  MVVMSIATAYVVPSSAVATDAVLEQAQKEQQTNPYNLPAGTAAPQTEAPAADAPATETPA 120

Query: 117 GKRSSS 122
               + 
Sbjct: 121 PATETP 126


>gi|254524736|ref|ZP_05136791.1| protein-export membrane protein [Stenotrophomonas sp. SKA14]
 gi|219722327|gb|EED40852.1| protein-export membrane protein [Stenotrophomonas sp. SKA14]
          Length = 145

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 22/107 (20%), Positives = 41/107 (38%), Gaps = 8/107 (7%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L VV+++V V ++ +IL+Q    +A GS             R  ++ L + T  LA  F
Sbjct: 5   ILNVVYVLVAVAMIALILMQRGSGAAAGSGFGAGASGTVFGARGASNFLSKSTKWLAVVF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
           F  S+ +   + + +    D     +            G+   P + 
Sbjct: 65  FGISLFMAWYAGHGTRPAADQDLGLMSAPAASAPAAPAGE--LPAVP 109


>gi|189467721|ref|ZP_03016506.1| hypothetical protein BACINT_04113 [Bacteroides intestinalis DSM
           17393]
 gi|189435985|gb|EDV04970.1| hypothetical protein BACINT_04113 [Bacteroides intestinalis DSM
           17393]
          Length = 128

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 46/106 (43%), Gaps = 4/106 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M +FL+++ ++  + +  ++LIQ+S        F SS+    VR T   L + T  LA F
Sbjct: 1   MYLFLVILMVVASLLMCFIVLIQNSKGGGLASGFSSSNQIMGVRKTTDFLEKGTWFLAGF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
               SIA   +   +S +  D +        K    +     ++P+
Sbjct: 61  MVVMSIATAYVVPTSSGKGGDVILEQAQKEEKTNPYNMPTGTAAPQ 106


>gi|39996727|ref|NP_952678.1| preprotein translocase subunit SecG [Geobacter sulfurreducens
          PCA]
 gi|39983608|gb|AAR35001.1| preprotein translocase, SecG subunit [Geobacter sulfurreducens
          PCA]
 gi|298505738|gb|ADI84461.1| preprotein translocase, SecG subunit [Geobacter sulfurreducens
          KN400]
          Length = 122

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 34/81 (41%), Gaps = 6/81 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
          M IFL  +H++V + L+ ++L+QS   +  G       S +          L + T   A
Sbjct: 1  MMIFLTFLHILVCLALIGIVLLQSGKGAEMGASFGAGGSQSVFGASGGTTFLSKLTTAAA 60

Query: 55 FFFFATSIALGMISRYTSTRY 75
            F  TS+ L  +S    T  
Sbjct: 61 IIFMLTSLTLAYLSGRAETSS 81


>gi|84502702|ref|ZP_01000821.1| Preprotein translocase SecG subunit [Oceanicola batsensis HTCC2597]
 gi|84389097|gb|EAQ01895.1| Preprotein translocase SecG subunit [Oceanicola batsensis HTCC2597]
          Length = 122

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 48/123 (39%), Gaps = 4/123 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA---HSLGRFTAILAFFF 57
           M+  ++++HL + + L+ V+L+Q S+    G         S      +LG+ T ILA  F
Sbjct: 1   MENVVLIIHLFLALALIGVVLLQKSEGGGLGMGGGGGGAMSGRAAATALGKVTWILAAAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
             TSIAL +I+   ST     + R        Q  +              A S+   +  
Sbjct: 61  IGTSIALTIIAADKST-GASVLDRLAPTGAVPQEMEEVPALPDGGSLLPPAPSTGGDLTP 119

Query: 118 KRS 120
              
Sbjct: 120 SAD 122


>gi|254464934|ref|ZP_05078345.1| preprotein translocase, SecG subunit [Rhodobacterales bacterium
           Y4I]
 gi|206685842|gb|EDZ46324.1| preprotein translocase, SecG subunit [Rhodobacterales bacterium
           Y4I]
          Length = 121

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 49/121 (40%), Gaps = 3/121 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA---HSLGRFTAILAFFF 57
           M+  ++++HL++ +GL+ V+L+Q S+    G         S      +LG+ T +LA  F
Sbjct: 1   MENVVLIIHLLLALGLIAVVLLQRSEGGGLGMGGGGGGAISGRAAATALGKVTWLLAIAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
             TSI L +++   S         ++  S             S  L      ++  V + 
Sbjct: 61  ICTSITLTIMAAQKSAGSSVTDRLAVPQSEDGGAPAVPAPLGSDLLPPSEGDNAPLVPSA 120

Query: 118 K 118
            
Sbjct: 121 D 121


>gi|254361631|ref|ZP_04977769.1| Sec family Type II general secretory pathway preprotein
          translocase SecG [Mannheimia haemolytica PHL213]
 gi|261496381|ref|ZP_05992775.1| Sec family Type II general secretory pathway preprotein
          translocase SecG [Mannheimia haemolytica serotype A2
          str. OVINE]
 gi|153093149|gb|EDN74165.1| Sec family Type II general secretory pathway preprotein
          translocase SecG [Mannheimia haemolytica PHL213]
 gi|261307966|gb|EEY09275.1| Sec family Type II general secretory pathway preprotein
          translocase SecG [Mannheimia haemolytica serotype A2
          str. OVINE]
          Length = 108

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 6/97 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
          +   L +V+L+V V L+  +L+Q    +  G+S      +       +A+ L R TA+LA
Sbjct: 2  LINVLTIVYLVVAVLLIAFVLMQQGKGADAGASFGAGASATVFGSAGSANFLSRTTALLA 61

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG 91
            FFA S+ +G +S +           S V+  + + 
Sbjct: 62 TIFFAISLVIGNLSSHNVAPKSQFEDLSQVEQKQVEP 98


>gi|78048410|ref|YP_364585.1| preprotein translocase subunit SecG [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78036840|emb|CAJ24533.1| preprotein translocase subunit SecG [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 157

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 19/114 (16%), Positives = 44/114 (38%), Gaps = 6/114 (5%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L V++++V + ++ +IL+Q    +A GS             +  ++ L + T  LA  F
Sbjct: 5   ILNVIYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLAVVF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
           F+ S+ +   + + +     N+      +              P+  +  A  +
Sbjct: 65  FSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAGELTQPLPQAPAAGAVPT 118


>gi|330817793|ref|YP_004361498.1| preprotein translocase subunit SecG [Burkholderia gladioli BSR3]
 gi|327370186|gb|AEA61542.1| preprotein translocase subunit SecG [Burkholderia gladioli BSR3]
          Length = 129

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV ++  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQILSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL  +  Y S      +
Sbjct: 64 TIFFIATLALTYLGSYKSAPSIGLL 88


>gi|298291795|ref|YP_003693734.1| preprotein translocase, SecG subunit [Starkeya novella DSM 506]
 gi|296928306|gb|ADH89115.1| preprotein translocase, SecG subunit [Starkeya novella DSM 506]
          Length = 129

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 45/74 (60%), Gaps = 5/74 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
          MQ  ++V+HL+VV+ L+ V+LIQ S+    G         F S R TA+ L R TAILA 
Sbjct: 1  MQTVIIVIHLMVVLALIGVVLIQRSEGGGLGIGGGGGGGGFFSARGTANVLTRATAILAA 60

Query: 56 FFFATSIALGMISR 69
           FF TS++L +++ 
Sbjct: 61 LFFITSLSLTILAG 74


>gi|149909283|ref|ZP_01897939.1| Biopolymer transport protein [Moritella sp. PE36]
 gi|149807600|gb|EDM67548.1| Biopolymer transport protein [Moritella sp. PE36]
          Length = 106

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/108 (20%), Positives = 43/108 (39%), Gaps = 8/108 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
           M   ++V++LIV + ++  +L+Q    +  G       S+       + + L R TAILA
Sbjct: 1   MYEVIIVIYLIVALAIIGFVLMQQGKGADMGASFGSGGSNTVFGAGGSGNFLTRVTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FFA   +L + +  + +     +         D       +   P+
Sbjct: 61  VVFFAL--SLLLGNLSSQSETDVILDAEKPAITSDIPVSPVNNSDVPQ 106


>gi|195953187|ref|YP_002121477.1| preprotein translocase, SecG subunit [Hydrogenobaculum sp. Y04AAS1]
 gi|195932799|gb|ACG57499.1| preprotein translocase, SecG subunit [Hydrogenobaculum sp. Y04AAS1]
          Length = 100

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 13/99 (13%), Positives = 36/99 (36%), Gaps = 7/99 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
           +   L+V+ +I+ + L+ ++L+Q S      +           V      L + T     
Sbjct: 4   LYYILVVLFIIIALFLIVLVLLQKSRGDIGAAFGGATARSIFGVGGVDTILTKGTYWFTA 63

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN 94
            F   +I + +++   +      M    + + + + +  
Sbjct: 64  IFMVLAIVIAILTDVRNN--SSIMQNEHISANQTKHSKP 100


>gi|15602073|ref|NP_245145.1| preprotein translocase subunit SecG [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|18202829|sp|Q9CP52|SECG_PASMU RecName: Full=Protein-export membrane protein secG
 gi|12720432|gb|AAK02292.1| SecG [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 115

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 21/108 (19%), Positives = 43/108 (39%), Gaps = 6/108 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M   L++ + I+ + +V +ILIQ    +  G+S              + + L + TA+LA
Sbjct: 1   MYQTLLLGYAIIAIVIVFLILIQQGKGADAGASFGGGASGTIFGSVGSGNFLSKMTALLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF  SI +G ++ + +   +         + + Q        +   
Sbjct: 61  TAFFVMSIVIGNVNSHRNNVKQGKFDDLSATAEQIQQQQKIDAPAVET 108


>gi|73540663|ref|YP_295183.1| preprotein translocase subunit SecG [Ralstonia eutropha JMP134]
 gi|72118076|gb|AAZ60339.1| protein translocase subunit secG [Ralstonia eutropha JMP134]
          Length = 118

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 42/84 (50%), Gaps = 6/84 (7%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAF 55
          +  L++V ++  +G++ ++LIQ    +        G+S +      +A+ L R TA+LA 
Sbjct: 5  KTLLVLVQVLSALGVIGLVLIQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAVLAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNM 79
           FF  +++L ++  Y  +     M
Sbjct: 65 LFFICTLSLTLMGNYKPSTSLGVM 88


>gi|83858358|ref|ZP_00951880.1| hypothetical protein OA2633_02626 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853181|gb|EAP91033.1| hypothetical protein OA2633_02626 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 138

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 31/132 (23%), Positives = 49/132 (37%), Gaps = 12/132 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L+++H+++   L  VIL+Q S+        G      S R  A+ L R T IL   
Sbjct: 1   MTAVLLIIHVLIAAALTGVILMQRSEGGALGIGGGGPGGMMSGRGAANLLTRVTMILGAL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKD-------QGNDNFGDGSSPKLDSVSAK 109
           F   SI L +IS  T T     + R               +G +      + +  +  A 
Sbjct: 61  FIGNSILLAIISGVT-TSSGSVLDRVGETQTNSDLPFGDLEGLETDVPAPTDEAPADPAP 119

Query: 110 SSSSVVAGKRSS 121
           +S    A    +
Sbjct: 120 ASDDAPAQDEPA 131


>gi|329962035|ref|ZP_08300046.1| preprotein translocase, SecG subunit [Bacteroides fluxus YIT 12057]
 gi|328530683|gb|EGF57541.1| preprotein translocase, SecG subunit [Bacteroides fluxus YIT 12057]
          Length = 126

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 44/106 (41%), Gaps = 4/106 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M + L+++ +I  V +  ++LIQ+S        F SS+    VR T   L + T  LA  
Sbjct: 1   MYLLLVILMVIASVLMCFIVLIQNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWTLAAV 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
               SIA       +S++  D +        K    +     ++P+
Sbjct: 61  MVVFSIASAYTVPASSSKGGDVILEQAQQEEKTNPYNMPVGTAAPQ 106


>gi|261492437|ref|ZP_05988993.1| Sec family Type II general secretory pathway preprotein translocase
           SecG [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261311896|gb|EEY13043.1| Sec family Type II general secretory pathway preprotein translocase
           SecG [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 114

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 25/110 (22%), Positives = 44/110 (40%), Gaps = 6/110 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           +   L +V+L+V V L+  +L+Q    +  G+S      +       +A+ L R TA+LA
Sbjct: 2   LINVLTIVYLVVAVLLIAFVLMQQGKGADAGASFGAGASATVFGSAGSANFLSRTTALLA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             FFA S+ +G +S +           S  + +                D
Sbjct: 62  TIFFAISLVIGNLSSHNVAPKSQFEDLSQFEDLSQVEQKQVEPVKIENSD 111


>gi|237746763|ref|ZP_04577243.1| predicted protein [Oxalobacter formigenes HOxBLS]
 gi|229378114|gb|EEO28205.1| predicted protein [Oxalobacter formigenes HOxBLS]
          Length = 136

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 18/133 (13%), Positives = 49/133 (36%), Gaps = 9/133 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA--------HSLGRFTAI 52
           +    ++V ++  + ++ ++L+Q    +  G++       S +        + L + TAI
Sbjct: 2   LYNITIIVQVLSALAIIVLVLMQHGKGADMGAAFGAGGGSSGSIFGASGSSNFLSKSTAI 61

Query: 53  LAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK-SS 111
            A  FF +++A+  +  Y +      + +    +      +   + +  K  S +A    
Sbjct: 62  AAVVFFVSTLAMAYLGHYRAPAQSGVIEKLQSVTTPAPVQEAPAEPAVSKEASGAAAIPG 121

Query: 112 SSVVAGKRSSSRT 124
           +           T
Sbjct: 122 AQQTVPANPGENT 134


>gi|261867518|ref|YP_003255440.1| preprotein translocase subunit SecG [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412850|gb|ACX82221.1| protein-export membrane protein [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 112

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 22/112 (19%), Positives = 44/112 (39%), Gaps = 6/112 (5%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFFF 58
           +++++L+V + L+  IL+Q    +  G+S                + L R TAILA  FF
Sbjct: 1   MLIIYLVVSIALIAFILLQQGKGADAGASFGGGASGTVFGSAGAGNFLSRTTAILATIFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
             SI +G I+ + +   +         + + Q        ++    +     
Sbjct: 61  IISIVIGNINSHRNNVKQGAFDDLSGTAEQIQQQQQQQAPAALDTKNNDIPQ 112


>gi|190575279|ref|YP_001973124.1| preprotein translocase subunit SecG [Stenotrophomonas maltophilia
           K279a]
 gi|190013201|emb|CAQ46834.1| putative general secretory pathway protein-export membrane protein
           [Stenotrophomonas maltophilia K279a]
          Length = 145

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 23/107 (21%), Positives = 41/107 (38%), Gaps = 8/107 (7%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L VV+++V V ++ +IL+Q    +A GS             R  ++ L + T  LA  F
Sbjct: 5   ILNVVYVLVAVAMIALILMQRGSGAAAGSGFGAGASGTVFGARGASNFLSKSTKWLAVVF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
           F  S+ +   + + S    D     +            G+   P + 
Sbjct: 65  FGISLFMAWYAGHGSRPAADQDLGLMSAPAAVAPAAPAGE--LPAVP 109


>gi|116749489|ref|YP_846176.1| preprotein translocase subunit SecG [Syntrophobacter fumaroxidans
          MPOB]
 gi|116698553|gb|ABK17741.1| protein translocase subunit secG [Syntrophobacter fumaroxidans
          MPOB]
          Length = 203

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS-----AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          M IFL+++H++  V L+ ++L+Q+   +       G+S         +  + + T   A 
Sbjct: 1  MYIFLILLHVVASVALILIVLLQTGRGAEMGAAFGGASQTLFGGGGGSTFMSKLTTGAAI 60

Query: 56 FFFATSIALGMISRYTSTRY 75
           F  T ++L  IS    +R 
Sbjct: 61 VFMLTCLSLAYISAGPQSRS 80


>gi|167855778|ref|ZP_02478532.1| protein-export membrane protein [Haemophilus parasuis 29755]
 gi|219870671|ref|YP_002475046.1| preprotein translocase subunit SecG [Haemophilus parasuis SH0165]
 gi|167853118|gb|EDS24378.1| protein-export membrane protein [Haemophilus parasuis 29755]
 gi|219690875|gb|ACL32098.1| preprotein translocase subunit SecG [Haemophilus parasuis SH0165]
          Length = 109

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 27/108 (25%), Positives = 48/108 (44%), Gaps = 6/108 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           +   L +V+L+V + LV  IL+Q    +  G+S              +A+ L R TAILA
Sbjct: 2   LINVLTIVYLVVAIFLVGFILMQQGKGADAGASFGAGAAGTVFGSAGSANFLSRTTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF+ S+ +G ++  T+         S V+  ++       +   P+
Sbjct: 62  IIFFSVSLVIGNLNSQTAAPKSQFEDLSNVEQKQEVTPAKIENSDIPQ 109


>gi|188577697|ref|YP_001914626.1| preprotein translocase subunit SecG [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188522149|gb|ACD60094.1| preprotein translocase subunit SecG [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 153

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 45/114 (39%), Gaps = 6/114 (5%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA  F
Sbjct: 5   ILNVVYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLAVVF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
           F+ S+ +   + + +     N+      ++             P+  +  A  +
Sbjct: 65  FSISLFMAWYATHGARPTDQNLGVMSQSAMPAPAAAGELTQPLPQAPAAGAVPT 118


>gi|86157958|ref|YP_464743.1| protein translocase subunit secG [Anaeromyxobacter dehalogenans
          2CP-C]
 gi|85774469|gb|ABC81306.1| protein translocase subunit secG [Anaeromyxobacter dehalogenans
          2CP-C]
          Length = 122

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
          M   + V+H++V + L+ VIL+Q+      G+             R +   LG+ T++ A
Sbjct: 1  MITLITVLHVLVCIFLILVILLQAGKGGGMGAGLGGGGSQTVFGGRGSQTFLGKVTSVSA 60

Query: 55 FFFFATSIALGMISRYTST 73
            F  TS+ L   +  TS+
Sbjct: 61 GIFMLTSVTLAYHASRTSS 79


>gi|198276462|ref|ZP_03208993.1| hypothetical protein BACPLE_02657 [Bacteroides plebeius DSM 17135]
 gi|198270550|gb|EDY94820.1| hypothetical protein BACPLE_02657 [Bacteroides plebeius DSM 17135]
          Length = 124

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 44/104 (42%), Gaps = 4/104 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M +  +V+ ++  V +  V+LIQ+S       +F SS+    VR T   + + T  LA F
Sbjct: 1   MYLLFVVLMVLAAVLMCFVVLIQNSKGGGLSSSFASSNQIMGVRKTTDFIEKLTWGLAAF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
               S+A   +    +      M +++ +   +  N   G  + 
Sbjct: 61  MVVISVATSYVVPSQAEGSSVIMEQAVKEQKTNPLNAPAGFAAP 104


>gi|161485710|ref|NP_643015.2| preprotein translocase subunit SecG [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 157

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 43/111 (38%), Gaps = 6/111 (5%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA  F
Sbjct: 5   ILNVVYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLAVVF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
           F+ S+ +   + + +     N+      +              P+  +  A
Sbjct: 65  FSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAGELTQPLPQAPAAGA 115


>gi|238028144|ref|YP_002912375.1| preprotein translocase subunit SecG [Burkholderia glumae BGR1]
 gi|237877338|gb|ACR29671.1| Protein-export membrane protein [Burkholderia glumae BGR1]
          Length = 125

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          +++ ++VV ++  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 4  LKVLIIVVQILSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL  +  Y S      +
Sbjct: 64 TVFFVATLALTYLGSYKSAPSIGVL 88


>gi|152995055|ref|YP_001339890.1| preprotein translocase subunit SecG [Marinomonas sp. MWYL1]
 gi|150835979|gb|ABR69955.1| preprotein translocase, SecG subunit [Marinomonas sp. MWYL1]
          Length = 117

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 40/97 (41%), Gaps = 6/97 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS------TAHSLGRFTAILA 54
          M+  ++V+H++  V ++ ++L+Q    +  G+S    + ++           G+ TA+ A
Sbjct: 1  MEALILVLHVLAAVVIIALVLLQQGKGADAGASFGGGASQTVFGSQGGGSFFGKMTAVFA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG 91
            FF TS  L   +   +      +         ++ 
Sbjct: 61 LVFFLTSFGLAYFASEQAKSVSGALDFVPSAPQVEET 97


>gi|285017791|ref|YP_003375502.1| protein-export membrane protein secg (preprotein translocase band 1
           subunit) (p12) [Xanthomonas albilineans GPE PC73]
 gi|283473009|emb|CBA15514.1| probable protein-export membrane protein secg (preprotein
           translocase band 1 subunit) (p12) [Xanthomonas
           albilineans]
          Length = 138

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/108 (21%), Positives = 45/108 (41%), Gaps = 7/108 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           + + L VV+++V + ++ +IL+Q    +A GS             R  ++ L + T  LA
Sbjct: 2   LIVILNVVYVLVAIAMIALILMQRGAGAAAGSGFGSGASGTVFGSRGASNFLSKTTKWLA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FFA S+ +   + + S +  D     +            G+   P+
Sbjct: 62  VAFFAISLFMAWYAAH-SAQPADANLGVMSQGASPVPAAPAGELQIPQ 108


>gi|260753026|ref|YP_003225919.1| preprotein translocase, SecG subunit [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258552389|gb|ACV75335.1| preprotein translocase, SecG subunit [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 119

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 44/116 (37%), Gaps = 3/116 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA---FGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           +   L+VV  +V   LV VIL+Q S+ S      +     S    A+ L R T  LA  F
Sbjct: 2   LFTILIVVQALVAAALVTVILMQQSEGSGITGGSNPGGLMSASGAANFLTRATGALAVLF 61

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
              SIAL  ++   +T  + ++  +     +              +      +++ 
Sbjct: 62  VVLSIALAALASVQNTAPQIDISLAHKPVAQQTAPAQPAQPKPSSVPLADQPATTP 117


>gi|326798179|ref|YP_004315998.1| preprotein translocase, SecG subunit [Sphingobacterium sp. 21]
 gi|326548943|gb|ADZ77328.1| preprotein translocase, SecG subunit [Sphingobacterium sp. 21]
          Length = 121

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 41/120 (34%), Gaps = 5/120 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L+V+ ++  V LV ++LIQ+         F  S+N   V+ T   L + T +L   
Sbjct: 1   MYTLLIVLTILACVLLVFIVLIQNPKGGGLASGFAGSNNLMGVQRTGDILEKGTWVLVIA 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN-FGDGSSPKLDSVSAKSSSSVV 115
               S+ L + +    T     +      +             ++P        +S    
Sbjct: 61  IMVFSLLLNITNPGAGTGSNPGLELQKQITPTATPTAPLQKPATTPATPQGQKPASVDTT 120


>gi|242310136|ref|ZP_04809291.1| preprotein translocase subunit SecG [Helicobacter pullorum MIT
          98-5489]
 gi|239523433|gb|EEQ63299.1| preprotein translocase subunit SecG [Helicobacter pullorum MIT
          98-5489]
          Length = 114

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 37/96 (38%), Gaps = 4/96 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M   L+VV  ++ + +  V+L+Q S      +  GS+ +    +  A  L + T +L F 
Sbjct: 1  MSGILLVVQFVLAIIITIVVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKTTFVLGFL 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
          F   +IALG      S +   +              
Sbjct: 61 FVVNTIALGYFYTKDSQKSIVDNVEIPATQTNPAPA 96


>gi|124516458|gb|EAY57966.1| preprotein translocase, SecG subunit [Leptospirillum rubarum]
          Length = 101

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 42/103 (40%), Gaps = 7/103 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA-----FGSSSNFTSVRSTAHSLGRFTAILAF 55
           M   + VVH++  V +V  +L+QS   +       GSS +    R  +  L + T +LA 
Sbjct: 1   MTTLITVVHVLTCVLIVVAVLLQSGKGAETGVMIGGSSQSLFGARGASSFLSKVTVVLAT 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
            F  TS++L +I    S      +  S + S+           
Sbjct: 61  LFMVTSLSLSLI--RQSPVGPSLLLNSPLKSLPSAPPPKTKTP 101


>gi|325297178|ref|YP_004257095.1| preprotein translocase, SecG subunit [Bacteroides salanitronis DSM
           18170]
 gi|324316731|gb|ADY34622.1| preprotein translocase, SecG subunit [Bacteroides salanitronis DSM
           18170]
          Length = 124

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 26/126 (20%), Positives = 49/126 (38%), Gaps = 8/126 (6%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
              L+ + ++  V +  V+LIQ+S       +F +S+    VR T   + + T  LA F 
Sbjct: 3   YYLLVGLIVLASVLMCFVVLIQNSKGGGLASSFAASNQIMGVRKTTDFIEKLTWGLAVFM 62

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
              SIA   +           M +    ++++Q  +             +A    +V A 
Sbjct: 63  VVVSIAAAYVIPSAVEGSSVIMDQ----AVEEQKTNPLNAPEGFAAPQQNAAEQETVPAA 118

Query: 118 KRSSSR 123
             S++R
Sbjct: 119 SDSAAR 124


>gi|32265939|ref|NP_859971.1| preprotein translocase subunit SecG [Helicobacter hepaticus ATCC
           51449]
 gi|32261988|gb|AAP77037.1| membrane protein SecG involved in protein secretion [Helicobacter
           hepaticus ATCC 51449]
          Length = 132

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 52/131 (39%), Gaps = 6/131 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L VV +++ V +  ++L+Q S      +  GS+ +    +  A  L +FT  L   
Sbjct: 1   MTTTLFVVQIVLAVFITIIVLLQKSSSIGLGAYSGSNESVFGAKGPAGFLAKFTMFLGLL 60

Query: 57  FFATSIALGMISRYTSTRY--KDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
           F   +IAL       S +         +L  +     N +  +  +P + + +   S+ +
Sbjct: 61  FVLNTIALSYTYNTQSQKSILDSIPSNTLAPAAPAAPNTDTKESENPFILNENVAPSAPL 120

Query: 115 VAGKRSSSRTK 125
           +  +    + +
Sbjct: 121 LQQEPVQGQNE 131


>gi|163855936|ref|YP_001630234.1| preprotein translocase subunit SecG [Bordetella petrii DSM 12804]
 gi|163259664|emb|CAP41965.1| secG [Bordetella petrii]
          Length = 178

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 45/122 (36%), Gaps = 9/122 (7%)

Query: 13  VVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGM 66
            + ++ ++L+Q    +  GS+       +       A+ L R T   A  FFA+++ L  
Sbjct: 16  ALAIIVLVLLQQGKGADMGSAFGSGSAGSLFGATGAANFLSRTTKWAAVVFFASTLGLAY 75

Query: 67  ISRYTSTRYKDNMHRSLVDSIKDQ--GNDNFGDGSSPKLDS-VSAKSSSSVVAGKRSSSR 123
           +S   S+         + D   D+          S   +     A+  +SV     +  +
Sbjct: 76  VSHKGSSSAGSVESGVMQDFPADRSVPQVPGAANSGSSVPQSAPAQPDASVPQAPAAQPQ 135

Query: 124 TK 125
           ++
Sbjct: 136 SE 137


>gi|253700503|ref|YP_003021692.1| preprotein translocase subunit SecG [Geobacter sp. M21]
 gi|251775353|gb|ACT17934.1| preprotein translocase, SecG subunit [Geobacter sp. M21]
          Length = 123

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 35/100 (35%), Gaps = 8/100 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
          M I L+ +H++V   L+ V+L+QS   +  G       S +          + + T   A
Sbjct: 1  MTILLVTLHIVVCFSLIVVVLLQSGKGAEMGASFGASGSQSVFGAGGGNTFMSKLTTSAA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN 94
            F  TS+AL   S          M +         G   
Sbjct: 61 IIFMLTSLALAFTSGKGG--GSSIMSKVPKAKPAPMGGTP 98


>gi|114327491|ref|YP_744648.1| protein translocase subunit secG [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315665|gb|ABI61725.1| protein translocase subunit secG [Granulibacter bethesdensis
           CGDNIH1]
          Length = 133

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 54/127 (42%), Gaps = 5/127 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS-----SSNFTSVRSTAHSLGRFTAILAF 55
           M   L+++HL V + L+ V+LIQ S+    G        +F S R TA+ L R TAILA 
Sbjct: 1   MNTVLLIIHLFVTLALIGVVLIQRSEGGGLGIGGSQGMGSFMSGRGTANLLTRTTAILAT 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            F   S+ L +++R T+      +      +     +      + P   S  A   +   
Sbjct: 61  LFMLLSLTLALLNRGTAGVGHSVLFGQGTPAAPSSPSLPAAPPAHPPAGSQPAAPDAKTA 120

Query: 116 AGKRSSS 122
             K  S+
Sbjct: 121 VPKTPSA 127


>gi|167646728|ref|YP_001684391.1| preprotein translocase subunit SecG [Caulobacter sp. K31]
 gi|167349158|gb|ABZ71893.1| preprotein translocase, SecG subunit [Caulobacter sp. K31]
          Length = 169

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 3/78 (3%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFFFAT 60
           L+ +++IV   L+ V+L+Q S+  A G       F + R     L R T IL   F   
Sbjct: 5  VLLTINIIVCFALIGVVLMQRSEGGALGMGGGGGGFMTARGAGDLLTRTTWILFSIFLII 64

Query: 61 SIALGMISRYTSTRYKDN 78
          S+AL +++   +      
Sbjct: 65 SLALTILTGRMANSNSVV 82


>gi|161485692|ref|NP_637878.2| preprotein translocase subunit SecG [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|162017104|ref|YP_242674.2| preprotein translocase subunit SecG [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188991028|ref|YP_001903038.1| preprotein translocase subunit SecG [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167732788|emb|CAP50982.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 162

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/116 (17%), Positives = 45/116 (38%), Gaps = 6/116 (5%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA  F
Sbjct: 5   ILNVVYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLAVVF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
           F+ S+ +   + + +     N+      +              P+  +  A  ++ 
Sbjct: 65  FSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAGELTQPLPQAPAAGAVPTAP 120


>gi|270296168|ref|ZP_06202368.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270273572|gb|EFA19434.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 129

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 41/107 (38%), Gaps = 4/107 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M + L+++ LI  V +  ++LIQ+S        F SS+    VR T   L + T  LA  
Sbjct: 1   MYLLLVILMLIASVLMCFIVLIQNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWTLAAV 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKL 103
               SI        ++ +  D +        K    +      +P+ 
Sbjct: 61  MVVFSIVSAYTIPSSTGKGGDVILEQAQQEEKTNPYNMPVGTEAPQS 107


>gi|160892213|ref|ZP_02073216.1| hypothetical protein BACUNI_04677 [Bacteroides uniformis ATCC 8492]
 gi|317480745|ref|ZP_07939831.1| preprotein translocase [Bacteroides sp. 4_1_36]
 gi|156858691|gb|EDO52122.1| hypothetical protein BACUNI_04677 [Bacteroides uniformis ATCC 8492]
 gi|316903086|gb|EFV24954.1| preprotein translocase [Bacteroides sp. 4_1_36]
          Length = 129

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 41/107 (38%), Gaps = 4/107 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M + L+++ LI  V +  ++LIQ+S        F SS+    VR T   L + T  LA  
Sbjct: 1   MYLLLVILMLIASVLMCFIVLIQNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWTLAAV 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKL 103
               SI        ++ +  D +        K    +      +P+ 
Sbjct: 61  MVVFSIVSAYTIPSSTGKGGDVILEQAQQEEKTNPYNMPVGTEAPQS 107


>gi|242279408|ref|YP_002991537.1| preprotein translocase, SecG subunit [Desulfovibrio salexigens DSM
           2638]
 gi|242122302|gb|ACS79998.1| preprotein translocase, SecG subunit [Desulfovibrio salexigens DSM
           2638]
          Length = 112

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/104 (20%), Positives = 39/104 (37%), Gaps = 4/104 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFF 56
           MQ  ++ VH+I  V L+  +L+QS          G S +          L + TA LA  
Sbjct: 1   MQTLVITVHIIACVFLIIFVLLQSGKEDMGVIFGGGSGSVFGSTGAGGVLVKITAFLAAI 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
           F  TS++   +S          +    + + + +      +  +
Sbjct: 61  FLVTSLSYNYLSGNRIADESVMLKGDTIITPEVEKPAVTFEEPA 104


>gi|330830891|ref|YP_004393843.1| preprotein translocase subunit SecG [Aeromonas veronii B565]
 gi|328806027|gb|AEB51226.1| Preprotein translocase, SecG subunit [Aeromonas veronii B565]
          Length = 108

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/107 (24%), Positives = 44/107 (41%), Gaps = 6/107 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+VV+L+V + L+ +++IQ    +  G+S              +   L R TAILA
Sbjct: 1   MYEILLVVYLLVSLALIGLVMIQQGKGADMGASFGAGASNTVFGSGGSGSFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
             FF  S+ LG +S     +  +  +      ++        D   P
Sbjct: 61  TLFFVISLVLGSMSSNKVKQGSEWENLQQTQQVEQTKAPVKKDTDVP 107


>gi|192973069|gb|ACF06968.1| preprotein translocase SecG subunit [uncultured Roseobacter sp.]
          Length = 117

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/112 (20%), Positives = 47/112 (41%), Gaps = 6/112 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA-----HSLGRFTAILAF 55
           MQ  ++++HL++ + L+ ++L+Q S+    G         + +      +L + T  LA 
Sbjct: 1   MQNVVLIIHLLLAISLIGLVLLQRSEGGGLGMGGGGAGGGAMSGRAAASALTKLTWGLAI 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
            F  TS+AL ++    S      + + +  + +D   D          DS  
Sbjct: 61  AFICTSLALTILQVQKS-SGSSVLDQLMPATEQDTPVDGDALLPPSAEDSAP 111


>gi|126735304|ref|ZP_01751050.1| preprotein translocase, SecG subunit, putative [Roseobacter sp.
           CCS2]
 gi|126715859|gb|EBA12724.1| preprotein translocase, SecG subunit, putative [Roseobacter sp.
           CCS2]
          Length = 118

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/112 (22%), Positives = 45/112 (40%), Gaps = 3/112 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS---VRSTAHSLGRFTAILAFFF 57
           M+  ++++HLI+ + L+  +L+Q S+    G           R  A ++ +FT  LA  F
Sbjct: 1   MENVVLIIHLILALALIGTVLLQRSEGGGLGMGGGGGGATGSRPAATAMSKFTWALAAAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             TSI+L +I+   +          +          +FGD   P        
Sbjct: 61  ICTSISLTLIAASNTAGSSVVDQLGIDPGSDAPLLPDFGDSLLPPSLDGDDP 112


>gi|283856264|ref|YP_162199.2| preprotein translocase subunit SecG [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|283775259|gb|AAV89088.2| preprotein translocase, SecG subunit [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 119

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 42/116 (36%), Gaps = 3/116 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS---SSNFTSVRSTAHSLGRFTAILAFFF 57
           +   L+VV  +V   LV VIL+Q S+ S            S    A+ L R T  LA  F
Sbjct: 2   LFTILIVVQALVAAALVTVILMQQSEGSGITGGLNPGGLMSASGAANFLTRATGALAVLF 61

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
              SIAL  ++   +T  + +   +     +              +      +++ 
Sbjct: 62  VVLSIALAALASVQNTAPQIDTSLAHKPVAQQTAPAQPAQPKPSSVPLADQPATTP 117


>gi|325276162|ref|ZP_08141967.1| preprotein translocase subunit SecG [Pseudomonas sp. TJI-51]
 gi|324098699|gb|EGB96740.1| preprotein translocase subunit SecG [Pseudomonas sp. TJI-51]
          Length = 133

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 49/131 (37%), Gaps = 6/131 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  + LV ++L+Q    +  G+S            + +A  L + TAILA
Sbjct: 2   LETVIVVFHLLAALSLVVLVLLQQGKGAEAGASFGAGASNTVFGSQGSATFLSKLTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF T++ LG  ++  + +               +      +   P L       ++  
Sbjct: 62  ATFFLTALGLGYFAKQQAHQLSQAGLPDPAVLEVKEPQKPAVNDDVPVLQQQQKSEATPN 121

Query: 115 VAGKRSSSRTK 125
                  +  +
Sbjct: 122 TGDVPPPAEEQ 132


>gi|171058184|ref|YP_001790533.1| preprotein translocase subunit SecG [Leptothrix cholodnii SP-6]
 gi|170775629|gb|ACB33768.1| preprotein translocase, SecG subunit [Leptothrix cholodnii SP-6]
          Length = 133

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 37/88 (42%), Gaps = 7/88 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          +   +++  L+  + ++ ++L+Q    +  G+S              +A+ L R TAI A
Sbjct: 4  LMNLMLLTQLVSAIAMIGLVLVQHGKGADMGASFGGGASGSLFGATGSANFLSRSTAICA 63

Query: 55 FFFFATSIALGMISRYTSTR-YKDNMHR 81
            FF  ++AL   S    T      + +
Sbjct: 64 AVFFTCTLALAYFSNARGTNVGGSVLDQ 91


>gi|117618966|ref|YP_857797.1| preprotein translocase, SecG subunit [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117560373|gb|ABK37321.1| preprotein translocase, SecG subunit [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 108

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/107 (24%), Positives = 44/107 (41%), Gaps = 6/107 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+VV+L+V + L+ +++IQ    +  G+S              +   L R TAILA
Sbjct: 1   MYEILLVVYLLVSLALIGLVMIQQGKGADMGASFGAGASNTVFGSGGSGSFLTRTTAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
             FF  S+ LG +S     +  +  +      ++        D   P
Sbjct: 61  TLFFLISLVLGSMSSNKVKQGSEWENLQQTQQVEQSKAPVKKDTDVP 107


>gi|307565930|ref|ZP_07628389.1| preprotein translocase, SecG subunit [Prevotella amnii CRIS 21A-A]
 gi|307345358|gb|EFN90736.1| preprotein translocase, SecG subunit [Prevotella amnii CRIS 21A-A]
          Length = 122

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/119 (19%), Positives = 42/119 (35%), Gaps = 6/119 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M    +V+ +++ + ++C++LIQ S        F SS+    VR T   + + T   A  
Sbjct: 1   MYTLFIVLIVVIALLMICIVLIQESKGGGLSSNFSSSNAIMGVRKTTDFVEKATWTFAAL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF--GDGSSPKLDSVSAKSSSS 113
               SIA   ++   ST        +  D   +  N              +  A   + 
Sbjct: 61  MVIISIASAYVAPTASTDESVIEKAATSDQPTNPNNLPNFGASQQKQAAPTKQAAPIAP 119


>gi|302383246|ref|YP_003819069.1| preprotein translocase subunit SecG [Brevundimonas subvibrioides
          ATCC 15264]
 gi|302193874|gb|ADL01446.1| preprotein translocase, SecG subunit [Brevundimonas subvibrioides
          ATCC 15264]
          Length = 137

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 3/81 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS---SSNFTSVRSTAHSLGRFTAILAFFF 57
          +Q  L+VV +++ + L  VIL+Q S+  A G     S F + R   + L   T  L   F
Sbjct: 2  LQTILLVVMILISLALTGVILLQRSEGGALGMGGGPSGFMTARGAGNLLTTTTWWLGAGF 61

Query: 58 FATSIALGMISRYTSTRYKDN 78
             +I+L +I     +     
Sbjct: 62 VICAISLTIIGNVERSNRSVV 82


>gi|197122739|ref|YP_002134690.1| preprotein translocase, SecG subunit [Anaeromyxobacter sp. K]
 gi|220917522|ref|YP_002492826.1| preprotein translocase subunit SecG [Anaeromyxobacter
          dehalogenans 2CP-1]
 gi|196172588|gb|ACG73561.1| preprotein translocase, SecG subunit [Anaeromyxobacter sp. K]
 gi|219955376|gb|ACL65760.1| preprotein translocase, SecG subunit [Anaeromyxobacter
          dehalogenans 2CP-1]
          Length = 122

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 6/79 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
          M   + V+H++V + L+ VIL+Q+      G+             R +   LG+ T++ A
Sbjct: 1  MITLVTVLHVLVCIFLILVILLQAGKGGGMGAGLGGGGSQTVFGGRGSQTFLGKVTSVSA 60

Query: 55 FFFFATSIALGMISRYTST 73
            F  TS+ L   +  T++
Sbjct: 61 GIFMLTSVTLAYHASRTTS 79


>gi|67458496|ref|YP_246120.1| preprotein translocase subunit SecG [Rickettsia felis URRWXCal2]
 gi|75537035|sp|Q4UNA3|SECG_RICFE RecName: Full=Protein-export membrane protein secG
 gi|67004029|gb|AAY60955.1| Protein-export membrane protein SecG [Rickettsia felis URRWXCal2]
          Length = 100

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 40/97 (41%), Gaps = 5/97 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+ VH+ + V L+ VIL+Q S S         ++    S ++  + L + T IL  
Sbjct: 1  MIEILLFVHITIAVLLIIVILMQRSGSDGISSISGGNNMGVVSAKTVGNFLTKSTIILTT 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
           F   +I L  +S    +     ++    +  ++   
Sbjct: 61 LFLINAIVLANLSSKKKSDLVSKINEIEENQAENSLP 97


>gi|206603299|gb|EDZ39779.1| preprotein translocase, SecG subunit [Leptospirillum sp. Group II
           '5-way CG']
          Length = 101

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 42/103 (40%), Gaps = 7/103 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA-----FGSSSNFTSVRSTAHSLGRFTAILAF 55
           M   + VVH++  V +V  +L+QS   +       GSS +    R  +  L + T +LA 
Sbjct: 1   MTTLITVVHVLTCVLIVVAVLLQSGKGAETGVMIGGSSQSLFGARGASSFLSKVTVVLAT 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
            F  TS++L +I    S      +  S + S+           
Sbjct: 61  LFMVTSLSLSLI--RQSPVGPSLLLNSPLKSLPSAPAPKTKTP 101


>gi|157738470|ref|YP_001491154.1| protein-export membrane protein SecG [Arcobacter butzleri RM4018]
 gi|315635329|ref|ZP_07890597.1| preprotein translocase subunit SecG [Arcobacter butzleri JV22]
 gi|157700324|gb|ABV68484.1| protein-export membrane protein SecG [Arcobacter butzleri RM4018]
 gi|315480363|gb|EFU71028.1| preprotein translocase subunit SecG [Arcobacter butzleri JV22]
          Length = 115

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 44/117 (37%), Gaps = 7/117 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L++V  ++ V +   +L+Q S      +  GS+ +    +  A+ L + T  L   
Sbjct: 1   MTSTLLIVQFVLAVLITITVLLQKSSSIGLGAYSGSNESVFGAKGPANFLTKATMALGLA 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
           F   ++ LG        R K  +     +S+           ++P   +    +SS 
Sbjct: 61  FVINTLVLGYFYNEQ--RNKSAIDSVKTESLIPATPVTQ-TPTAPVAPTSQIPTSSE 114


>gi|42522594|ref|NP_967974.1| preprotein translocase subunit SecG [Bdellovibrio bacteriovorus
           HD100]
 gi|39575126|emb|CAE78967.1| Preprotein translocase subunit SecG [Bdellovibrio bacteriovorus
           HD100]
          Length = 161

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 41/97 (42%), Gaps = 9/97 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDS------SAFGSSSNFTSVRSTAHSLGRFTAILA 54
           M  F+ V+H+IV + L+ ++LIQ S S           S++           G+ T   A
Sbjct: 32  MTTFIGVLHIIVALVLIILVLIQDSKSDGALGMGGSSGSNSLLGATGAQSLAGKMTVWAA 91

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG 91
             F  T +AL  +   TS++ K  +    + +   Q 
Sbjct: 92  IIFAVTCLALATL---TSSKTKSVVDSLPLPTAPTQE 125


>gi|149927540|ref|ZP_01915794.1| hypothetical protein LMED105_12155 [Limnobacter sp. MED105]
 gi|149823813|gb|EDM83039.1| hypothetical protein LMED105_12155 [Limnobacter sp. MED105]
          Length = 110

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/109 (15%), Positives = 35/109 (32%), Gaps = 7/109 (6%)

Query: 8   VHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV------RSTAHSLGRFTAILAFFFFATS 61
           + +I  + ++ ++L+Q    +  G++    S         +A+ L R T   A  F   +
Sbjct: 1   MQIISAIAVIVLVLLQHGKGADMGAAFGSGSSGSLFGATGSANFLSRATGFCATIFLLCT 60

Query: 62  IALGMISRYT-STRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
           + L   SR          M     +  +          + PK       
Sbjct: 61  LGLAFYSRAGVEAESGGVMESIQANPAEGTATPVETKPAEPKTPVQDIP 109


>gi|145298041|ref|YP_001140882.1| preprotein translocase subunit SecG [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850813|gb|ABO89134.1| Preprotein translocase subunit SecG [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 108

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 47/108 (43%), Gaps = 6/108 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+VV+L+V + L+ +++IQ    +  G+S              +   L R TA+LA
Sbjct: 1   MYEILLVVYLLVSLALIGLVMIQQGKGADMGASFGAGASNTVFGSGGSGSFLTRTTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             FF  S+ LG +S +   +  +  +    + ++        D   P+
Sbjct: 61  TLFFLVSLVLGSMSSHKVKQGSEWENLQQTEQVEQTKAPVNKDTDVPQ 108


>gi|254787188|ref|YP_003074617.1| preprotein translocase, SecG subunit [Teredinibacter turnerae
           T7901]
 gi|237685748|gb|ACR13012.1| preprotein translocase, SecG subunit [Teredinibacter turnerae
           T7901]
          Length = 148

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 55/119 (46%), Gaps = 7/119 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M+  L++VHL+  + ++ +IL+Q    +  G+S              + +   R TAI A
Sbjct: 1   MENILLLVHLLTALAIIGLILMQQGKGAEMGASFGAGASQTLFGSVGSGNFFSRLTAIAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ-GNDNFGDGSSPKLDSVSAKSSS 112
             FF TS +L +++++ S    D++    ++ ++D     N  D   P L+   A   +
Sbjct: 61  TIFFVTSFSLAVVAKHQSNVGDDDLALPELEQLEDASTATNNDDSDVPALEVEGANVDT 119


>gi|325924674|ref|ZP_08186112.1| protein translocase subunit secG [Xanthomonas perforans 91-118]
 gi|325544880|gb|EGD16225.1| protein translocase subunit secG [Xanthomonas perforans 91-118]
          Length = 157

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 44/114 (38%), Gaps = 6/114 (5%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA  F
Sbjct: 5   ILNVVYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLAVVF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
           F+ S+ +   + + +     N+      +              P+  +  A  +
Sbjct: 65  FSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAGELTQPLPQAPAAGAVPT 118


>gi|56478175|ref|YP_159764.1| preprotein translocase subunit SecG [Aromatoleum aromaticum EbN1]
 gi|56314218|emb|CAI08863.1| Protein-export membrane protein SecG [Aromatoleum aromaticum EbN1]
          Length = 119

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/107 (18%), Positives = 45/107 (42%), Gaps = 6/107 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAF 55
              ++ +H++V + ++ ++L+Q    +  G++    +  S       A+ L R T +LA 
Sbjct: 6   FSIVLTIHVLVGLFIIGLVLMQHGKGADAGAAFGGGASGSVFGSSGSANFLSRTTGVLAT 65

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
            FF TS++L  ++    ++    M  +   S           G+   
Sbjct: 66  VFFITSLSLSYLASNKPSQPSSVMEGASALSAPATDASPADGGAEDS 112


>gi|224023738|ref|ZP_03642104.1| hypothetical protein BACCOPRO_00454 [Bacteroides coprophilus DSM
           18228]
 gi|224016960|gb|EEF74972.1| hypothetical protein BACCOPRO_00454 [Bacteroides coprophilus DSM
           18228]
          Length = 123

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 45/104 (43%), Gaps = 4/104 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M +  +V+ ++  + +  V+L+Q+S       +F SS+    VR T   + + T  LA F
Sbjct: 1   MYLLFVVLMVLAAILMCFVVLVQNSKGGGLSSSFASSNQIMGVRKTTDFIEKLTWGLAIF 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
               SIA   +   T+      M +++ +   +  N   G  + 
Sbjct: 61  MVVISIATSYVIPTTTEGSSVIMDQAVKEQKTNPLNAPAGFAAP 104


>gi|319941419|ref|ZP_08015747.1| translocase subunit secG [Sutterella wadsworthensis 3_1_45B]
 gi|319805039|gb|EFW01869.1| translocase subunit secG [Sutterella wadsworthensis 3_1_45B]
          Length = 119

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 44/113 (38%), Gaps = 6/113 (5%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAFF 56
              +V+ +I  V ++ ++L+Q    +        G+S +      +A+ L R TAI A  
Sbjct: 6   SIALVLQIISAVVVIVLVLMQHGKGADLGAAFGSGASGSVFGATGSANFLSRSTAIAATV 65

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
           FF ++IAL + S   + R        L    +    +    G + K       
Sbjct: 66  FFCSTIALTLASGAFNKRSAQPEGGVLSTIEQPASQEQGMAGDANKSPVNQIP 118


>gi|241761008|ref|ZP_04759097.1| preprotein translocase, SecG subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241374627|gb|EER64088.1| preprotein translocase, SecG subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 119

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 43/116 (37%), Gaps = 3/116 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA---FGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           +   L+VV  +V   LV VIL+Q S+ S      +     S    A+ L R T  LA  F
Sbjct: 2   LFTILIVVQALVAAALVTVILMQQSEGSGITGGSNPGGLMSASGAANFLTRATGALAVLF 61

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
              SIAL  ++   +T  + +   +     +              +      +++ 
Sbjct: 62  VVLSIALAALASVQNTAPQIDTSLAHKPVAQQTAPAQPAQPKPSSVPLADQPATTP 117


>gi|293391395|ref|ZP_06635729.1| protein-export membrane protein [Aggregatibacter
          actinomycetemcomitans D7S-1]
 gi|290951929|gb|EFE02048.1| protein-export membrane protein [Aggregatibacter
          actinomycetemcomitans D7S-1]
          Length = 109

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 38/84 (45%), Gaps = 6/84 (7%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFFF 58
          +++++L+V + L+  IL+Q    +  G+S                + L R TAILA  FF
Sbjct: 1  MLIIYLVVSIALIAFILLQQGKGADAGASFGGGASGTVFGSAGAGNFLSRTTAILATVFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRS 82
            SI +G I+ + +   +      
Sbjct: 61 IISIVIGNINSHRNNVKQGAFDDL 84


>gi|85712950|ref|ZP_01043990.1| Biopolymer transport protein [Idiomarina baltica OS145]
 gi|85693256|gb|EAQ31214.1| Biopolymer transport protein [Idiomarina baltica OS145]
          Length = 86

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   LMV+ LIV + L+  I+IQ    +  G+S              + + L R TAILA
Sbjct: 1  MFEVLMVMFLIVAIVLIGFIMIQQGKGADMGASFGSGASNTVFGSSGSGNFLSRTTAILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++ LG +S   S   +D++
Sbjct: 61 VIFFVLALVLGNLSTSVSDSSEDSL 85


>gi|315617258|gb|EFU97867.1| preprotein translocase, SecG subunit [Escherichia coli 3431]
 gi|325498756|gb|EGC96615.1| preprotein translocase IISP family [Escherichia fergusonii ECD227]
 gi|327251266|gb|EGE62955.1| preprotein translocase, SecG subunit [Escherichia coli STEC_7v]
 gi|332086480|gb|EGI91627.1| preprotein translocase, SecG subunit [Shigella dysenteriae 155-74]
          Length = 99

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 40/95 (42%), Gaps = 6/95 (6%)

Query: 12  VVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALG 65
           + +GLV +I++Q    +  G+S      +       + + + R TA+LA  FF  S+ LG
Sbjct: 1   MAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFFIISLVLG 60

Query: 66  MISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
            I+   + +  +  + S     +          +S
Sbjct: 61  NINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTS 95


>gi|46580086|ref|YP_010894.1| preprotein translocase subunit SecG [Desulfovibrio vulgaris str.
          Hildenborough]
 gi|120602456|ref|YP_966856.1| preprotein translocase subunit SecG [Desulfovibrio vulgaris DP4]
 gi|46449502|gb|AAS96153.1| preprotein translocase, SecG subunit [Desulfovibrio vulgaris str.
          Hildenborough]
 gi|120562685|gb|ABM28429.1| protein translocase subunit secG [Desulfovibrio vulgaris DP4]
 gi|311233915|gb|ADP86769.1| preprotein translocase, SecG subunit [Desulfovibrio vulgaris
          RCH1]
          Length = 116

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/84 (21%), Positives = 36/84 (42%), Gaps = 4/84 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFF 56
          MQ  ++ +H+I  + LV ++L+QS          G +++          L + TA LA  
Sbjct: 1  MQNLVLTLHVIACLILVVLVLLQSGKEGMGVIFGGGNASVFGSTGAGGLLAKLTAFLAVL 60

Query: 57 FFATSIALGMISRYTSTRYKDNMH 80
          F  TS++   ++    +     + 
Sbjct: 61 FIITSLSYNYMTSSHKSDESSIID 84


>gi|261400562|ref|ZP_05986687.1| preprotein translocase, SecG subunit [Neisseria lactamica ATCC
          23970]
 gi|313669104|ref|YP_004049388.1| protein-export integral membrane protein [Neisseria lactamica
          ST-640]
 gi|269209632|gb|EEZ76087.1| preprotein translocase, SecG subunit [Neisseria lactamica ATCC
          23970]
 gi|309379498|emb|CBX21864.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313006566|emb|CBN88030.1| putative protein-export integral membrane protein [Neisseria
          lactamica 020-06]
          Length = 120

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 41/95 (43%), Gaps = 8/95 (8%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSA--------FGSSSNFTSVRSTAHSLGRFTAIL 53
          +  + ++++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5  KTLIWIINIISALAVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54 AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
          A FFFA+ +A+  I  +T+    D  +        
Sbjct: 65 ATFFFASCMAMVYIHTHTTKHGLDFSNVQQTKQAP 99


>gi|194366605|ref|YP_002029215.1| preprotein translocase subunit SecG [Stenotrophomonas maltophilia
           R551-3]
 gi|194349409|gb|ACF52532.1| preprotein translocase, SecG subunit [Stenotrophomonas maltophilia
           R551-3]
          Length = 145

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/107 (19%), Positives = 41/107 (38%), Gaps = 8/107 (7%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L VV+++V V ++ +IL+Q    +A GS             R  ++ L + T  LA  F
Sbjct: 5   ILNVVYVLVAVAMIALILMQRGSGAAAGSGFGAGASGTVFGARGASNFLSKSTKWLAVVF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
           F  S+ +   + + +    +     +            G+   P + 
Sbjct: 65  FGISLFMAWYAGHGTRPAAEQDLGLMSAPAVTAPAAPAGE--LPAVP 109


>gi|78357031|ref|YP_388480.1| preprotein translocase subunit SecG [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78219436|gb|ABB38785.1| protein translocase subunit secG [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 109

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/109 (18%), Positives = 40/109 (36%), Gaps = 4/109 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFF 56
           MQ  ++ +H++  + L  ++L+QS          G SS+          L + TA++A  
Sbjct: 1   MQTVILTLHIVACIVLTVLVLLQSGKEGMGVIFGGGSSSMFGGAGAGGMLAKLTAVVAAL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
           F  TS++   IS  +       +   +  + +               D 
Sbjct: 61  FIVTSLSYNYISGASHRAESSIIDVQVEKTKQAPVTIEEPAEKPAASDQ 109


>gi|254436306|ref|ZP_05049812.1| preprotein translocase, SecG subunit, putative [Nitrosococcus
           oceani AFC27]
 gi|207087996|gb|EDZ65269.1| preprotein translocase, SecG subunit, putative [Nitrosococcus
           oceani AFC27]
          Length = 148

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/130 (22%), Positives = 46/130 (35%), Gaps = 6/130 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M   L+V+H++V V LV ++LIQ    +        G+S+     R +   L R +AILA
Sbjct: 1   MHSVLLVLHIVVAVALVGLVLIQHGKGADAGAAFGSGASATVFGARGSGSFLTRASAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS++L   S                    +            +  +         
Sbjct: 61  ATFFITSLSLAYFSVRKPQETSVTQTVEPRVVADENMVIPSLPKEEDEEGAAKKLLEDDQ 120

Query: 115 VAGKRSSSRT 124
             G   SS +
Sbjct: 121 GKGGEESSES 130


>gi|145638644|ref|ZP_01794253.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittII]
 gi|145272239|gb|EDK12147.1| preprotein translocase subunit SecG [Haemophilus influenzae
          PittII]
          Length = 71

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 6/67 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q         S   G+S          + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATS 61
            FF   
Sbjct: 61 TAFFCYC 67


>gi|87119794|ref|ZP_01075691.1| hypothetical protein MED121_07635 [Marinomonas sp. MED121]
 gi|86165270|gb|EAQ66538.1| hypothetical protein MED121_07635 [Marinomonas sp. MED121]
          Length = 118

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 46/115 (40%), Gaps = 7/115 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS------TAHSLGRFTAILA 54
           M+  ++VVH++  + ++ ++L+Q    +  G+S    + ++           G+ TA+ A
Sbjct: 2   MEALVLVVHVLAAIAIIGLVLLQQGKGADAGASFGGGASQTVFGSQGGGSFFGKLTALFA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
             FF TS AL  ++   + +    +        + Q      D   P+       
Sbjct: 62  LVFFLTSFALAYVASQQAKQVSGQLDYVP-AVEEIQDTVTVPDLVEPQASESDVP 115


>gi|197118720|ref|YP_002139147.1| preprotein translocase subunit SecG [Geobacter bemidjiensis Bem]
 gi|197088080|gb|ACH39351.1| preprotein translocase, SecG subunit [Geobacter bemidjiensis Bem]
          Length = 132

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 37/104 (35%), Gaps = 8/104 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
           M I L+ +H++V   L+ V+L+QS   +  G       S +       +  + + T   A
Sbjct: 1   MTILLVTLHIVVCFALIVVVLLQSGKGAEMGASFGASGSQSVFGAGGGSTFMSKLTTSAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
             F  TS+AL   S          M ++        G       
Sbjct: 61  IIFMLTSLALAFASGKGG--GSSIMSKAPKAKPAPMGGLPLQQP 102


>gi|297180946|gb|ADI17149.1| preprotein translocase subunit secg [uncultured gamma
           proteobacterium HF0070_08D07]
          Length = 114

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/81 (19%), Positives = 26/81 (32%), Gaps = 6/81 (7%)

Query: 17  VCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY 70
           + ++L+Q    +        GSS         A+ L R T   A  FF  S  L  +++ 
Sbjct: 20  IGLVLLQQGKGADVGAAFGSGSSGTVFGSSGGANFLTRLTTFFAVLFFVLSFGLAYLAKE 79

Query: 71  TSTRYKDNMHRSLVDSIKDQG 91
            +          L D      
Sbjct: 80  RTQSSATLPMIELPDRENQDS 100


>gi|49483036|ref|YP_040260.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus MRSA252]
 gi|295427358|ref|ZP_06819993.1| preprotein translocase [Staphylococcus aureus subsp. aureus
          EMRSA16]
 gi|81651512|sp|Q6GIL2|SECG_STAAR RecName: Full=Probable protein-export membrane protein secG
 gi|49241165|emb|CAG39843.1| putative protein-export membrane protein [Staphylococcus aureus
          subsp. aureus MRSA252]
 gi|295128746|gb|EFG58377.1| preprotein translocase [Staphylococcus aureus subsp. aureus
          EMRSA16]
          Length = 77

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M  FL+V+ +I  + L+ V+L+Q   SS F  + +  +         R     L R T I
Sbjct: 1  MHTFLIVLLIIDCIALITVVLLQEGKSSGFSGAISGGAEQLFGKQKQRGVDLFLNRLTII 60

Query: 53 LAFFFFATSIALGMIS 68
          L+  FF   I +  + 
Sbjct: 61 LSILFFVLMICISYLG 76


>gi|27467481|ref|NP_764118.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          ATCC 12228]
 gi|57866442|ref|YP_188041.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          RP62A]
 gi|242242150|ref|ZP_04796595.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          W23144]
 gi|251810214|ref|ZP_04824687.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          BCM-HMP0060]
 gi|282875639|ref|ZP_06284510.1| preprotein translocase, SecG subunit [Staphylococcus epidermidis
          SK135]
 gi|293368242|ref|ZP_06614871.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          M23864:W2(grey)]
 gi|81675180|sp|Q5HQU8|SECG_STAEQ RecName: Full=Probable protein-export membrane protein secG
 gi|81843020|sp|Q8CPY2|SECG_STAES RecName: Full=Probable protein-export membrane protein secG
 gi|27315024|gb|AAO04160.1|AE016745_259 preprotein translocase SecG subunit [Staphylococcus epidermidis
          ATCC 12228]
 gi|57637100|gb|AAW53888.1| preprotein translocase, SecG subunit [Staphylococcus epidermidis
          RP62A]
 gi|242234405|gb|EES36717.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          W23144]
 gi|251806266|gb|EES58923.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          BCM-HMP0060]
 gi|281295666|gb|EFA88189.1| preprotein translocase, SecG subunit [Staphylococcus epidermidis
          SK135]
 gi|291317665|gb|EFE58082.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          M23864:W2(grey)]
 gi|319401143|gb|EFV89358.1| preprotein translocase, SecG subunit [Staphylococcus epidermidis
          FRI909]
 gi|329723295|gb|EGG59825.1| preprotein translocase, SecG subunit [Staphylococcus epidermidis
          VCU144]
 gi|329736861|gb|EGG73126.1| preprotein translocase, SecG subunit [Staphylococcus epidermidis
          VCU028]
 gi|329737930|gb|EGG74154.1| preprotein translocase, SecG subunit [Staphylococcus epidermidis
          VCU045]
          Length = 77

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 29/76 (38%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M   ++V+ +I  + LV V+L+Q         +  G +         R     L R T I
Sbjct: 1  MHTLIIVLLIIDCIALVTVVLLQEGKSNGLSGAISGGAEQLFGKQKQRGVDLFLHRLTII 60

Query: 53 LAFFFFATSIALGMIS 68
          LA  FF     +  + 
Sbjct: 61 LAILFFVLMFCISYLG 76


>gi|114771698|ref|ZP_01449102.1| adenylosuccinate synthetase [alpha proteobacterium HTCC2255]
 gi|114547770|gb|EAU50660.1| adenylosuccinate synthetase [alpha proteobacterium HTCC2255]
          Length = 120

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 50/119 (42%), Gaps = 3/119 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV---RSTAHSLGRFTAILAFFF 57
           MQ  ++V+HLI+ V L+ ++L+Q S+    G      +    R  A  L + T I+A  F
Sbjct: 1   MQNVVLVIHLILSVSLIGIVLLQRSEGGGLGIGGGGNNSGGGRPKAAPLAKVTWIIAIAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
             TSI L +I+   S         S +++  D          +    S + + +    A
Sbjct: 61  LITSITLTIIAAKNSGGSSVTDGFSTIETDTDTLELPKSLEGNLLPPSAADEPALPPKA 119


>gi|258591138|emb|CBE67433.1| putative Protein-export membrane protein, secG-like [NC10 bacterium
           'Dutch sediment']
          Length = 123

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 41/122 (33%), Gaps = 6/122 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M I L V+HL++ + L+ ++L+QS   +        GSS      R  A  L + T   A
Sbjct: 1   MVIALSVIHLLIALVLIVIVLLQSGKGADIGAAFGGGSSQTVFGGRGAATFLSKLTLAAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             F  +SI L + S    +       R    +                    +  +    
Sbjct: 61  VLFMVSSIILTIWSERRGSSSVITEERVGQTAPAPASPPADAPAPPTSPAGQTPPAQVPS 120

Query: 115 VA 116
            A
Sbjct: 121 AA 122


>gi|329113483|ref|ZP_08242264.1| Protein Translocase Subunit SecG [Acetobacter pomorum DM001]
 gi|326697308|gb|EGE48968.1| Protein Translocase Subunit SecG [Acetobacter pomorum DM001]
          Length = 114

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+++H  V + L+ V+LIQ S+    G         F S R TA+ L R TA+LA 
Sbjct: 1  MTTALLILHFCVTIALIGVVLIQRSEGGGLGIGSSQGMGAFMSGRGTANLLTRTTAVLAG 60

Query: 56 FF 57
           F
Sbjct: 61 VF 62


>gi|258542320|ref|YP_003187753.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-01]
 gi|256633398|dbj|BAH99373.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-01]
 gi|256636457|dbj|BAI02426.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-03]
 gi|256639510|dbj|BAI05472.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-07]
 gi|256642566|dbj|BAI08521.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-22]
 gi|256645621|dbj|BAI11569.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-26]
 gi|256648674|dbj|BAI14615.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-32]
 gi|256651727|dbj|BAI17661.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-01-42C]
 gi|256654718|dbj|BAI20645.1| protein translocase subunit SecG [Acetobacter pasteurianus IFO
          3283-12]
          Length = 114

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+++H  V + L+ V+LIQ S+    G         F S R TA+ L R TA+LA 
Sbjct: 1  MTTALLILHFCVTIALIGVVLIQRSEGGGLGIGSSQGMGAFMSGRGTANLLTRTTAVLAG 60

Query: 56 FF 57
           F
Sbjct: 61 VF 62


>gi|223043051|ref|ZP_03613099.1| preprotein translocase, SecG subunit [Staphylococcus capitis
          SK14]
 gi|314933090|ref|ZP_07840456.1| preprotein translocase, SecG subunit [Staphylococcus caprae C87]
 gi|222443905|gb|EEE50002.1| preprotein translocase, SecG subunit [Staphylococcus capitis
          SK14]
 gi|313654409|gb|EFS18165.1| preprotein translocase, SecG subunit [Staphylococcus caprae C87]
          Length = 77

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 29/76 (38%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M   ++V+ +I  + LV V+L+Q         +  G +         R     L R T I
Sbjct: 1  MHTLIIVLLIIDCIALVTVVLLQEGKSNGLSGAISGGAEQLFGKQKQRGVDLFLHRLTII 60

Query: 53 LAFFFFATSIALGMIS 68
          LA  FF     +  + 
Sbjct: 61 LAIIFFVLMFCISYLG 76


>gi|146329507|ref|YP_001209712.1| preprotein translocase, SecG subunit [Dichelobacter nodosus
           VCS1703A]
 gi|146232977|gb|ABQ13955.1| preprotein translocase, SecG subunit [Dichelobacter nodosus
           VCS1703A]
          Length = 125

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 49/130 (37%), Gaps = 13/130 (10%)

Query: 1   MQIFLM-VVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAIL 53
           M   ++ ++ +   + L  +IL+Q S  +  G+S      +     +     L + T  L
Sbjct: 1   MTTLIVQIIFITTAIALSILILLQQSKGAGLGASFGAGASATVFGAKGAGSFLYKLTRFL 60

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
           AF FF +++ +  +   + T         ++   + +   +  +   P     +A  +S 
Sbjct: 61  AFVFFISALMMSYMQNRSVTGTS------ILQQTQLEIKKDAAEIDVPVSGKDNASPASD 114

Query: 114 VVAGKRSSSR 123
                  S++
Sbjct: 115 TGIPTSDSTK 124


>gi|189463557|ref|ZP_03012342.1| hypothetical protein BACCOP_04281 [Bacteroides coprocola DSM 17136]
 gi|189429660|gb|EDU98644.1| hypothetical protein BACCOP_04281 [Bacteroides coprocola DSM 17136]
          Length = 128

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 47/118 (39%), Gaps = 8/118 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           + +  + + ++  V +  V+LIQ+S       +F +S+    VR T   + + T  LA F
Sbjct: 4   LYLLFVGLIVLAAVLMCFVVLIQNSKGGGLSSSFAASNQIMGVRKTTDFIEKLTWGLAIF 63

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
               S+A   +   TS      M +    ++K+Q  +     +        A +   V
Sbjct: 64  MVVVSVATAYVIPTTSEASSVIMDQ----AVKEQKTNPLNAPAGFAAPQSDAATDQPV 117


>gi|152980118|ref|YP_001353151.1| preprotein translocase SecG subunit [Janthinobacterium sp.
           Marseille]
 gi|151280195|gb|ABR88605.1| preprotein translocase SecG subunit [Janthinobacterium sp.
           Marseille]
          Length = 128

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 48/124 (38%), Gaps = 7/124 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAF 55
              ++VV ++  + ++ ++L+Q    +  G+S       +      +++ L +FT + A 
Sbjct: 5   HTIIVVVQVLSALTIIGLVLLQHGKGADMGASFGSGASGSLFGATGSSNFLSKFTGVAAV 64

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSI-KDQGNDNFGDGSSPKLDSVSAKSSSSV 114
            FF+ ++ L  I    +T     M      ++            ++P+       S+ S 
Sbjct: 65  IFFSATLGLAFIGNKPATPSAGVMENLPASAVPGAAAPAQTAPAAAPETPVAPGGSAQSN 124

Query: 115 VAGK 118
              K
Sbjct: 125 QIPK 128


>gi|124266595|ref|YP_001020599.1| protein translocase subunit secG [Methylibium petroleiphilum PM1]
 gi|124259370|gb|ABM94364.1| protein translocase subunit secG [Methylibium petroleiphilum PM1]
          Length = 137

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFF 56
            ++VV ++  + ++ ++LIQ    +  G+S       +      +A+ L R T + A  
Sbjct: 6  TVMVVVQMLSALVMIGLVLIQHGKGADMGASFGSGASGSLFGASGSANFLSRSTGVCAAI 65

Query: 57 FFATSIALGMISRYTSTRYK 76
          FFA ++AL       ++   
Sbjct: 66 FFACTLALAYFGNLRASTGG 85


>gi|113969367|ref|YP_733160.1| preprotein translocase subunit SecG [Shewanella sp. MR-4]
 gi|113884051|gb|ABI38103.1| protein translocase subunit secG [Shewanella sp. MR-4]
          Length = 110

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 39/95 (41%), Gaps = 7/95 (7%)

Query: 17  VCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY 70
           + +ILIQ    +  G+S              + + L R TAILA  FF  S+ +G +S  
Sbjct: 17  IGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILAIAFFTLSLLIGNLSAN 76

Query: 71  TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
            + + +D      VD    Q  D   + S  K+  
Sbjct: 77  HA-KNEDTWKNLGVDEQVTQPVDQATEKSETKIPD 110


>gi|42526747|ref|NP_971845.1| preprotein translocase subunit SecG [Treponema denticola ATCC
          35405]
 gi|41817062|gb|AAS11756.1| preprotein translocase, SecG subunit [Treponema denticola ATCC
          35405]
 gi|325473807|gb|EGC76995.1| preprotein translocase [Treponema denticola F0402]
          Length = 116

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 37/77 (48%), Gaps = 4/77 (5%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDS----SAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
          L+V+ +I+   ++ ++L+Q+ +       F   SN      +++ L R T ++   FF T
Sbjct: 8  LLVLFVIICAIIIFLVLLQNEEGDSLGGLFSGGSNSAFGSKSSNVLTRATYVVVALFFVT 67

Query: 61 SIALGMISRYTSTRYKD 77
          +  L +I++  S     
Sbjct: 68 TFLLALITKTPSDSGLS 84


>gi|82750486|ref|YP_416227.1| preprotein translocase subunit SecG [Staphylococcus aureus RF122]
 gi|82656017|emb|CAI80422.1| probable protein-export translocase membrane protein
          [Staphylococcus aureus RF122]
          Length = 77

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 31/75 (41%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M  FL+V+ +I  + L+ V+L+Q         +  G +         R     L R T I
Sbjct: 1  MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII 60

Query: 53 LAFFFFATSIALGMI 67
          L+  FF   I +  +
Sbjct: 61 LSILFFVLMICISYL 75


>gi|242373016|ref|ZP_04818590.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          M23864:W1]
 gi|242349170|gb|EES40771.1| preprotein translocase subunit SecG [Staphylococcus epidermidis
          M23864:W1]
          Length = 77

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 28/76 (36%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M   ++V+ +I  + LV V+L+Q         +  G +         R     L R T  
Sbjct: 1  MHTLIIVLLIIDCIALVTVVLLQEGKSNGLSGAISGGAEQLFGKQKQRGVDLFLHRLTIF 60

Query: 53 LAFFFFATSIALGMIS 68
          LA  FF     +  + 
Sbjct: 61 LAIIFFVLMFCISYLG 76


>gi|325915538|ref|ZP_08177849.1| protein translocase subunit secG [Xanthomonas vesicatoria ATCC
           35937]
 gi|325538254|gb|EGD09939.1| protein translocase subunit secG [Xanthomonas vesicatoria ATCC
           35937]
          Length = 157

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 46/119 (38%), Gaps = 6/119 (5%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L VV+++V + ++ +IL+Q    +A GS             +  ++ L + T  LA  F
Sbjct: 5   ILNVVYVLVALAMIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLAVVF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           F+ S+ +   + + +     N+      +              P+  +  A  ++   +
Sbjct: 65  FSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAGELTQPLPQAPAAGAVPTAPSQS 123


>gi|313903094|ref|ZP_07836488.1| protein translocase subunit secG [Thermaerobacter subterraneus
          DSM 13965]
 gi|313466596|gb|EFR62116.1| protein translocase subunit secG [Thermaerobacter subterraneus
          DSM 13965]
          Length = 71

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 6/69 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          ++++H++ V+GL+ V+++QS  S+      A G+ + F   R     LGR T ILA  FF
Sbjct: 1  MLILHILAVIGLIAVVILQSGRSAGLSGAIAGGAEAFFGKRRGLDDFLGRMTVILAVVFF 60

Query: 59 ATSIALGMI 67
           TS  LG  
Sbjct: 61 VTSFVLGYF 69


>gi|325268965|ref|ZP_08135586.1| preprotein translocase subunit SecG [Prevotella multiformis DSM
          16608]
 gi|324988586|gb|EGC20548.1| preprotein translocase subunit SecG [Prevotella multiformis DSM
          16608]
          Length = 128

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 37/98 (37%), Gaps = 4/98 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M    +++ +I  + ++ V+LIQ S        F SS+    VR T   + + T  LA  
Sbjct: 1  MYTLFVILIVIAALLMIGVVLIQESKGGGLSSNFSSSNAIMGVRKTTDFIEKTTWGLAIA 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN 94
              S+A   ++    T        +   S  +  N  
Sbjct: 61 MVVISVASAYVAPTADTDESVIEKAATEGSTTNPNNLP 98


>gi|304382006|ref|ZP_07364559.1| preprotein translocase subunit SecG [Prevotella marshii DSM 16973]
 gi|304336804|gb|EFM03027.1| preprotein translocase subunit SecG [Prevotella marshii DSM 16973]
          Length = 128

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 53/129 (41%), Gaps = 5/129 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L+++ ++  + ++ V+LIQ S        F SS+    VR T   + + T  LA  
Sbjct: 1   MYTLLVILIVLASLLMIFVVLIQESKGGGLSSNFSSSNAIMGVRKTTDFIEKTTWGLAIA 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               S+A   +   T    +  + +S  +S     N+  G G+     +  A  S++   
Sbjct: 61  LVVISVACSYVVPSTVN-TESVIEKSATESNTTNPNNLPGFGTGQSQQTAPAGQSNTPAT 119

Query: 117 GKRSSSRTK 125
            K  +S  K
Sbjct: 120 PKAPASPAK 128


>gi|251771558|gb|EES52135.1| preprotein translocase, SecG subunit [Leptospirillum
          ferrodiazotrophum]
          Length = 110

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 38/80 (47%), Gaps = 5/80 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA-----FGSSSNFTSVRSTAHSLGRFTAILAF 55
          M I + V+H++  + ++  +L+QS   +       GSS +    +     L + T +LA 
Sbjct: 1  MTILITVIHVMTCLLIIAAVLLQSGKGAETGVMLGGSSQSMFGAQGATPFLSKLTVVLAT 60

Query: 56 FFFATSIALGMISRYTSTRY 75
           F  TS++L +I + +    
Sbjct: 61 VFMVTSLSLALIKQNSVGPS 80


>gi|15923768|ref|NP_371302.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus Mu50]
 gi|15926455|ref|NP_373988.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus N315]
 gi|21282469|ref|NP_645557.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus MW2]
 gi|49485650|ref|YP_042871.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus MSSA476]
 gi|57650120|ref|YP_185718.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus COL]
 gi|148267238|ref|YP_001246181.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus JH9]
 gi|150393287|ref|YP_001315962.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus JH1]
 gi|151220959|ref|YP_001331781.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus str. Newman]
 gi|156979106|ref|YP_001441365.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus Mu3]
 gi|161353529|ref|YP_499357.2| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus NCTC 8325]
 gi|161509049|ref|YP_001574708.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus USA300_TCH1516]
 gi|162138563|ref|YP_493463.2| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus USA300_FPR3757]
 gi|221142193|ref|ZP_03566686.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus str. JKD6009]
 gi|253317248|ref|ZP_04840461.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus str. CF-Marseille]
 gi|253731408|ref|ZP_04865573.1| Sec family type I general secretory protein SecG [Staphylococcus
          aureus subsp. aureus USA300_TCH959]
 gi|253732772|ref|ZP_04866937.1| Sec family type I general secretory protein SecG [Staphylococcus
          aureus subsp. aureus TCH130]
 gi|255005569|ref|ZP_05144170.2| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus Mu50-omega]
 gi|258452174|ref|ZP_05700190.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A5948]
 gi|258453971|ref|ZP_05701943.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A5937]
 gi|262050044|ref|ZP_06022901.1| protein-export membrane protein [Staphylococcus aureus D30]
 gi|262052705|ref|ZP_06024896.1| protein-export membrane protein [Staphylococcus aureus 930918-3]
 gi|284023801|ref|ZP_06378199.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus 132]
 gi|294850507|ref|ZP_06791236.1| preprotein translocase [Staphylococcus aureus A9754]
 gi|295406502|ref|ZP_06816308.1| preprotein translocase [Staphylococcus aureus A8819]
 gi|296276293|ref|ZP_06858800.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus MR1]
 gi|297208493|ref|ZP_06924922.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus ATCC 51811]
 gi|297245228|ref|ZP_06929102.1| preprotein translocase [Staphylococcus aureus A8796]
 gi|297590286|ref|ZP_06948925.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus MN8]
 gi|300912585|ref|ZP_07130028.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus TCH70]
 gi|304381598|ref|ZP_07364248.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus ATCC BAA-39]
 gi|81649728|sp|Q6GB52|SECG_STAAS RecName: Full=Probable protein-export membrane protein secG
 gi|81694962|sp|Q5HHN9|SECG_STAAC RecName: Full=Probable protein-export membrane protein secG
 gi|81704588|sp|Q7A1F4|SECG_STAAW RecName: Full=Probable protein-export membrane protein secG
 gi|81706012|sp|Q7A6Q1|SECG_STAAN RecName: Full=Probable protein-export membrane protein secG
 gi|81781928|sp|Q99VK3|SECG_STAAM RecName: Full=Probable protein-export membrane protein secG
 gi|13700669|dbj|BAB41966.1| probable protein-export membrane protein [Staphylococcus aureus
          subsp. aureus N315]
 gi|14246547|dbj|BAB56940.1| probable protein-export membrane protein [Staphylococcus aureus
          subsp. aureus Mu50]
 gi|21203906|dbj|BAB94605.1| probable protein-export membrane protein [Staphylococcus aureus
          subsp. aureus MW2]
 gi|49244093|emb|CAG42519.1| putative protein-export membrane protein [Staphylococcus aureus
          subsp. aureus MSSA476]
 gi|57284306|gb|AAW36400.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus COL]
 gi|147740307|gb|ABQ48605.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus JH9]
 gi|149945739|gb|ABR51675.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus JH1]
 gi|150373759|dbj|BAF67019.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus str. Newman]
 gi|156721241|dbj|BAF77658.1| probable protein-export membrane protein [Staphylococcus aureus
          subsp. aureus Mu3]
 gi|160367858|gb|ABX28829.1| possible Sec family Type I general secretory protein SecG
          [Staphylococcus aureus subsp. aureus USA300_TCH1516]
 gi|253724858|gb|EES93587.1| Sec family type I general secretory protein SecG [Staphylococcus
          aureus subsp. aureus USA300_TCH959]
 gi|253729246|gb|EES97975.1| Sec family type I general secretory protein SecG [Staphylococcus
          aureus subsp. aureus TCH130]
 gi|257860389|gb|EEV83221.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A5948]
 gi|257863836|gb|EEV86592.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          A5937]
 gi|259159402|gb|EEW44455.1| protein-export membrane protein [Staphylococcus aureus 930918-3]
 gi|259161840|gb|EEW46425.1| protein-export membrane protein [Staphylococcus aureus D30]
 gi|269940355|emb|CBI48732.1| putative protein-export membrane protein [Staphylococcus aureus
          subsp. aureus TW20]
 gi|283470073|emb|CAQ49284.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus ST398]
 gi|285816480|gb|ADC36967.1| Preprotein translocase subunit SecG [Staphylococcus aureus
          04-02981]
 gi|294822645|gb|EFG39085.1| preprotein translocase [Staphylococcus aureus A9754]
 gi|294968647|gb|EFG44670.1| preprotein translocase [Staphylococcus aureus A8819]
 gi|296886748|gb|EFH25652.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus ATCC 51811]
 gi|297177899|gb|EFH37148.1| preprotein translocase [Staphylococcus aureus A8796]
 gi|297576585|gb|EFH95300.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus MN8]
 gi|298694114|gb|ADI97336.1| probable protein-export translocase membrane protein
          [Staphylococcus aureus subsp. aureus ED133]
 gi|300886831|gb|EFK82033.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus TCH70]
 gi|302332489|gb|ADL22682.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus JKD6159]
 gi|302750675|gb|ADL64852.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus str. JKD6008]
 gi|304339961|gb|EFM05905.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus ATCC BAA-39]
 gi|312438791|gb|ADQ77862.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus TCH60]
 gi|312829270|emb|CBX34112.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus ECT-R 2]
 gi|315129014|gb|EFT85011.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus CGS03]
 gi|315194399|gb|EFU24791.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus CGS00]
 gi|315196257|gb|EFU26611.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus CGS01]
 gi|320139885|gb|EFW31746.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus MRSA131]
 gi|320142024|gb|EFW33852.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus MRSA177]
 gi|323438635|gb|EGA96379.1| preprotein translocase subunit SecG [Staphylococcus aureus O11]
 gi|323441960|gb|EGA99597.1| preprotein translocase subunit SecG [Staphylococcus aureus O46]
 gi|329313499|gb|AEB87912.1| Probable protein-export membrane protein secG [Staphylococcus
          aureus subsp. aureus T0131]
 gi|329723787|gb|EGG60315.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 21189]
 gi|329724625|gb|EGG61132.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 21172]
 gi|329729750|gb|EGG66151.1| preprotein translocase, SecG subunit [Staphylococcus aureus
          subsp. aureus 21193]
          Length = 77

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 31/76 (40%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M  FL+V+ +I  + L+ V+L+Q         +  G +         R     L R T I
Sbjct: 1  MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII 60

Query: 53 LAFFFFATSIALGMIS 68
          L+  FF   I +  + 
Sbjct: 61 LSILFFVLMICISYLG 76


>gi|307293344|ref|ZP_07573190.1| preprotein translocase, SecG subunit [Sphingobium chlorophenolicum
           L-1]
 gi|306881410|gb|EFN12626.1| preprotein translocase, SecG subunit [Sphingobium chlorophenolicum
           L-1]
          Length = 122

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 31/104 (29%), Positives = 41/104 (39%), Gaps = 3/104 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG---SSSNFTSVRSTAHSLGRFTAILAFFF 57
           M  F++VV  IV   LV VIL+Q S+    G   S + F S R  A  L R T ILA  F
Sbjct: 1   MFTFILVVQAIVAALLVTVILMQKSEGGGLGVGGSPAGFMSARGAADFLTRSTTILAGIF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
              S+ L +I+         +                   G+ P
Sbjct: 61  VTLSVVLAVIASVQHRPSDIDTSLVKQAPQSPASAPAPATGNDP 104


>gi|332041816|gb|EGI78165.1| preprotein translocase subunit SecG [Hylemonella gracilis ATCC
           19624]
          Length = 138

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 44/115 (38%), Gaps = 6/115 (5%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAFF 56
             L+ V +I  + ++ ++LIQ    +  G++    S  S       A+ L R TA+LA  
Sbjct: 6   TLLVTVQIITALVMIGLVLIQHGKGADMGAAFGSGSSGSLFGASGSANFLSRTTAVLATV 65

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
           FFA ++AL        T     +            N     G +P   + S  + 
Sbjct: 66  FFAVTLALAYFGNARPTSSGSVLEGPAAVVPASSENAAQIPGGAPAASAESQVAP 120


>gi|148549782|ref|YP_001269884.1| preprotein translocase subunit SecG [Pseudomonas putida F1]
 gi|148513840|gb|ABQ80700.1| protein translocase subunit secG [Pseudomonas putida F1]
          Length = 132

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 53/131 (40%), Gaps = 6/131 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  + LV ++L+Q    +  G+S            + +A  L + TAILA
Sbjct: 2   LETVIVVFHLLAALSLVVLVLLQQGKGAEAGASFGAGASNTVFGSQGSATFLSKLTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF T++ LG  ++  + +               +      +   P L    ++++S+ 
Sbjct: 62  ATFFLTALGLGYFAKQQAHQLSQAGLPDPAVLEVKEPQKPAVNDDVPVLQQQKSETTSNT 121

Query: 115 VAGKRSSSRTK 125
                 +   K
Sbjct: 122 GDVPPPAQEQK 132


>gi|330722334|gb|EGH00194.1| Preprotein translocase subunit SecG [gamma proteobacterium
           IMCC2047]
          Length = 107

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 22/107 (20%), Positives = 42/107 (39%), Gaps = 6/107 (5%)

Query: 16  LVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILAFFFFATSIALGMISR 69
           ++ ++L+Q    +  G+S              + + + R TA+LA FFF TS AL ++++
Sbjct: 1   MIALVLLQQGKGADMGASFGAGASQTVFGSGGSGNFMTRATAVLATFFFVTSFALAIVAK 60

Query: 70  YTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
             S    +      V   +  G           L+   A +S   + 
Sbjct: 61  DKSVIDANAGIPEAVTVDQVDGETLPEISEEGLLEEQPADASLPDLD 107


>gi|254670972|emb|CBA07674.1| protein-export integral membrane protein [Neisseria meningitidis
          alpha153]
          Length = 94

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSA--------FGSSSNFTSVRSTAHSLGRFTAIL 53
          +  + +V++I  + ++ ++L+Q    +          GS+         A+ L R TA+ 
Sbjct: 5  KTLIWIVNIISALAVIVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRSTAVA 64

Query: 54 AFFFFAT 60
          A FFFAT
Sbjct: 65 ATFFFAT 71


>gi|283955345|ref|ZP_06372844.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283793105|gb|EFC31875.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 122

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 20/115 (17%), Positives = 42/115 (36%), Gaps = 8/115 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L+++   +VV +   +L+Q S      +  GS+ +    +  A  L +FT ++   
Sbjct: 1   MITLLIILQFAIVVVICIAVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFVMGIL 60

Query: 57  FFATSIALGMISRYTSTRYKD----NMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
             A +I LG +    S           + + + S          +  +P    + 
Sbjct: 61  LIANTIGLGYLYNKASKDSLAEKIKVENNTTIPSAPIVPTAPNTNSIAPSAPQLP 115


>gi|288801259|ref|ZP_06406714.1| preprotein translocase, SecG subunit [Prevotella sp. oral taxon 299
           str. F0039]
 gi|288331870|gb|EFC70353.1| preprotein translocase, SecG subunit [Prevotella sp. oral taxon 299
           str. F0039]
          Length = 129

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 50/125 (40%), Gaps = 5/125 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M    +++ L+    ++ ++LIQ S        F SS++   VR T   + + T  LA  
Sbjct: 1   MYTLFIILILLASFFMIAIVLIQESKGGGLASNFSSSNSIMGVRKTTDVVEKTTWTLAAS 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
               S+    ++   +T  +  + R   ++     N   G G++   ++       +  A
Sbjct: 61  MVVLSVICAYVAPKAATE-ESAVERMSTEAPATNPNTTPGFGATSTANTKPTTGDVAPQA 119

Query: 117 GKRSS 121
            +++ 
Sbjct: 120 TQQTP 124


>gi|260591510|ref|ZP_05856968.1| preprotein translocase, SecG subunit [Prevotella veroralis F0319]
 gi|260536541|gb|EEX19158.1| preprotein translocase, SecG subunit [Prevotella veroralis F0319]
          Length = 127

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 44/126 (34%), Gaps = 6/126 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M    +++ +I  + ++ V+LIQ S        F SS+    VR T   + + T  LA  
Sbjct: 1   MYTLFVILIVIAALLMIGVVLIQESKGGGLSSNFSSSNAIMGVRKTTDFVEKATWGLAIA 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF--GDGSSPKLDSVSAKSSSSV 114
               SIA   ++   +T        +  ++  +  N              +   + ++  
Sbjct: 61  MVVISIASAYVAPTANTDESVIEKAATGNNATNPNNLPNFGASQQKQAAPAQGGQGNAPQ 120

Query: 115 VAGKRS 120
                +
Sbjct: 121 APATPA 126


>gi|145630377|ref|ZP_01786158.1| preprotein translocase subunit SecG [Haemophilus influenzae
          R3021]
 gi|144984112|gb|EDJ91549.1| preprotein translocase subunit SecG [Haemophilus influenzae
          R3021]
          Length = 71

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 6/67 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+ ++++V + L+  IL+Q         S   G+S          + L R +AILA
Sbjct: 1  MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA 60

Query: 55 FFFFATS 61
            FF   
Sbjct: 61 TAFFVYC 67


>gi|70727108|ref|YP_254022.1| preprotein translocase subunit SecG [Staphylococcus haemolyticus
          JCSC1435]
 gi|84029490|sp|Q4L4K9|SECG_STAHJ RecName: Full=Probable protein-export membrane protein secG
 gi|68447832|dbj|BAE05416.1| secG [Staphylococcus haemolyticus JCSC1435]
          Length = 77

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 28/76 (36%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M    +V+ +I  + L+ V+L+Q         +  G +         R     L R T I
Sbjct: 1  MHTLFIVLLIIDCIALITVVLLQEGKSNGLSGAISGGAEQLFGKQKQRGVDLFLHRLTII 60

Query: 53 LAFFFFATSIALGMIS 68
          LA  FF   I +    
Sbjct: 61 LAVIFFLIMIGISYFG 76


>gi|163793239|ref|ZP_02187215.1| preprotein translocase, SecG subunit [alpha proteobacterium BAL199]
 gi|159181885|gb|EDP66397.1| preprotein translocase, SecG subunit [alpha proteobacterium BAL199]
          Length = 105

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 9/106 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-------NFTSVRSTAHSLGRFTAIL 53
           M   ++ +HL++ + LV V+L+Q S+    G          +F S R TA+ L R TAIL
Sbjct: 1   MTAIVLTIHLMIALALVIVVLLQRSEGGGLGIGGGGGGGMGSFMSARGTANLLTRTTAIL 60

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
           A  F +TSI L +++  T T+    + R                 S
Sbjct: 61  AACFMSTSILLAILAGNTGTQ--SIVDRPAAVDTAPAKTGPAAPVS 104


>gi|260171508|ref|ZP_05757920.1| preprotein translocase subunit SecG [Bacteroides sp. D2]
          Length = 122

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 44/117 (37%), Gaps = 4/117 (3%)

Query: 10  LIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALG 65
           +I  + +  ++LIQ+S        F SS+    VR T   L + T  LA F    SIA  
Sbjct: 2   VIAALLMCFIVLIQNSKGGGLASGFSSSNAIMGVRKTTDFLEKATWGLAIFMVVMSIATA 61

Query: 66  MISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSS 122
            +   ++      + ++  +   +  N   G  +       +   ++   A   + +
Sbjct: 62  YVVPRSAVVKDAVLEQAQKEQQTNPYNLPAGTAAPQTEAPATNAPATETPAPAETPA 118


>gi|83952238|ref|ZP_00960970.1| preprotein translocase, SecG subunit [Roseovarius nubinhibens ISM]
 gi|83837244|gb|EAP76541.1| preprotein translocase, SecG subunit [Roseovarius nubinhibens ISM]
          Length = 121

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 51/122 (41%), Gaps = 3/122 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA--HSLGRFTAILAFFFF 58
           M+  ++ +HL+V + L+ V+L+Q S+    G      +V   +   +LG+ T +L F  F
Sbjct: 1   MENVVLTIHLLVTLALIGVVLLQRSEGGGLGMGGGGGAVAGRSAATALGKLTWVLGFGLF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATSIAL +I+   S      + R      +    D  GD          A    + +   
Sbjct: 61  ATSIALTVIAAEKSA-GSSVLDRLTDAPAQSAPADAQGDTGLGGSLLPPAAGDDTPLLPS 119

Query: 119 RS 120
             
Sbjct: 120 AE 121


>gi|259416202|ref|ZP_05740122.1| preprotein translocase subunit SecG [Silicibacter sp. TrichCH4B]
 gi|259347641|gb|EEW59418.1| preprotein translocase subunit SecG [Silicibacter sp. TrichCH4B]
          Length = 121

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 52/122 (42%), Gaps = 5/122 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA----HSLGRFTAILAFF 56
           M+  ++++HL++ +GL+ V+L+Q S+    G          T      +L + T +LA  
Sbjct: 1   MENVVLIIHLLLALGLIAVVLLQRSEGGGLGMGGGGGGGAMTGRAAATALSKVTWVLAIA 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           F ATSI L +++   S R        +  +     +       +  L   S +++  V +
Sbjct: 61  FIATSITLTVLAAQKSGR-SSITDSLVPSTQDSTPDAPTSPLGNDLLPPSSGENAPLVPS 119

Query: 117 GK 118
             
Sbjct: 120 AD 121


>gi|85374120|ref|YP_458182.1| hypothetical protein ELI_06465 [Erythrobacter litoralis HTCC2594]
 gi|84787203|gb|ABC63385.1| hypothetical protein ELI_06465 [Erythrobacter litoralis HTCC2594]
          Length = 122

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 51/122 (41%), Gaps = 5/122 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFF 57
           + +FL VV  IV   LV V+L+Q S+    G   +     S R  A  L R T  LA  F
Sbjct: 3   LFLFLTVVQAIVAAALVGVVLMQRSEGGGLGIGGSPSGMMSARGAADFLTRTTKWLAVAF 62

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
              SIAL  ++  T+    D +  +L  ++    +D     + P  D+ S  S   +   
Sbjct: 63  VGLSIALAAVAVETT--GGDAIESTLDRNVTSTESDPLAAPAVPGDDAPSTPSDDPLSPA 120

Query: 118 KR 119
             
Sbjct: 121 TE 122


>gi|330994541|ref|ZP_08318465.1| preprotein translocase subunit SecG [Gluconacetobacter sp.
          SXCC-1]
 gi|329758395|gb|EGG74915.1| preprotein translocase subunit SecG [Gluconacetobacter sp.
          SXCC-1]
          Length = 101

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS-----SSNFTSVRSTAHSLGRFTAILAF 55
          M   L+++HL V + L+  ILIQ S+    G        +F S R TA  L R TA+L  
Sbjct: 1  MITVLLLLHLFVTIALIGTILIQRSEGGGLGIGGSQGMGSFMSGRGTATLLTRSTAVLGT 60

Query: 56 FFFATSIALGMISRYTSTRYK 76
           F   S+ L +++R  S+   
Sbjct: 61 VFMVLSLTLAVMNRGASSGVG 81


>gi|117919476|ref|YP_868668.1| preprotein translocase subunit SecG [Shewanella sp. ANA-3]
 gi|117611808|gb|ABK47262.1| protein translocase subunit secG [Shewanella sp. ANA-3]
          Length = 110

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 38/95 (40%), Gaps = 7/95 (7%)

Query: 17  VCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY 70
           + +ILIQ    +  G+S              + + L R TAILA  FF  S+ +G +S  
Sbjct: 17  IGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILAIAFFTLSLLIGNLSAN 76

Query: 71  TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
            + + +D       D    Q  D   + S  K+  
Sbjct: 77  HA-KNEDAWKNLGADEQVTQPVDQATEKSETKIPD 110


>gi|114046594|ref|YP_737144.1| preprotein translocase subunit SecG [Shewanella sp. MR-7]
 gi|113888036|gb|ABI42087.1| protein translocase subunit secG [Shewanella sp. MR-7]
          Length = 110

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 38/95 (40%), Gaps = 7/95 (7%)

Query: 17  VCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY 70
           + +ILIQ    +  G+S              + + L R TAILA  FF  S+ +G +S  
Sbjct: 17  IGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILAIAFFTLSLLIGNLSAN 76

Query: 71  TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
            + + +D       D    Q  D   + S  K+  
Sbjct: 77  HA-KNEDAWKNLGSDEQVTQPVDQATEKSETKIPD 110


>gi|317402117|gb|EFV82710.1| protein-export membrane protein [Achromobacter xylosoxidans C54]
          Length = 138

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 47/131 (35%), Gaps = 11/131 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV------RSTAHSLGRFTAILA 54
           M   L+ V +I  + ++ ++L+Q    +  GS+    S          A+ L R T   A
Sbjct: 4   MLKLLLAVQVISALAIIVLVLLQQGKGADMGSAFGSGSSGSLFGATGAANFLSRATKWAA 63

Query: 55  FFFFATSIALGMISRYTSTRY---KDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
             FFA++  L  +S   ++        M     D    Q        + P   + S   +
Sbjct: 64  VVFFASTAGLAYVSHKGTSGPAVDSGVMQNFPADRSVPQ--VPGAAPTQPGAGASSVPGA 121

Query: 112 SSVVAGKRSSS 122
           SSV     S  
Sbjct: 122 SSVPGAASSVP 132


>gi|119897686|ref|YP_932899.1| preprotein translocase subunit SecG [Azoarcus sp. BH72]
 gi|119670099|emb|CAL94012.1| preprotein translocase SecG subunit [Azoarcus sp. BH72]
          Length = 120

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 42/102 (41%), Gaps = 6/102 (5%)

Query: 14  VGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMI 67
           +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA  FF TS++L  +
Sbjct: 18  LGVIGLVLVQHGKGADMGAAFGSGASGSLFGSSGSANFLSRTTAVLATVFFVTSLSLSYL 77

Query: 68  SRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
           +   ++     M R++  +  +               +    
Sbjct: 78  ASNKTSAPSSVMERAVPSAPAEGAGAVAPATPGDASKAQEIP 119


>gi|23015301|ref|ZP_00055081.1| COG1314: Preprotein translocase subunit SecG [Magnetospirillum
          magnetotacticum MS-1]
          Length = 112

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV----RSTAHSLGRFTAILAFFFFA 59
           ++V+HLI+ V LV VIL+Q S+  A G            R+  + L R T I+A  FF 
Sbjct: 6  IILVIHLILAVTLVGVILLQRSEGGALGIGGGSGGGLMTGRAAGNLLTRTTGIVAAAFFV 65

Query: 60 TSIALGMISRYTSTRYK 76
          TS+ L +++   +    
Sbjct: 66 TSLGLALLANSRTGGGS 82


>gi|148245104|ref|YP_001219798.1| preprotein translocase SecG subunit [Candidatus Vesicomyosocius
           okutanii HA]
 gi|146326931|dbj|BAF62074.1| preprotein translocase SecG subunit [Candidatus Vesicomyosocius
           okutanii HA]
          Length = 123

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 45/119 (37%), Gaps = 10/119 (8%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAF 55
             F+++VH+ + + L+ +IL+Q    +  G++       +   VR     L +    L+ 
Sbjct: 4   FQFILIVHMFLALSLIVLILMQHGKGADAGAAFGAGVSGSVFGVRGANSFLYKLITGLSL 63

Query: 56  FFFATSIALGMISRYTST---RYKDNMHRSLVDS-IKDQGNDNFGDGSSPKLDSVSAKS 110
            FF TS+ L  ++ +  +   +    M +      +              KLD +    
Sbjct: 64  GFFLTSLTLAYLATHDGSIGNKPISIMEQVTTGKLVVPDVPIATVTPILNKLDVIDIPD 122


>gi|317123040|ref|YP_004103043.1| protein translocase subunit secG [Thermaerobacter marianensis DSM
          12885]
 gi|315593020|gb|ADU52316.1| protein translocase subunit secG [Thermaerobacter marianensis DSM
          12885]
          Length = 71

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 39/69 (56%), Gaps = 6/69 (8%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          +++VH++ V+GL+ V+++QS  S+      A G+ + F   R     LGR T ILA  FF
Sbjct: 1  MLIVHILAVIGLIAVVVLQSGRSAGLSGAIAGGAEAFFGKRRGLDEFLGRMTVILAVVFF 60

Query: 59 ATSIALGMI 67
           TS  LG  
Sbjct: 61 ITSFVLGYF 69


>gi|148284062|ref|YP_001248152.1| preprotein translocase subunit SecG [Orientia tsutsugamushi str.
          Boryong]
 gi|146739501|emb|CAM79207.1| protein-export membrane protein [Orientia tsutsugamushi str.
          Boryong]
          Length = 97

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 37/94 (39%), Gaps = 6/94 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS------TAHSLGRFTAILA 54
          M   L+ +H+++ V LV  IL+  + + +    S                 L R   ILA
Sbjct: 1  MMNILLFIHIVISVLLVTAILLHKTGADSLSGLSGRNEGMGIVTSKAATSFLTRIIVILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
            FF  +I L  +S   +T   D +     +++ 
Sbjct: 61 TCFFINAIILANLSSKKNTSITDKLQLQEKNTVP 94


>gi|319787444|ref|YP_004146919.1| preprotein translocase subunit SecG [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465956|gb|ADV27688.1| preprotein translocase, SecG subunit [Pseudoxanthomonas suwonensis
           11-1]
          Length = 142

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 37/101 (36%), Gaps = 6/101 (5%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFF 57
            L VV+++V + ++ +IL+Q    +A GS             R  ++ L + T  LA  F
Sbjct: 5   ILNVVYVLVAIAMIVLILLQRGAGAAAGSGFGAGASGTVFGARGASNFLSKSTKWLAVVF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
           F  S+ +   + +++          +               
Sbjct: 65  FGISLFMAWYATHSARPVVQQDLGVMGQLEVPAAPVAAPGE 105


>gi|320107118|ref|YP_004182708.1| preprotein translocase subunit SecG [Terriglobus saanensis
          SP1PR4]
 gi|319925639|gb|ADV82714.1| preprotein translocase, SecG subunit [Terriglobus saanensis
          SP1PR4]
          Length = 99

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/82 (21%), Positives = 30/82 (36%), Gaps = 6/82 (7%)

Query: 13 VVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGM 66
           + L+ V+L+Q   S+          S      R  A+ L + T   A  F  TSI L +
Sbjct: 16 CLFLIGVVLLQQGKSADLAGAFGGQGSQTAFGPRGAANLLTKLTTWSAVLFMVTSIGLTV 75

Query: 67 ISRYTSTRYKDNMHRSLVDSIK 88
          +   TS     +  ++      
Sbjct: 76 LLAKTSDHSVLSGEKTTQTVPA 97


>gi|83310919|ref|YP_421183.1| preprotein translocase subunit SecG [Magnetospirillum magneticum
          AMB-1]
 gi|82945760|dbj|BAE50624.1| Preprotein translocase subunit SecG [Magnetospirillum magneticum
          AMB-1]
          Length = 112

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 4/77 (5%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV----RSTAHSLGRFTAILAFFFFA 59
           ++V+HLI+ V LV VIL+Q S+  A G            R+  + L R TAI+A  FF 
Sbjct: 6  IILVIHLILAVALVGVILLQRSEGGALGIGGGSGGGLMTGRAAGNLLTRTTAIVAGSFFL 65

Query: 60 TSIALGMISRYTSTRYK 76
          TS+ L +++   +    
Sbjct: 66 TSLVLALLANSRTGGGS 82


>gi|34556749|ref|NP_906564.1| preprotein translocase subunit SecG [Wolinella succinogenes DSM
          1740]
 gi|34482463|emb|CAE09464.1| conserved hypothetical protein [Wolinella succinogenes]
          Length = 101

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 38/100 (38%), Gaps = 6/100 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M   L++   +    +  V+L+Q S      +  GS+ +    +  A  L + T +L F 
Sbjct: 1  MSGILLITQFVFAALIAVVVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKATFVLGFV 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFG 96
          F   +IALG      STR    + +    ++         
Sbjct: 61 FVINTIALGYFYSQESTR--SVIDKVDTKTLVPSSAPAAP 98


>gi|167035706|ref|YP_001670937.1| preprotein translocase subunit SecG [Pseudomonas putida GB-1]
 gi|166862194|gb|ABZ00602.1| preprotein translocase, SecG subunit [Pseudomonas putida GB-1]
          Length = 132

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 53/131 (40%), Gaps = 6/131 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  + LV ++L+Q    +  G+S            + +A  L + TAILA
Sbjct: 2   LETVIVVFHLLAALSLVVLVLLQQGKGAEAGASFGAGASNTVFGSQGSATFLSKLTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF T++ LG  ++  + +               +      +   P L    ++++++ 
Sbjct: 62  ATFFLTALGLGYFAKQQAHQLSQAGLPDPAVLEVKEPQKPAVNDDVPVLQQQKSETTNNT 121

Query: 115 VAGKRSSSRTK 125
                 +   K
Sbjct: 122 GDVPPPAEEQK 132


>gi|299134973|ref|ZP_07028164.1| preprotein translocase, SecG subunit [Afipia sp. 1NLS2]
 gi|298589950|gb|EFI50154.1| preprotein translocase, SecG subunit [Afipia sp. 1NLS2]
          Length = 117

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 33/102 (32%), Positives = 46/102 (45%), Gaps = 4/102 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           MQ  ++V+HLI+V  L+ V+L+Q S+    G        F S R T + L R TAILA  
Sbjct: 1   MQTVVIVIHLIIVAALIGVVLLQRSEGGGLGIGGGGGGGFMSSRGTTNLLTRTTAILAAG 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
           FF TS+ L  ++ Y +             S       N  D 
Sbjct: 61  FFITSLFLSWLAGYDNRPKSLINPAPTSQSGSPAPEKNLLDS 102


>gi|24372784|ref|NP_716826.1| preprotein translocase subunit SecG [Shewanella oneidensis MR-1]
 gi|24346869|gb|AAN54271.1|AE015564_2 preprotein translocase, SecG subunit [Shewanella oneidensis MR-1]
          Length = 111

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 35/95 (36%), Gaps = 6/95 (6%)

Query: 17  VCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY 70
           + +ILIQ    +  G+S              + + L R TAILA  FF  S+ +G +S  
Sbjct: 17  IGLILIQQGKGADMGASFGAGASGTLFGSSGSGNFLTRTTAILAIAFFTLSLLIGNLSAN 76

Query: 71  TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
            +       +         Q  +   + S  K+  
Sbjct: 77  HAKNEDAWKNLGSDTEQVTQPVEQGTEKSETKIPD 111


>gi|149202639|ref|ZP_01879611.1| preprotein translocase, SecG subunit [Roseovarius sp. TM1035]
 gi|149143921|gb|EDM31955.1| preprotein translocase, SecG subunit [Roseovarius sp. TM1035]
          Length = 120

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 45/121 (37%), Gaps = 4/121 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA---HSLGRFTAILAFFF 57
           M+  ++ VHL++ + L+ V+L+Q S+    G         +      +LG+ T ILA  F
Sbjct: 1   MENVVLTVHLLLALALIGVVLLQRSEGGGLGMGGGGGGAMTGRAAATALGKMTWILAAAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
             TSI L +I+   +      + R        +            +   +  ++      
Sbjct: 61  IVTSITLTIIAAQNAAGV-SVLDRLTDQPPAAETTTPALPDVDALMPPPAGDTAPLTPTA 119

Query: 118 K 118
            
Sbjct: 120 D 120


>gi|163783634|ref|ZP_02178623.1| protein export membrane protein SecG [Hydrogenivirga sp.
           128-5-R1-1]
 gi|159881127|gb|EDP74642.1| protein export membrane protein SecG [Hydrogenivirga sp.
           128-5-R1-1]
          Length = 117

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/115 (14%), Positives = 37/115 (32%), Gaps = 8/115 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT-----SVRSTAHSLGRFTAILAF 55
           M   L+ + +IV + L+ + L+Q        +                  L + T  L  
Sbjct: 1   MYYALLTLFVIVSILLIILALLQKGRGDVGAAFGGAMGQSIFGAGGVDTVLTKATYWLGG 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
            F   +I L ++ R         + R + +  +   +   G     + D+  +  
Sbjct: 61  LFLVLAILLSIVPR---EEKGSIIEREIRNGSETAPSKPEGGTQEGRRDNTGSPP 112


>gi|302343399|ref|YP_003807928.1| preprotein translocase, SecG subunit [Desulfarculus baarsii DSM
          2075]
 gi|301640012|gb|ADK85334.1| preprotein translocase, SecG subunit [Desulfarculus baarsii DSM
          2075]
          Length = 137

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 42/96 (43%), Gaps = 7/96 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS-----AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          MQI L+++HL+    LV V+L+Q+   +       G+S            LG+ T I+A 
Sbjct: 1  MQIALILLHLVACAILVLVVLLQTGKGASLGAAFGGASQTVFGSSGAQTFLGKMTTIVAV 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQG 91
           F  TS+ L + +    ++    M      + + + 
Sbjct: 61 IFMVTSLTLAITAGGKGSK--SVMADVAQPAAQQES 94


>gi|266625928|ref|ZP_06118863.1| preprotein translocase, SecG subunit [Clostridium hathewayi DSM
          13479]
 gi|288862176|gb|EFC94474.1| preprotein translocase, SecG subunit [Clostridium hathewayi DSM
          13479]
          Length = 104

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/69 (24%), Positives = 28/69 (40%), Gaps = 7/69 (10%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF-------TSVRSTAHSLGRFTAILAF 55
            L ++ +I+ + L  +IL+Q   +   GS              RS    L +FT   A 
Sbjct: 31 TILSIIFVIICIALSAIILLQEGKTQGLGSIGGMADTYWGRNKGRSMEGKLEKFTRYGAI 90

Query: 56 FFFATSIAL 64
           FF  ++ L
Sbjct: 91 LFFVLALVL 99


>gi|296283877|ref|ZP_06861875.1| hypothetical protein CbatJ_09651 [Citromicrobium bathyomarinum
           JL354]
          Length = 132

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 49/132 (37%), Gaps = 12/132 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
           M +FL V+  I+   LV VIL+Q S+    G           S R  A  L R T  LA 
Sbjct: 1   MFLFLTVLQAIIAAALVGVILMQRSEGGGLGIGGGGSPGGMMSARGAADFLTRATRWLAV 60

Query: 56  FFFATSIALGMISRY-------TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
            F   SI L  ++          ST  ++    +  D +   G        + + D+   
Sbjct: 61  VFVVLSIILASLAVNMTGTDSIESTLDRNVTPAAPADPLAQGGAAAPAAAPAQQGDAADQ 120

Query: 109 KSSSSVVAGKRS 120
             ++  +AG   
Sbjct: 121 GEAADPLAGATE 132


>gi|84516438|ref|ZP_01003797.1| preprotein translocase, SecG subunit [Loktanella vestfoldensis
           SKA53]
 gi|84509474|gb|EAQ05932.1| preprotein translocase, SecG subunit [Loktanella vestfoldensis
           SKA53]
          Length = 117

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 52/117 (44%), Gaps = 7/117 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV--RSTAHSLGRFTAILAFFFF 58
           M+  ++++HLI+ + L+  +L+Q S+    G      +   R  A ++ +FT +LA  F 
Sbjct: 1   MENVVLIIHLILALSLIGTVLLQRSEGGGLGMGGGGGTANSRPPASAISKFTWMLAAAFI 60

Query: 59  ATSIALGMISRYTSTRYK-----DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
           ATSI L +I+   +           ++ +  D       D+    S+ +   + A  
Sbjct: 61  ATSITLTLIAAGNTAGLSVADRVGGINLNQNDVTVPDLGDSLLPPSAAEEPLLPAGD 117


>gi|313683629|ref|YP_004061367.1| preprotein translocase, secg subunit [Sulfuricurvum kujiense DSM
          16994]
 gi|313156489|gb|ADR35167.1| preprotein translocase, SecG subunit [Sulfuricurvum kujiense DSM
          16994]
          Length = 105

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/96 (18%), Positives = 36/96 (37%), Gaps = 6/96 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M   L++V +++VV +   +L+Q S      +  GS+ +    +     L + T  L F 
Sbjct: 1  MTGILLIVQIVLVVMITIAVLLQKSSSIGLGAYSGSNESVFGAKGPGSFLAKVTFFLGFV 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
          F   ++ALG             +   +  +      
Sbjct: 61 FIVNTVALGYFYAQQKNE--SVVDAMVEKTDVAAPT 94


>gi|282879490|ref|ZP_06288224.1| preprotein translocase, SecG subunit [Prevotella timonensis CRIS
           5C-B1]
 gi|281306637|gb|EFA98663.1| preprotein translocase, SecG subunit [Prevotella timonensis CRIS
           5C-B1]
          Length = 175

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/136 (16%), Positives = 43/136 (31%), Gaps = 25/136 (18%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M    + + ++  + +V +++IQ S        F SS+    VR T   + + T  LA F
Sbjct: 1   MYTLFVGLIVLASILMVVIVVIQESKGGGLASNFSSSNAIMGVRKTTDVIEKTTWGLAIF 60

Query: 57  FFATSIALGMISRYTSTRYKDN---------------------MHRSLVDSIKDQGNDNF 95
               S+A   +    S+                            ++ V   ++    N 
Sbjct: 61  MVVLSVACAYVVPRASSEQSVLEKTATETQTTNPNTTPGFGASEQQAPVAGSQNATPANQ 120

Query: 96  GDGSSPKLDSVSAKSS 111
           G   +P         +
Sbjct: 121 GTQQAPATPKAPVAPA 136


>gi|312796903|ref|YP_004029825.1| protein translocase subunit secG [Burkholderia rhizoxinica HKI 454]
 gi|312168678|emb|CBW75681.1| Protein translocase subunit secG [Burkholderia rhizoxinica HKI 454]
          Length = 133

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 52/123 (42%), Gaps = 7/123 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
           ++  ++VV ++  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA
Sbjct: 7   LKTLMIVVQVLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGASGSANFLSRTTAVLA 66

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF +++AL  +  Y        +  +   +       +        + S +A S+   
Sbjct: 67  TVFFVSTLALTALGSYRPKAGGGLLGGAASLAASAPAAGSGVASGV-AVPSSAAPSAGVS 125

Query: 115 VAG 117
             G
Sbjct: 126 TPG 128


>gi|225872135|ref|YP_002753590.1| preprotein translocase, SecG subunit [Acidobacterium capsulatum
          ATCC 51196]
 gi|225794511|gb|ACO34601.1| preprotein translocase, SecG subunit [Acidobacterium capsulatum
          ATCC 51196]
          Length = 96

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 39/94 (41%), Gaps = 6/94 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
          M   +  +H++V + L+ VIL+Q   S+          S      RS +  L + TA  A
Sbjct: 1  MIYLVATIHVLVSLFLIVVILLQQGSSADLAGAFGGQGSQTAFGPRSASTVLTKATAWAA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
            F  TS+ L ++    ST+    +  +   +  
Sbjct: 61 AIFMLTSLTLTILMMRQSTQQHSVLAGTTTSAPA 94


>gi|228474360|ref|ZP_04059095.1| preprotein translocase, SecG subunit [Staphylococcus hominis
          SK119]
 gi|314936919|ref|ZP_07844266.1| preprotein translocase, SecG subunit [Staphylococcus hominis
          subsp. hominis C80]
 gi|228271719|gb|EEK13066.1| preprotein translocase, SecG subunit [Staphylococcus hominis
          SK119]
 gi|313655538|gb|EFS19283.1| preprotein translocase, SecG subunit [Staphylococcus hominis
          subsp. hominis C80]
          Length = 77

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 29/76 (38%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M    MV+ +I  + L+ V+L+Q S       +  G +         R     L R T +
Sbjct: 1  MHTLFMVLLIIDCIALITVVLLQESKSNGLSGAISGGAEQLFGKQKQRGVDLFLHRLTIV 60

Query: 53 LAFFFFATSIALGMIS 68
          LA  FF   I +    
Sbjct: 61 LAIIFFLIMIGISYFG 76


>gi|302391121|ref|YP_003826941.1| protein translocase subunit secG [Acetohalobium arabaticum DSM
          5501]
 gi|302203198|gb|ADL11876.1| protein translocase subunit secG [Acetohalobium arabaticum DSM
          5501]
          Length = 99

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 6/70 (8%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFT-SVRSTAHSLGRFTAILAFFF 57
           L V+HLI+ + L+  +L+QS        +  G +S+F    R     + + T + A  F
Sbjct: 30 VLKVIHLIISLALIAGVLLQSGKSAGLSGAIDGGASSFFDQGRQAEEKIKKLTTVAAILF 89

Query: 58 FATSIALGMI 67
            +S+ L  +
Sbjct: 90 MISSLVLAAL 99


>gi|33597943|ref|NP_885586.1| preprotein translocase subunit SecG [Bordetella parapertussis
           12822]
 gi|33602850|ref|NP_890410.1| preprotein translocase subunit SecG [Bordetella bronchiseptica
           RB50]
 gi|33574372|emb|CAE38710.1| protein-export membrane protein [Bordetella parapertussis]
 gi|33577292|emb|CAE35849.1| protein-export membrane protein [Bordetella bronchiseptica RB50]
          Length = 154

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/116 (16%), Positives = 37/116 (31%), Gaps = 9/116 (7%)

Query: 15  GLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMIS 68
            ++ ++L+Q    +  GS+       +       A+ L R T   A  FF ++  L  ++
Sbjct: 18  AIIVLVLLQQGKGADMGSAFGSGSAGSLFGATGAANFLSRTTKWAAVVFFVSTAGLAYVT 77

Query: 69  RYTSTRY---KDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSS 121
               +        M     D    Q   +   GS   +         +  A   +S
Sbjct: 78  HKGPSGPAIDSGVMQNFPQDRSVPQAPGSAPAGSGSSVPQAPGSGVPAAPAQPDAS 133


>gi|152991634|ref|YP_001357355.1| preprotein translocase subunit G [Sulfurovum sp. NBC37-1]
 gi|151423495|dbj|BAF70998.1| preprotein translocase subunit G [Sulfurovum sp. NBC37-1]
          Length = 115

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 39/103 (37%), Gaps = 6/103 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L++V +++ + +   IL+Q S      +  GS+ +    +     L + T  LAF 
Sbjct: 1   MTSTLLIVQIVLAIAITIAILLQKSSSIGLGAYSGSNESVFGAKGPTGFLAKLTFSLAFL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
           F   ++ALG +  YTS      +      +             
Sbjct: 61  FIVNTLALGYL--YTSQNSASVVDEITPKNNAVIPAAPATAPE 101


>gi|325294779|ref|YP_004281293.1| preprotein translocase, SecG subunit [Desulfurobacterium
          thermolithotrophum DSM 11699]
 gi|325065227|gb|ADY73234.1| preprotein translocase, SecG subunit [Desulfurobacterium
          thermolithotrophum DSM 11699]
          Length = 91

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 33/82 (40%), Gaps = 4/82 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M   L++ H I+ + L+ V+LIQ           G S++      T   L + TAIL   
Sbjct: 1  MFTALLIFHAIIALLLIIVVLIQPGKGDTSSLLGGGSASSAFGADTGAVLTKTTAILGAL 60

Query: 57 FFATSIALGMISRYTSTRYKDN 78
          F   S+ L ++    +      
Sbjct: 61 FMLNSLILSVVGSKLAQENSVV 82


>gi|114330924|ref|YP_747146.1| preprotein translocase subunit SecG [Nitrosomonas eutropha C91]
 gi|114307938|gb|ABI59181.1| protein translocase subunit secG [Nitrosomonas eutropha C91]
          Length = 121

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 50/121 (41%), Gaps = 7/121 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILA 54
           M+  +  VH+I  V +V ++L+Q    +  G++    S  S       A+ L R TA+ A
Sbjct: 1   METLIWSVHIIAAVVVVVLVLLQQGKGADMGAAFGGGSSGSLFGASGSANFLSRMTALAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ L   S          M +  + S K   +    + S  + +S S   +  +
Sbjct: 61  TVFFVTSLTLTYYSSGDKDE-GSVMQKLEIKSDKAADSTGNVESSGAENESGSTSRAGEI 119

Query: 115 V 115
            
Sbjct: 120 P 120


>gi|222824489|ref|YP_002576063.1| preprotein translocase, SecG subunit [Campylobacter lari RM2100]
 gi|222539710|gb|ACM64811.1| preprotein translocase, SecG subunit [Campylobacter lari RM2100]
          Length = 114

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/117 (16%), Positives = 44/117 (37%), Gaps = 12/117 (10%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L+++   +VV +   +L+Q S      +  GS+ +    +  A  L +FT ++   
Sbjct: 1   MTTLLIILQFAIVVIICIAVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFVMGVL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             A +IAL  +    ++          +    +Q      + ++  +    +   S 
Sbjct: 61  LIANTIALSYMYNNANSNS--------LAEKAEQILPKAPETNTTNIPVAPSAPISE 109


>gi|294011599|ref|YP_003545059.1| preprotein translocase subunit SecG [Sphingobium japonicum UT26S]
 gi|292674929|dbj|BAI96447.1| preprotein translocase subunit SecG [Sphingobium japonicum UT26S]
          Length = 125

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 37/79 (46%), Gaps = 3/79 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG---SSSNFTSVRSTAHSLGRFTAILAFFF 57
          M  F++VV  IV   LV VIL+Q S+    G   S + F S R  A  L R T +LA  F
Sbjct: 1  MFTFILVVQAIVAALLVTVILMQKSEGGGLGVGGSPAGFMSARGAADFLTRSTTVLAGIF 60

Query: 58 FATSIALGMISRYTSTRYK 76
             S+ L +I+        
Sbjct: 61 VTLSVVLAVIASIQHRPSD 79


>gi|254469843|ref|ZP_05083248.1| preprotein translocase, SecG subunit [Pseudovibrio sp. JE062]
 gi|211961678|gb|EEA96873.1| preprotein translocase, SecG subunit [Pseudovibrio sp. JE062]
          Length = 121

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 60/121 (49%), Gaps = 5/121 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M+  L+V+HL+VVV LV ++L+Q S+  A G          S R TA+ L R TAILA  
Sbjct: 1   METVLIVIHLMVVVALVAMVLLQRSEGGALGIGGGGGGGVMSSRGTANVLTRGTAILAVC 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           FFATS+AL +++RY   R    + +    S         G+G   +L   S  +   V  
Sbjct: 61  FFATSLALSLLARYD-ERPGSLLDQVPAGSATQGTEQGSGNGLLDQLQQQSQPTGPQVPP 119

Query: 117 G 117
            
Sbjct: 120 A 120


>gi|255321710|ref|ZP_05362865.1| protein-export membrane protein [Campylobacter showae RM3277]
 gi|255301190|gb|EET80452.1| protein-export membrane protein [Campylobacter showae RM3277]
          Length = 115

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 37/97 (38%), Gaps = 6/97 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M    +V+  I  V L   +L+Q S      +  GS+ +    +  A  L +FT ++   
Sbjct: 1  MDSLFLVLQFIFAVVLTIAVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFVVGVL 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
          F   ++AL  +    S++    +      S+      
Sbjct: 61 FILNTLALSYVYNMQSSK--SLIDSVDTSSLPAAPEA 95


>gi|255007883|ref|ZP_05280009.1| preprotein translocase subunit SecG [Bacteroides fragilis 3_1_12]
          Length = 118

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 42/99 (42%), Gaps = 4/99 (4%)

Query: 10  LIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALG 65
           +I  + +  ++LIQ+S        F SS+    VR T   L + T  LA F    SIA  
Sbjct: 2   VIAAILMCFIVLIQNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWGLAAFMVVMSIATA 61

Query: 66  MISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
            +   +S++ +D +        +    +     ++PK D
Sbjct: 62  YVVPTSSSKTQDVIMEQAQQEEQTNPYNLPVGTTAPKTD 100


>gi|254496120|ref|ZP_05109019.1| hypothetical protein LDG_0849 [Legionella drancourtii LLAP12]
 gi|254354661|gb|EET13297.1| hypothetical protein LDG_0849 [Legionella drancourtii LLAP12]
          Length = 105

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 6/76 (7%)

Query: 8  VHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAFFFFATS 61
          +H++V V L+ ++LIQ    +        G+S+     + T   L + T  LA  FF TS
Sbjct: 2  IHVVVAVVLIGLVLIQHGKGADIGAAFGSGASNTLFGSQGTGSFLFKLTGGLALTFFVTS 61

Query: 62 IALGMISRYTSTRYKD 77
          + L  +      + + 
Sbjct: 62 LLLSYLVSIQYQKAEQ 77


>gi|237753265|ref|ZP_04583745.1| preprotein translocase subunit SecG [Helicobacter winghamensis
          ATCC BAA-430]
 gi|229375532|gb|EEO25623.1| preprotein translocase subunit SecG [Helicobacter winghamensis
          ATCC BAA-430]
          Length = 113

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 17/79 (21%), Positives = 35/79 (44%), Gaps = 4/79 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M   L+++  ++ + +  V+++Q S      +  GS+ +    +  A  L + T  L   
Sbjct: 1  MSGILLILQFVLAILITIVVMMQKSSSMGLGAYSGSNESLFGAKGPAGFLVKLTFALGLL 60

Query: 57 FFATSIALGMISRYTSTRY 75
          F   +IALG +    + R 
Sbjct: 61 FVLNTIALGYLYMQDAKRS 79


>gi|329889378|ref|ZP_08267721.1| preprotein translocase, SecG subunit [Brevundimonas diminuta ATCC
           11568]
 gi|328844679|gb|EGF94243.1| preprotein translocase, SecG subunit [Brevundimonas diminuta ATCC
           11568]
          Length = 138

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 42/95 (44%), Gaps = 3/95 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS---SSNFTSVRSTAHSLGRFTAILAFFF 57
           +Q  L+V  +++ V L  VIL+Q S+  A G     S F + R   + L R T+ILA  F
Sbjct: 6   LQTILLVAMILISVALSAVILLQRSEGGALGMGGGPSGFMTARGAGNLLTRTTSILAIAF 65

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
           F  +I L +   Y           ++     DQ  
Sbjct: 66  FVCAIGLTIAGNYARGSRSVIDADAVGSIAVDQPQ 100


>gi|189184246|ref|YP_001938031.1| preprotein translocase subunit SecG [Orientia tsutsugamushi str.
          Ikeda]
 gi|189181017|dbj|BAG40797.1| protein-export membrane protein SecG [Orientia tsutsugamushi str.
          Ikeda]
          Length = 97

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 38/94 (40%), Gaps = 6/94 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS------TAHSLGRFTAILA 54
          M   L+ +H+++ V LV  IL+  + + +    S             +   L R   ILA
Sbjct: 1  MMNILLFIHIVISVLLVTAILLHKTGADSLSGLSGRNEGIGIVTSKASTSFLTRIIVILA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
            FF  +I L  +S   +T   D +     +++ 
Sbjct: 61 TCFFINAIILANLSSKKNTSITDKLQLQESNTVP 94


>gi|92117283|ref|YP_577012.1| preprotein translocase subunit SecG [Nitrobacter hamburgensis X14]
 gi|91800177|gb|ABE62552.1| protein translocase subunit secG [Nitrobacter hamburgensis X14]
          Length = 130

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 31/102 (30%), Positives = 47/102 (46%), Gaps = 3/102 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           M   ++VVHLI+V  L  ++L+Q S+    G      F S R TA+ L R TA LA  FF
Sbjct: 1   MHTVVIVVHLIIVATLTVIVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTAFLAAGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
           ATS+ L  ++ Y   +    +  +     +  G        +
Sbjct: 61  ATSLFLSWLAGYD-HKPGSILDGTPASQSQPAGGATPVAPPA 101


>gi|30249738|ref|NP_841808.1| preprotein translocase subunit SecG [Nitrosomonas europaea ATCC
           19718]
 gi|30180775|emb|CAD85689.1| Preprotein translocase SecG subunit [Nitrosomonas europaea ATCC
           19718]
          Length = 124

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 45/103 (43%), Gaps = 6/103 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
           M+  +  VH+I  V ++ +IL+Q    +  G+      S +      +A+ L R TA+  
Sbjct: 1   METLIWSVHIIAAVIIIILILLQQGKGADMGAAFGSGASGSLFGASGSANFLSRMTALAT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGD 97
             FF TS+ L   S  + +  +  M +  + S +       GD
Sbjct: 61  TVFFITSLTLTYFSGTSHSGEESVMQKLDMKSGEVAVPAAGGD 103


>gi|299066332|emb|CBJ37516.1| preprotein translocase membrane subunit [Ralstonia solanacearum
          CMR15]
          Length = 115

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 40/85 (47%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  L+V  ++  +G++ ++L+Q    +        G+S +      +A+ L R TAILA
Sbjct: 4  LKTLLLVAQILSALGVIGLVLLQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAILA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL ++           M
Sbjct: 64 TVFFIATLALTLLGTSKGNVSAGVM 88


>gi|317505342|ref|ZP_07963270.1| preprotein translocase subunit SecG [Prevotella salivae DSM 15606]
 gi|315663556|gb|EFV03295.1| preprotein translocase subunit SecG [Prevotella salivae DSM 15606]
          Length = 116

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 47/114 (41%), Gaps = 5/114 (4%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
              L+V+ ++  + +V V+LIQ S        F SS+    VR T + + + T  LA   
Sbjct: 3   YTLLVVLIVLAAILMVFVVLIQESKGGGLASNFSSSNAIMGVRKTTNMIEKLTWGLAISM 62

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
              S+    ++    T  +  M ++  ++      +  G G+S ++       +
Sbjct: 63  VVLSVLCARVAPSAPTD-QSVMEKNATETQTTNPINTQGFGASQQVPQAPQSPA 115


>gi|319789631|ref|YP_004151264.1| preprotein translocase, SecG subunit [Thermovibrio ammonificans
          HB-1]
 gi|317114133|gb|ADU96623.1| preprotein translocase, SecG subunit [Thermovibrio ammonificans
          HB-1]
          Length = 96

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/91 (17%), Positives = 33/91 (36%), Gaps = 5/91 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST-----AHSLGRFTAILAF 55
          M   L++ H  + + L+ V++IQ   +    +    +S  S         L + TA+L  
Sbjct: 1  MFTALLIFHAFIALLLIIVVIIQPGQAEGGVAMMGGSSTGSAFGAETGAVLTKTTAVLGA 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDS 86
           F   S+ L ++  +   +            
Sbjct: 61 IFMLNSLILAVVGPHFMNQSSVVEKVIKEQQ 91


>gi|94497169|ref|ZP_01303741.1| preprotein translocase, SecG subunit [Sphingomonas sp. SKA58]
 gi|94423274|gb|EAT08303.1| preprotein translocase, SecG subunit [Sphingomonas sp. SKA58]
          Length = 122

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 30/100 (30%), Positives = 41/100 (41%), Gaps = 6/100 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG---SSSNFTSVRSTAHSLGRFTAILAFFF 57
           M  FL+VV  I+   LV VIL+Q S+    G   S + F S R  A  L R T ILA  F
Sbjct: 1   MFTFLLVVQAIIAALLVTVILMQKSEGGGLGVGGSPAGFMSARGAADFLTRSTTILASVF 60

Query: 58  FATSIALGMISRYTSTRY---KDNMHRSLVDSIKDQGNDN 94
              SI + +I+             + ++          D 
Sbjct: 61  VLLSIVMAVIASVRHAPSDIDTSLVKQAPATQSAPATTDP 100


>gi|295086982|emb|CBK68505.1| protein translocase subunit secG [Bacteroides xylanisolvens XB1A]
          Length = 123

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 43/117 (36%), Gaps = 4/117 (3%)

Query: 10  LIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALG 65
           +I  + +  ++LIQ+S        F SS+    VR T   L + T  LA F    SIA  
Sbjct: 2   VIAALLMCFIVLIQNSKGGGLASGFSSSNAIMGVRKTTDFLEKATWGLAIFMVVMSIATA 61

Query: 66  MISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSS 122
            +   ++      + ++  +   +  N   G  +       +   ++   A    + 
Sbjct: 62  YVVPRSAVAKDAVLEQAQKEQQTNPYNLPAGTAAPQTEAPATNAPATETPAPATETP 118


>gi|239636607|ref|ZP_04677609.1| preprotein translocase, SecG subunit [Staphylococcus warneri
          L37603]
 gi|239597962|gb|EEQ80457.1| preprotein translocase, SecG subunit [Staphylococcus warneri
          L37603]
          Length = 77

 Score = 58.1 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 30/76 (39%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M  F +V+ +I  + LV V+L+Q         +  G +         R     L R T I
Sbjct: 1  MHTFFVVLLIIDCIALVTVVLLQEGKSNGLSGAISGGAEQLFGKQKQRGVDLFLHRLTII 60

Query: 53 LAFFFFATSIALGMIS 68
          L+  FF   I +  + 
Sbjct: 61 LSVIFFLLMIGISYLG 76


>gi|34496395|ref|NP_900610.1| protein-export integral membrane protein [Chromobacterium violaceum
           ATCC 12472]
 gi|34102248|gb|AAQ58614.1| protein-export integral membrane protein [Chromobacterium violaceum
           ATCC 12472]
          Length = 118

 Score = 58.1 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 22/102 (21%), Positives = 47/102 (46%), Gaps = 6/102 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILA 54
           ++  + +V+L+    ++ ++L+Q    +  G++    S  S       A+ L R TA++A
Sbjct: 4   LKTLIWIVNLLSAASIIVLVLMQHGKGADMGAAFGSGSSGSLFGASGSANFLSRTTAVVA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFG 96
             FF+TS+AL  +S    +      + S ++ +  Q      
Sbjct: 64  VVFFSTSMALVFLSGGGKSDLGVMGNGSKIEQVAPQIPAGAP 105


>gi|209963460|ref|YP_002296375.1| preprotein translocase, SecG subunit, putative [Rhodospirillum
          centenum SW]
 gi|209956926|gb|ACI97562.1| preprotein translocase, SecG subunit, putative [Rhodospirillum
          centenum SW]
          Length = 117

 Score = 58.1 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 30/89 (33%), Positives = 44/89 (49%), Gaps = 5/89 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV----RSTAHSLGRFTAILAFF 56
          M+  ++VVHL++ V LV V+LIQ S+    G            R +A+ L R TAILA  
Sbjct: 1  MEKVVLVVHLLIAVSLVGVVLIQKSEGGGLGIGGGTMGGLMTTRGSANLLTRTTAILAAC 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVD 85
          FF TS+ L  ++  T    +    R+   
Sbjct: 61 FFTTSLVLAAMTGATG-PAESIFDRTAPG 88


>gi|187929294|ref|YP_001899781.1| preprotein translocase subunit SecG [Ralstonia pickettii 12J]
 gi|187726184|gb|ACD27349.1| preprotein translocase, SecG subunit [Ralstonia pickettii 12J]
          Length = 120

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 40/90 (44%), Gaps = 6/90 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  L+V  ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLLLVAQILSALGVIGLVLLQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLV 84
            FF  ++AL +I           M     
Sbjct: 64 TVFFVATLALTLIGTNKGGVSAGVMGSVAP 93


>gi|329901005|ref|ZP_08272666.1| Preprotein translocase subunit SecG [Oxalobacteraceae bacterium
          IMCC9480]
 gi|327549293|gb|EGF33868.1| Preprotein translocase subunit SecG [Oxalobacteraceae bacterium
          IMCC9480]
          Length = 125

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 12/84 (14%), Positives = 36/84 (42%), Gaps = 6/84 (7%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAFF 56
            ++V+ ++  + ++ ++L+Q    +  G+      S +      +++ L + T + A  
Sbjct: 6  TIIVVIQVVTALTIIGLVLMQHGKGADMGAAFGSGASGSLFGATGSSNFLSKMTGVAAAV 65

Query: 57 FFATSIALGMISRYTSTRYKDNMH 80
          FF +++AL  +    +        
Sbjct: 66 FFGSTLALAYLGTGRTVSTGSVTD 89


>gi|310815251|ref|YP_003963215.1| putative preprotein translocase [Ketogulonicigenium vulgare Y25]
 gi|308753986|gb|ADO41915.1| putative preprotein translocase [Ketogulonicigenium vulgare Y25]
          Length = 122

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 24/119 (20%), Positives = 48/119 (40%), Gaps = 6/119 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS------VRSTAHSLGRFTAILA 54
           M+  +++VHLI+ + L+ V+L+Q S+    G  +   +       RS   +L + T  LA
Sbjct: 1   METVVIIVHLILALVLIGVVLLQRSEGGGLGMGAGGGNGGLPSTGRSGTTALAKATWWLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
             F  TS+ L +++   ++      +  L+                P   +  + S   
Sbjct: 61  GAFIVTSLVLTILAATGNSGSGLMSNPDLLLPPPASDAPAASGLLPPAAGTTESNSLLP 119


>gi|319761761|ref|YP_004125698.1| preprotein translocase, secg subunit [Alicycliphilus
          denitrificans BC]
 gi|317116322|gb|ADU98810.1| preprotein translocase, SecG subunit [Alicycliphilus
          denitrificans BC]
          Length = 121

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 6/84 (7%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAFF 56
            ++ + ++  +G++ +ILIQ    +  G++    S  S       A+ L R TA+LA  
Sbjct: 6  NVILAIQMLAALGMIGLILIQHGKGADMGAAFGSGSSGSLFGASGSANFLSRTTAVLATI 65

Query: 57 FFATSIALGMISRYTSTRYKDNMH 80
          FF  ++AL              + 
Sbjct: 66 FFVATLALAYFGNQRPASSGSVLE 89


>gi|330826541|ref|YP_004389844.1| preprotein translocase subunit SecG [Alicycliphilus denitrificans
          K601]
 gi|329311913|gb|AEB86328.1| preprotein translocase, SecG subunit [Alicycliphilus
          denitrificans K601]
          Length = 121

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 6/84 (7%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAFF 56
            ++ + ++  +G++ +ILIQ    +  G++    S  S       A+ L R TA+LA  
Sbjct: 6  NIILAIQMLAALGMIGLILIQHGKGADMGAAFGSGSSGSLFGASGSANFLSRTTAVLATI 65

Query: 57 FFATSIALGMISRYTSTRYKDNMH 80
          FF  ++AL              + 
Sbjct: 66 FFVATLALAYFGNQRPASSGSVLE 89


>gi|268680894|ref|YP_003305325.1| preprotein translocase, SecG subunit [Sulfurospirillum deleyianum
          DSM 6946]
 gi|268618925|gb|ACZ13290.1| preprotein translocase, SecG subunit [Sulfurospirillum deleyianum
          DSM 6946]
          Length = 112

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 31/78 (39%), Gaps = 4/78 (5%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
             L+V   I+   L   +L+Q S      +  GS+ +    +  A  + +FT ILA  F
Sbjct: 3  TSVLLVFQFILTAILTIAVLLQKSSSIGLGAYSGSNESLFGAKGPAGFMAKFTFILAIVF 62

Query: 58 FATSIALGMISRYTSTRY 75
           A ++ LG          
Sbjct: 63 VANTLTLGYFYNQDKKVS 80


>gi|163737682|ref|ZP_02145099.1| adenylosuccinate synthetase [Phaeobacter gallaeciensis BS107]
 gi|163740734|ref|ZP_02148127.1| preprotein translocase, SecG subunit [Phaeobacter gallaeciensis
           2.10]
 gi|161385725|gb|EDQ10101.1| preprotein translocase, SecG subunit [Phaeobacter gallaeciensis
           2.10]
 gi|161389208|gb|EDQ13560.1| adenylosuccinate synthetase [Phaeobacter gallaeciensis BS107]
          Length = 120

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 50/121 (41%), Gaps = 4/121 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA---HSLGRFTAILAFFF 57
           M+  ++++HL++ +GL+ V+L+Q S+    G         S      ++ + T ILA  F
Sbjct: 1   MENVVLIIHLLLALGLIAVVLLQRSEGGGLGMGGGGGGAMSGRAAATAMSKLTWILAVAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
             TSI L +++   S        R    + +   +       S  L  V   ++  V + 
Sbjct: 61  IGTSITLTILAAQKSA-GSSVADRLSAPAAEGAADAPEAPLGSDLLPPVQGDNAPLVPSA 119

Query: 118 K 118
            
Sbjct: 120 D 120


>gi|300691024|ref|YP_003752019.1| preprotein translocase membrane subunit [Ralstonia solanacearum
          PSI07]
 gi|299078084|emb|CBJ50727.1| preprotein translocase membrane subunit [Ralstonia solanacearum
          PSI07]
          Length = 116

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 39/85 (45%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  L+V  ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLLLVAQILSALGVIGLVLLQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++ L +I           M
Sbjct: 64 TVFFIATLTLTLIGTSKGNVSAGVM 88


>gi|118474943|ref|YP_892898.1| protein-export membrane protein [Campylobacter fetus subsp. fetus
          82-40]
 gi|261885620|ref|ZP_06009659.1| protein-export membrane protein [Campylobacter fetus subsp.
          venerealis str. Azul-94]
 gi|118414169|gb|ABK82589.1| protein-export membrane protein [Campylobacter fetus subsp. fetus
          82-40]
          Length = 109

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 31/79 (39%), Gaps = 4/79 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M    + +  I+ V L   IL+Q S      +  GS+ +    +  A  L +FT  +   
Sbjct: 1  MSSIFLALQFILAVILTIAILLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFFIGLL 60

Query: 57 FFATSIALGMISRYTSTRY 75
          F   ++ALG     +    
Sbjct: 61 FVLNTLALGYTYNQSLRNS 79


>gi|315607788|ref|ZP_07882781.1| preprotein translocase subunit SecG [Prevotella buccae ATCC
          33574]
 gi|315250257|gb|EFU30253.1| preprotein translocase subunit SecG [Prevotella buccae ATCC
          33574]
          Length = 128

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 37/100 (37%), Gaps = 5/100 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M   L+ V ++V   ++ ++L+Q S        F S++    VR+  + + + T  LA  
Sbjct: 1  MYTLLVTVIVLVSFLMIGIVLVQESKGGGLASNFQSANQLFGVRTAHNGVEKITWALAVL 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFG 96
              S+A   ++   +      M  +  +           
Sbjct: 61 MVVISVACAYVAPV-AKSDGSVMEGATTEQTATPAMPGAS 99


>gi|288924775|ref|ZP_06418712.1| preprotein translocase, SecG subunit [Prevotella buccae D17]
 gi|288338562|gb|EFC76911.1| preprotein translocase, SecG subunit [Prevotella buccae D17]
          Length = 128

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 37/100 (37%), Gaps = 5/100 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M   L+ V ++V   ++ ++L+Q S        F S++    VR+  + + + T  LA  
Sbjct: 1  MYTLLVTVIVLVSFLMIGIVLVQESKGGGLASNFQSANQLFGVRTAHNGVEKITWALAVL 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFG 96
              S+A   ++   +      M  +  +           
Sbjct: 61 MVVISVACAYVAPV-AKSDGSVMEGATTEQTATPAMPGAS 99


>gi|226939455|ref|YP_002794528.1| SecG [Laribacter hongkongensis HLHK9]
 gi|226714381|gb|ACO73519.1| SecG [Laribacter hongkongensis HLHK9]
          Length = 120

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 42/99 (42%), Gaps = 7/99 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILA 54
           ++  + +V+++  + ++ ++L+Q    +  G++    S  S       A+ L R TA+ +
Sbjct: 4   LKTLVWIVNIVSAIAVIVLVLMQHGKGADMGAAFGSGSSGSLFGASGSANFLSRTTAVCS 63

Query: 55  FFFFATSIALGMISRYTSTRYK-DNMHRSLVDSIKDQGN 92
             FFAT +A+ ++            M    V     Q  
Sbjct: 64  TVFFATCLAMALMFGVPKKENALGVMSGQAVPQKVQQNA 102


>gi|319891783|ref|YP_004148658.1| Preprotein translocase subunit SecG [Staphylococcus
          pseudintermedius HKU10-03]
 gi|317161479|gb|ADV05022.1| Preprotein translocase subunit SecG [Staphylococcus
          pseudintermedius HKU10-03]
 gi|323465048|gb|ADX77201.1| preprotein translocase, SecG subunit [Staphylococcus
          pseudintermedius ED99]
          Length = 77

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 29/75 (38%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M  F +V+ +I  + L+ V+L+Q         +  G +         R     L R T +
Sbjct: 1  MHSFFVVLLIIDCIALITVVLLQEGKSNGLSGAISGGAEQLFGKQKQRGVDLFLHRLTIV 60

Query: 53 LAFFFFATSIALGMI 67
          L+  FF   + +   
Sbjct: 61 LSIIFFVLMLGISYF 75


>gi|91789117|ref|YP_550069.1| preprotein translocase subunit SecG [Polaromonas sp. JS666]
 gi|91698342|gb|ABE45171.1| protein translocase subunit secG [Polaromonas sp. JS666]
          Length = 140

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 34/84 (40%), Gaps = 6/84 (7%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAFF 56
            ++ + ++  +G++ +IL+Q    +  G++       S       A+ L R T +LA  
Sbjct: 6  TIVLALQMLAALGMIGLILVQHGKGADMGAAFGSGGSGSLFGASGSANFLSRTTGVLAAV 65

Query: 57 FFATSIALGMISRYTSTRYKDNMH 80
          FFA ++ L              + 
Sbjct: 66 FFACTLLLAYFGNAQPRTSSSVLD 89


>gi|269202401|ref|YP_003281670.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus ED98]
 gi|262074691|gb|ACY10664.1| preprotein translocase subunit SecG [Staphylococcus aureus subsp.
          aureus ED98]
          Length = 77

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 30/76 (39%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M  FL+V+ +I  + L+ V+L+Q         +  G +         R     L R   I
Sbjct: 1  MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLIII 60

Query: 53 LAFFFFATSIALGMIS 68
          L+  FF   I +  + 
Sbjct: 61 LSILFFVLMICISYLG 76


>gi|260223143|emb|CBA33412.1| Protein-export membrane protein secG [Curvibacter putative symbiont
           of Hydra magnipapillata]
          Length = 119

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/106 (18%), Positives = 39/106 (36%), Gaps = 6/106 (5%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAFF 56
             ++ V L+  V ++ +IL+Q    +  G++       S       A+ L R TA+LA  
Sbjct: 6   TIILTVQLLAAVAMIGLILVQHGKGADMGAAFGSGGSGSLFGASGSANFLSRTTAVLATV 65

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
           FF +++AL              +  + V +            +   
Sbjct: 66  FFVSTLALAYFGNLRPASSGSVLEGAAVVAPAVAPVAETAPATPAS 111


>gi|261880287|ref|ZP_06006714.1| preprotein translocase [Prevotella bergensis DSM 17361]
 gi|270332974|gb|EFA43760.1| preprotein translocase [Prevotella bergensis DSM 17361]
          Length = 131

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 23/114 (20%), Positives = 47/114 (41%), Gaps = 5/114 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M  F +V+ ++V + ++ ++LIQ S        F SS+    VR T   + + T  LA  
Sbjct: 1   MYTFFVVLIVLVSLLMIFIVLIQESKGGGLASNFSSSNAIMGVRKTTDFVEKATWGLAAL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
               SI     +   ST  +  + ++  ++      +  G  ++P   +    +
Sbjct: 61  MVVFSIVCAYTAPQAST-SQSVLEKAATETQTTNPINTQGFQAAPAEGTAPKGT 113


>gi|238020291|ref|ZP_04600717.1| hypothetical protein GCWU000324_00169 [Kingella oralis ATCC 51147]
 gi|237867271|gb|EEP68277.1| hypothetical protein GCWU000324_00169 [Kingella oralis ATCC 51147]
          Length = 194

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/130 (16%), Positives = 54/130 (41%), Gaps = 9/130 (6%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS-------SNFTSVRSTAHSLGRFTAILA 54
           +  ++V+++   + +VC++L+Q    +  G+                 A+ L R TA+ A
Sbjct: 5   KTLILVINIFSSISVVCLVLMQQGKGADAGAGFGGSGSAQGVFGSAGNANFLSRMTALFA 64

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF +S+AL  +  ++  R K     ++  +     +      S     ++  +++ + 
Sbjct: 65  TIFFISSLALSYV--HSGNRNKGIDFSNVQQTASVAASAPASSVSVASQPALPQQTAPAA 122

Query: 115 VAGKRSSSRT 124
            +   +S+  
Sbjct: 123 TSASVTSASQ 132


>gi|171463525|ref|YP_001797638.1| preprotein translocase, SecG subunit [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171193063|gb|ACB44024.1| preprotein translocase, SecG subunit [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 114

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 18/109 (16%), Positives = 39/109 (35%), Gaps = 6/109 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAF 55
           +  L+V+ +I  + ++ ++L+Q    +  G+      S +      +A+ L R TAI A 
Sbjct: 5   KTLLIVLQVISALAVILLVLLQQGKGADMGAAFGSGASGSLFGASGSANFLSRATAIFAA 64

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
            FF  ++ +  +                  +          D   P + 
Sbjct: 65  VFFICTLGITWLGNKKEVSPGVLSGTVAPAAAPAAPVAPVQDPIKPAVP 113


>gi|254797206|ref|YP_003082046.1| preprotein translocase, SecG subunit [Neorickettsia risticii str.
          Illinois]
 gi|254590444|gb|ACT69806.1| preprotein translocase, SecG subunit [Neorickettsia risticii str.
          Illinois]
          Length = 107

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
          FL+V+  IV V +V ++L Q+S      +          VRS +    RFT +L   FF 
Sbjct: 3  FLIVLQFIVAVLIVILVLCQNSGSSVPGALTSGRRGLFPVRSASGLFVRFTWVLLLLFFL 62

Query: 60 TSIALGMISRYTSTR 74
           +I LG ++  ++T 
Sbjct: 63 NTIFLGRLNFASNTE 77


>gi|288803687|ref|ZP_06409117.1| preprotein translocase, SecG subunit [Prevotella melaninogenica
          D18]
 gi|288333927|gb|EFC72372.1| preprotein translocase, SecG subunit [Prevotella melaninogenica
          D18]
          Length = 126

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 37/89 (41%), Gaps = 4/89 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M    +++ +I  + ++ V+LIQ S        F SS+    VR T   + + T  LA  
Sbjct: 1  MYTLFVILIVIAALLMIGVVLIQESKGGGLSSNFSSSNAIMGVRKTTDFVEKTTWGLAIA 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVD 85
              S+A   ++   +T        +L D
Sbjct: 61 MVIISVASAYVAPSATTDASVVEKAALDD 89


>gi|302345672|ref|YP_003814025.1| preprotein translocase, SecG subunit [Prevotella melaninogenica
          ATCC 25845]
 gi|302149713|gb|ADK95975.1| preprotein translocase, SecG subunit [Prevotella melaninogenica
          ATCC 25845]
          Length = 126

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 37/89 (41%), Gaps = 4/89 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M    +++ +I  + ++ V+LIQ S        F SS+    VR T   + + T  LA  
Sbjct: 1  MYTLFVILIVIAALLMIGVVLIQESKGGGLSSNFSSSNAIMGVRKTTDFVEKTTWGLAIA 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVD 85
              S+A   ++   +T        +L D
Sbjct: 61 MVIISVASAYVAPSATTDASVVEKAALDD 89


>gi|237748895|ref|ZP_04579375.1| predicted protein [Oxalobacter formigenes OXCC13]
 gi|229380257|gb|EEO30348.1| predicted protein [Oxalobacter formigenes OXCC13]
          Length = 134

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 19/133 (14%), Positives = 53/133 (39%), Gaps = 8/133 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA--------HSLGRFTAI 52
           +   ++++ +I  + ++ ++L+Q    +  G++    S  S +        + L + TAI
Sbjct: 2   LYNIIIIIQVISALAIIALVLMQQGKGADMGAAFGAGSSGSGSLFGASGSSNFLSKSTAI 61

Query: 53  LAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
            A  FF +++ +  I    +      + +     +         + S  K  S +A    
Sbjct: 62  AAVIFFVSTLVMAYIGNSRAPTQSGIIEKLQSAPVAPVEQPKAPEPSMSKDASGAAAIPG 121

Query: 113 SVVAGKRSSSRTK 125
           +  + ++  + +K
Sbjct: 122 ATQSMEQGKNTSK 134


>gi|73663218|ref|YP_301999.1| preprotein translocase subunit SecG [Staphylococcus saprophyticus
          subsp. saprophyticus ATCC 15305]
 gi|84029491|sp|Q49W06|SECG_STAS1 RecName: Full=Probable protein-export membrane protein secG
 gi|72495733|dbj|BAE19054.1| putative preprotein translocase subunit [Staphylococcus
          saprophyticus subsp. saprophyticus ATCC 15305]
          Length = 77

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 29/76 (38%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M   +MV+ ++  + LV V+L+Q         +  G +         R     L R T +
Sbjct: 1  MHTLIMVLLILDCIALVTVVLLQEGKSNGLSGAISGGAEQLFGKQKQRGIDLFLHRLTIV 60

Query: 53 LAFFFFATSIALGMIS 68
          L+  FF   + +    
Sbjct: 61 LSVIFFLLMLGISYFG 76


>gi|312870272|ref|ZP_07730400.1| preprotein translocase, SecG subunit [Lactobacillus oris
          PB013-T2-3]
 gi|311094156|gb|EFQ52472.1| preprotein translocase, SecG subunit [Lactobacillus oris
          PB013-T2-3]
          Length = 79

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 9/79 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHS---LGRFTA 51
          M   LM + LIV V L+  +++Q +       S+  G + +  S R        +   T 
Sbjct: 1  MYNTLMTIFLIVCVILIACVMMQPAKNDNDAMSALTGGAGDLFSRRKARGFEAVMQIVTT 60

Query: 52 ILAFFFFATSIALGMISRY 70
          I    FF  ++AL  +S +
Sbjct: 61 ICGALFFILALALVYVSSH 79


>gi|307942207|ref|ZP_07657558.1| preprotein translocase subunit SecG [Roseibium sp. TrichSKD4]
 gi|307774493|gb|EFO33703.1| preprotein translocase subunit SecG [Roseibium sp. TrichSKD4]
          Length = 124

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 59/119 (49%), Gaps = 5/119 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M+  ++V+HL++V+ LV V+L+Q S+  A G          S R TA+ L R TAILA  
Sbjct: 1   METVVIVIHLMIVLALVLVVLLQRSEGGALGIGGGGGGGMMSARGTANVLTRATAILAVA 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
           FF TS++L +I++    R    +  +   +         G+     LD++  +S  S  
Sbjct: 61  FFITSLSLSLIAKNE-DRPSSILDATSPAASDSAPTTADGESGGGILDALKEQSQPSGP 118


>gi|254281861|ref|ZP_04956829.1| secretion protein SecG [gamma proteobacterium NOR51-B]
 gi|219678064|gb|EED34413.1| secretion protein SecG [gamma proteobacterium NOR51-B]
          Length = 138

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 54/128 (42%), Gaps = 6/128 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M+  ++V HL V + ++ +I++Q    +  G+S              T + L + TA L+
Sbjct: 1   MEQLILVGHLFVALAIIGLIMLQQGKGADIGASFGAGASQTLFGSTGTTNVLTKSTAWLS 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FFA+S +L MI+   +   +D      V++          D +  +   + + S    
Sbjct: 61  AAFFASSFSLAMIADSRTAGDEDLGFEIPVEASSSAPEALPIDQAGFEAPVLESSSEIPQ 120

Query: 115 VAGKRSSS 122
           + G  S +
Sbjct: 121 IDGSESGA 128


>gi|332185339|ref|ZP_08387088.1| preprotein translocase, SecG subunit [Sphingomonas sp. S17]
 gi|332015063|gb|EGI57119.1| preprotein translocase, SecG subunit [Sphingomonas sp. S17]
          Length = 121

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 46/120 (38%), Gaps = 3/120 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFF 57
           M  FL+V+H I+   LV VIL+Q S+    G   +     S R  A  L R TA+LA  F
Sbjct: 1   MFAFLLVIHAIIAATLVTVILMQRSEGGGLGMGGSPSGLMSARGAADFLSRATAVLATAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
              SI L +++   S    D        +             +    +     +S+V   
Sbjct: 61  VGFSILLAVLAATRSAPTIDTSLARTPATQAPITQPAPAPVPTGAAPATQPADNSAVPLA 120


>gi|303257196|ref|ZP_07343210.1| preprotein translocase, SecG subunit [Burkholderiales bacterium
           1_1_47]
 gi|302860687|gb|EFL83764.1| preprotein translocase, SecG subunit [Burkholderiales bacterium
           1_1_47]
          Length = 125

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 45/122 (36%), Gaps = 6/122 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           +    +V+ +I  V ++ ++L+Q    +  G++       +      +A+ L R TA+ +
Sbjct: 4   LITVAVVLQVISAVAIIVLVLLQHGKGADMGAAFGGGASGSLFGATGSANFLSRSTAVAS 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  ++AL    +         +  ++    K          ++   D     + + +
Sbjct: 64  TIFFCATLALTFGGQVRKAPAAGGVLSTVTTEQKAPAQPTPPVPATNTSDFTDKPAQNQI 123

Query: 115 VA 116
             
Sbjct: 124 PR 125


>gi|167751945|ref|ZP_02424072.1| hypothetical protein ALIPUT_00187 [Alistipes putredinis DSM 17216]
 gi|167660186|gb|EDS04316.1| hypothetical protein ALIPUT_00187 [Alistipes putredinis DSM 17216]
          Length = 124

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 20/117 (17%), Positives = 45/117 (38%), Gaps = 6/117 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA---FGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           +    +++ L+  + ++  +L+Q+  S     FG+S+    VR T+  L +FT  +A   
Sbjct: 2   LYTLCIILILVASILIILAVLVQNPKSGMAANFGASNQVMGVRQTSDFLEKFTWTMAVVI 61

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
              S+ L  ++       + N+   L             +  +P +      +S   
Sbjct: 62  VVLSL-LATLAMDRGLVARSNVE--LEKDANALMEKMIVEDPAPAVPQAELPASDQQ 115


>gi|114707417|ref|ZP_01440313.1| protein-export membrane protein [Fulvimarina pelagi HTCC2506]
 gi|114536976|gb|EAU40104.1| protein-export membrane protein [Fulvimarina pelagi HTCC2506]
          Length = 258

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 35/114 (30%), Positives = 60/114 (52%), Gaps = 5/114 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFF 57
           M+  L+V+HL++V+ LV V+L+Q S+  A G         S R  A++L + T ILA  F
Sbjct: 1   METILIVIHLMIVIALVVVVLLQRSEGGALGIGGGGGGMMSARGAANALTKTTGILAAGF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
           F TS++LG+++RY  ++  D + +   +  +     +  D     L S    +S
Sbjct: 61  FITSLSLGILARY-GSQPTDILDQLPSNQGQSTDGGSLLDQ-LGGLPSEDEGAS 112


>gi|213581062|ref|ZP_03362888.1| preprotein translocase subunit SecG [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 92

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 35/88 (39%), Gaps = 6/88 (6%)

Query: 19  VILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTS 72
           +I++Q    +  G+S      +       + + + R TA+LA  FF  S+ LG I+   +
Sbjct: 1   MIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTAVLATLFFIISLVLGNINSNKT 60

Query: 73  TRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
            +  +  + S     +          +S
Sbjct: 61  NKGSEWENLSAPAKTEQTQPAAPAQPTS 88


>gi|121998545|ref|YP_001003332.1| preprotein translocase subunit SecG [Halorhodospira halophila SL1]
 gi|121589950|gb|ABM62530.1| protein translocase subunit secG [Halorhodospira halophila SL1]
          Length = 138

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 47/127 (37%), Gaps = 8/127 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
           M   L+ VH+++ V LV ++L+     +  G+      SS     R  A  + +  A L 
Sbjct: 1   MFEALLAVHIVIAVALVVLVLLNQGKGADMGAAFGSGASSTVFGSRGAATFMTKLIATLG 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ L +I+          +     + + +  ++   D  +P    + A   +  
Sbjct: 61  TTFFLTSLGLAVIAAQGVGGGASVI--GDDEGVLESDDEEETDPEAPAAPDMPADEDAPA 118

Query: 115 VAGKRSS 121
                  
Sbjct: 119 PEAPGEP 125


>gi|260575463|ref|ZP_05843462.1| preprotein translocase, SecG subunit [Rhodobacter sp. SW2]
 gi|259022383|gb|EEW25680.1| preprotein translocase, SecG subunit [Rhodobacter sp. SW2]
          Length = 168

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 45/115 (39%), Gaps = 2/115 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA--HSLGRFTAILAFFFF 58
           M+  ++ VHLI+ + L+ V+L+Q S+    G      ++   A   +L R T I A  F 
Sbjct: 1   MENVVLTVHLILALLLIGVVLLQRSEGGGLGMGGGGGAMSGRAAATALTRLTWIFAVAFI 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
            TS+AL +I+   S                   +   G GS        A  +  
Sbjct: 61  GTSVALTIIAAKNSAGSSVIDQIGGTAPAPKAPDAPLGGGSLLPPAPTDAPLTPP 115


>gi|251794218|ref|YP_003008949.1| preprotein translocase, SecG subunit [Paenibacillus sp. JDR-2]
 gi|247541844|gb|ACS98862.1| preprotein translocase, SecG subunit [Paenibacillus sp. JDR-2]
          Length = 84

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M+IF  ++ +I  VGL+ V+L+Q   S+    +    +         R     L R T  
Sbjct: 7  MEIFWKILLVIFAVGLIAVVLLQKGKSAGLSGAITGGAEHLFGKQKARGLDLFLQRLTVG 66

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  ++ +  +
Sbjct: 67 LASGFFILALVVAYV 81


>gi|121604329|ref|YP_981658.1| preprotein translocase subunit SecG [Polaromonas naphthalenivorans
           CJ2]
 gi|120593298|gb|ABM36737.1| protein translocase subunit secG [Polaromonas naphthalenivorans
           CJ2]
          Length = 136

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 47/123 (38%), Gaps = 8/123 (6%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAFF 56
             ++ V ++  +G++ +IL+Q    +  G++       S       A+ L R T ILA  
Sbjct: 6   TAVLAVQMLSALGMIGLILVQHGKGADMGAAFGSGGSGSLFGASGSANFLSRTTGILAAL 65

Query: 57  FFATSIALGMISRYTSTRYKDNMHR--SLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
           FFA ++ L              +     +  +I   G       ++P   +V A    ++
Sbjct: 66  FFACTLMLAYFGNAQPRTSSSVLEGAAVIAPAIPASGAAQIPGNTAPATTAVEAPVPPAI 125

Query: 115 VAG 117
            A 
Sbjct: 126 PAS 128


>gi|167901990|ref|ZP_02489195.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          NCTC 13177]
          Length = 112

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 11 IVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAFFFFATSIAL 64
          +  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA  FF  ++AL
Sbjct: 1  MSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLATIFFVATLAL 60

Query: 65 GMISRYTSTRYKDNM 79
            +  Y S      +
Sbjct: 61 TYLGSYKSAPSVGVL 75


>gi|167718842|ref|ZP_02402078.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          DM98]
 gi|167845003|ref|ZP_02470511.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          B7210]
          Length = 112

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 11 IVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAFFFFATSIAL 64
          +  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA  FF  ++AL
Sbjct: 1  MSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLATIFFVATLAL 60

Query: 65 GMISRYTSTRYKDNM 79
            +  Y S      +
Sbjct: 61 TYLGSYKSAPSVGVL 75


>gi|126725628|ref|ZP_01741470.1| preprotein translocase, SecG subunit [Rhodobacterales bacterium
           HTCC2150]
 gi|126704832|gb|EBA03923.1| preprotein translocase, SecG subunit [Rhodobacterales bacterium
           HTCC2150]
          Length = 120

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 43/103 (41%), Gaps = 5/103 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT-----SVRSTAHSLGRFTAILAF 55
           M+  ++++HL++ + L+ ++L+Q S+    G           + RS   ++G+ T ILA 
Sbjct: 1   MENVVLIIHLLLALSLIGIVLLQRSEGGGLGLGGGGGGGAAKTGRSAGTAMGKLTWILAA 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
            F  TSI+L +I+   +                     +    
Sbjct: 61  AFIVTSISLTVIAAQKAANESVISGAPASAEGSVPAGSDLLPT 103


>gi|83746296|ref|ZP_00943349.1| Protein translocase subunit secG [Ralstonia solanacearum UW551]
 gi|207723872|ref|YP_002254270.1| protein-export membrane protein secg (translocase) [Ralstonia
          solanacearum MolK2]
 gi|207742734|ref|YP_002259126.1| protein-export membrane protein secg (translocase) [Ralstonia
          solanacearum IPO1609]
 gi|300703641|ref|YP_003745243.1| preprotein translocase membrane subunit [Ralstonia solanacearum
          CFBP2957]
 gi|83727046|gb|EAP74171.1| Protein translocase subunit secG [Ralstonia solanacearum UW551]
 gi|206589077|emb|CAQ36039.1| protein-export membrane protein secg (translocase) [Ralstonia
          solanacearum MolK2]
 gi|206594128|emb|CAQ61055.1| protein-export membrane protein secg (translocase) [Ralstonia
          solanacearum IPO1609]
 gi|299071304|emb|CBJ42622.1| preprotein translocase membrane subunit [Ralstonia solanacearum
          CFBP2957]
          Length = 116

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  L+V  ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLLLVAQILSALGVIGLVLLQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++AL +I     +     M
Sbjct: 64 TVFFVATLALTLIGTSKGSVSAGVM 88


>gi|224475923|ref|YP_002633529.1| preprotein translocase subunit SecG [Staphylococcus carnosus
          subsp. carnosus TM300]
 gi|222420530|emb|CAL27344.1| putative preprotein translocase subunit SecG [Staphylococcus
          carnosus subsp. carnosus TM300]
          Length = 78

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 29/76 (38%), Gaps = 9/76 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSV----RSTAHSLGRFTA 51
          M   L V+ +I  + L+ V+L+Q S       +  G +          R     L R T 
Sbjct: 1  MHTLLTVLLVIDCIALITVVLLQESKSNGLSGAISGGAEQLFGGKQKQRGVDLFLNRVTI 60

Query: 52 ILAFFFFATSIALGMI 67
           L+  FF   +A+   
Sbjct: 61 GLSIAFFVLMLAITYF 76


>gi|227510629|ref|ZP_03940678.1| preprotein translocase subunit SecG [Lactobacillus brevis subsp.
          gravesensis ATCC 27305]
 gi|227513643|ref|ZP_03943692.1| preprotein translocase subunit SecG [Lactobacillus buchneri ATCC
          11577]
 gi|227524789|ref|ZP_03954838.1| preprotein translocase subunit SecG [Lactobacillus hilgardii ATCC
          8290]
 gi|227083159|gb|EEI18471.1| preprotein translocase subunit SecG [Lactobacillus buchneri ATCC
          11577]
 gi|227088045|gb|EEI23357.1| preprotein translocase subunit SecG [Lactobacillus hilgardii ATCC
          8290]
 gi|227190281|gb|EEI70348.1| preprotein translocase subunit SecG [Lactobacillus brevis subsp.
          gravesensis ATCC 27305]
          Length = 78

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 33/78 (42%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M   L+ + LI  V +   +L+Q S      S+  G + +  +    R     + + T +
Sbjct: 1  MYNLLITLLLIDCVLITIAVLMQPSKTNDAMSALTGGADDLFAKQKPRGFEAFMQKTTVV 60

Query: 53 LAFFFFATSIALGMISRY 70
          L   FF  S+ L  +S +
Sbjct: 61 LGIIFFVLSLGLVWLSSH 78


>gi|302338944|ref|YP_003804150.1| preprotein translocase, SecG subunit [Spirochaeta smaragdinae DSM
          11293]
 gi|301636129|gb|ADK81556.1| preprotein translocase, SecG subunit [Spirochaeta smaragdinae DSM
          11293]
          Length = 117

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/91 (18%), Positives = 36/91 (39%), Gaps = 5/91 (5%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSS---SNFTSVRSTAHSLGRFTAILAFFFFAT 60
           L+VV +I  + L+ +++IQ       G     S+      + + L + T+IL   F   
Sbjct: 7  LLLVVFVISALLLIVIVMIQDDQGEGLGGIFGGSSSAFGSRSGNVLTKTTSILGTVFILC 66

Query: 61 SIALGMISRYTSTRYKDNMHRSLVDSIKDQG 91
          S  L  +    +    + +  +  ++   Q 
Sbjct: 67 SFGLAWV--NHTPEGGNVIKAARQEAGVQQE 95


>gi|312113151|ref|YP_004010747.1| preprotein translocase, SecG subunit [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218280|gb|ADP69648.1| preprotein translocase, SecG subunit [Rhodomicrobium vannielii ATCC
           17100]
          Length = 119

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 49/119 (41%), Gaps = 5/119 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS-----TAHSLGRFTAILAF 55
           M   L+V+H++V V +V +IL+Q S+  A G                A+ + R TAILA 
Sbjct: 1   MANVLLVLHIVVAVTMVVIILLQRSEGGALGMGGGGGGGGFVSGRGAANVMTRTTAILAA 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
            FF TSI LG++ +  +         S                + PKL+     + +  
Sbjct: 61  IFFLTSITLGILGQRKTPTSAIGTPTSTSAPTTAPSQAPADAPALPKLNIPKPAAPAQQ 119


>gi|293603850|ref|ZP_06686265.1| preprotein translocase subunit SecG [Achromobacter piechaudii ATCC
           43553]
 gi|292817687|gb|EFF76753.1| preprotein translocase subunit SecG [Achromobacter piechaudii ATCC
           43553]
          Length = 149

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 45/133 (33%), Gaps = 9/133 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV------RSTAHSLGRFTAILA 54
           M   L+ V ++  + ++ ++L+Q    +  GS+    S          A+ L R T   A
Sbjct: 4   MLKLLLAVQVLSALAIIVLVLLQQGKGADMGSAFGSGSSGSLFGATGAANFLSRATKWAA 63

Query: 55  FFFFATSIALGMISRYTSTRY---KDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
             FFA++  L  +S   ++        M     D    Q                +  + 
Sbjct: 64  VVFFASTAGLAYVSHKGTSGPAVDSGVMQSFPSDRSVPQVPGAAPAAPGAASVPAAPAAP 123

Query: 112 SSVVAGKRSSSRT 124
           +   A   S+  T
Sbjct: 124 AKPDASVPSAPAT 136


>gi|170719904|ref|YP_001747592.1| preprotein translocase subunit SecG [Pseudomonas putida W619]
 gi|169757907|gb|ACA71223.1| preprotein translocase, SecG subunit [Pseudomonas putida W619]
          Length = 130

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 54/131 (41%), Gaps = 10/131 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           ++  ++V HL+  + LV ++L+Q    +  G+S            + +A  L +FTAILA
Sbjct: 2   LETVIVVFHLLAALSLVVLVLLQQGKGAEAGASFGAGASNTVFGSQGSATFLSKFTAILA 61

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF T++ LG  ++  + +      ++ +               +  +  +  + S + 
Sbjct: 62  ATFFLTALGLGYFAKQQAHQLG----QAGLPDPAVLEVKQPKPAVNDDVPVLQEQKSETT 117

Query: 115 VAGKRSSSRTK 125
            AG       +
Sbjct: 118 PAGDVPPPAEE 128


>gi|254419902|ref|ZP_05033626.1| preprotein translocase SecG subunit, putative [Brevundimonas sp.
          BAL3]
 gi|196186079|gb|EDX81055.1| preprotein translocase SecG subunit, putative [Brevundimonas sp.
          BAL3]
          Length = 148

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 3/81 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS---SSNFTSVRSTAHSLGRFTAILAFFF 57
          +Q  L+V  ++V V L  V+L+Q S+  A G     S F + R   + L + T +LA   
Sbjct: 6  LQTILLVAIILVAVSLTGVVLLQRSEGGALGMGGGPSGFMTARGAGNLLTKITWVLAALL 65

Query: 58 FATSIALGMISRYTSTRYKDN 78
          F  +I L ++           
Sbjct: 66 FGLTIILTVVGNMDRASVSVI 86


>gi|77359823|ref|YP_339398.1| preprotein translocase subunit SecG [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874734|emb|CAI85955.1| protein-export membrane protein secG(General Secretory Pathway)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 117

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 47/120 (39%), Gaps = 15/120 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
           M   L+VV+L+V + LV ++LIQ    +  GSS      S         + + + T +LA
Sbjct: 1   MYEILLVVYLVVALALVGMVLIQQGKGADMGSSFGAGASSTVFGSSGAGNFMTKTTTVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  SI LG ++     +          D  ++       +   P  + V   SS   
Sbjct: 61  SVFFILSIVLGNLTASHIKKT---------DEWENLEAAPALETVIPVEEDVPVTSSKEQ 111


>gi|222148650|ref|YP_002549607.1| protein-export membrane protein SECG [Agrobacterium vitis S4]
 gi|221735636|gb|ACM36599.1| protein-export membrane protein SECG [Agrobacterium vitis S4]
          Length = 128

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 42/124 (33%), Positives = 63/124 (50%), Gaps = 3/124 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HLI+V+ LV V+LIQ S+    G      F S R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLIIVISLVGVVLIQRSEGGGLGIGGGSGFMSARGAANALTRTTAILATLFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
            TS+ LG++SR+ +    D ++R         GN       +P      A  +++  A  
Sbjct: 61  ITSLGLGILSRFEAK-PTDILNRIPAGQQAPSGNILDQLPGAPATAPAPANGAATTPAPA 119

Query: 119 RSSS 122
           +  +
Sbjct: 120 QPGA 123


>gi|301062361|ref|ZP_07203024.1| preprotein translocase, SecG subunit [delta proteobacterium
          NaphS2]
 gi|300443565|gb|EFK07667.1| preprotein translocase, SecG subunit [delta proteobacterium
          NaphS2]
          Length = 109

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 33/95 (34%), Gaps = 7/95 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+++H+ V V L+ ++L+Q    +  G     SS            L + T  +A 
Sbjct: 1  MFAVLIILHVCVCVALILIVLLQKGKGAGMGAAFGGSSQTVFGSTGATSLLHKVTTGVAI 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQ 90
           F  TS+ L       S      M          Q
Sbjct: 61 VFMLTSLGLSFFIGKGSKA--SIMQDVNPVEQTSQ 93


>gi|281426139|ref|ZP_06257052.1| preprotein translocase, SecG subunit [Prevotella oris F0302]
 gi|299141907|ref|ZP_07035042.1| preprotein translocase, SecG subunit [Prevotella oris C735]
 gi|281399715|gb|EFB30546.1| preprotein translocase, SecG subunit [Prevotella oris F0302]
 gi|298576758|gb|EFI48629.1| preprotein translocase, SecG subunit [Prevotella oris C735]
          Length = 116

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/114 (21%), Positives = 48/114 (42%), Gaps = 5/114 (4%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
               +V+ ++  + +V V+LIQ S        F SS+    VR T + + + T  LA   
Sbjct: 3   YTLFVVLIVLAAILMVLVVLIQESKGGGLASNFSSSNAIMGVRKTTNVVEKATWALAVSM 62

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
              S+A   ++   +T  +  M +S  ++      +  G G+S ++       +
Sbjct: 63  VILSVACAYVAPQAATE-QSVMEKSATETQTTNPTNTQGFGASQQVPQAPQTPA 115


>gi|196231428|ref|ZP_03130286.1| preprotein translocase, SecG subunit [Chthoniobacter flavus
           Ellin428]
 gi|196224281|gb|EDY18793.1| preprotein translocase, SecG subunit [Chthoniobacter flavus
           Ellin428]
          Length = 240

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/123 (13%), Positives = 37/123 (30%), Gaps = 5/123 (4%)

Query: 3   IFLMVVHLIVVVGLVCVILIQSSDS-----SAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
             L+V+H+IV + ++ + L+Q   +     +  G  +       T + L   T  L   F
Sbjct: 7   NVLLVIHVIVSLLIILLTLMQRPKNEGLGAAFGGGMTENLFGAQTTNVLATATRYLGGIF 66

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           F  ++ L  +    + +      R +                +           + V   
Sbjct: 67  FVLTVLLSWLYVKETNQRSTLQKRLMSVPKLAAPATPAPAAGTATPAPTDKNLPAPVTTP 126

Query: 118 KRS 120
              
Sbjct: 127 ASE 129


>gi|163784442|ref|ZP_02179321.1| hypothetical protein HG1285_09621 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880291|gb|EDP73916.1| hypothetical protein HG1285_09621 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 102

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/97 (18%), Positives = 38/97 (39%), Gaps = 5/97 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS-----SSNFTSVRSTAHSLGRFTAILAF 55
           +   L ++ +I  + LV +IL+Q +  S  G+     ++           L + T  L  
Sbjct: 4   LYTILSILLVIDGILLVILILMQKTKGSEIGAVFGSGAAAAVLGAGATTFLTKLTYWLGG 63

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
            F A  ++L +I+ Y + +  +      V     +  
Sbjct: 64  IFLALVLSLSLINHYETKKSIELPENVPVSKPAGEKG 100


>gi|118589927|ref|ZP_01547331.1| preprotein translocase SecG subunit [Stappia aggregata IAM 12614]
 gi|118437424|gb|EAV44061.1| preprotein translocase SecG subunit [Stappia aggregata IAM 12614]
          Length = 127

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 3/127 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF---TSVRSTAHSLGRFTAILAFFF 57
           M+  ++V+HL+VV+ LV V+L+Q S+  A G         S R TA+ L R TA+LA  F
Sbjct: 1   METVVIVIHLMVVLALVLVVLLQRSEGGALGIGGGGGGLMSSRGTANILTRATAVLAVAF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
           FATS+ L +I++                       D   +G S  +     + +    +G
Sbjct: 61  FATSLTLSLIAKNQDRPGSILDAVPTATQEVPATTDGTTEGGSGGVLDSLKQLNQQQPSG 120

Query: 118 KRSSSRT 124
            +  +  
Sbjct: 121 PQVPAAQ 127


>gi|57505744|ref|ZP_00371670.1| protein translocation protein, low temperature (secG)
           [Campylobacter upsaliensis RM3195]
 gi|315637820|ref|ZP_07893010.1| preprotein translocase subunit SecG [Campylobacter upsaliensis
           JV21]
 gi|57016017|gb|EAL52805.1| protein translocation protein, low temperature (secG)
           [Campylobacter upsaliensis RM3195]
 gi|315482061|gb|EFU72675.1| preprotein translocase subunit SecG [Campylobacter upsaliensis
           JV21]
          Length = 116

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/112 (24%), Positives = 48/112 (42%), Gaps = 6/112 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L+V+  ++VV +   +L+Q S      +  GS+ +    +  A  L +FT I+   
Sbjct: 1   MITLLIVLQFVIVVVICIAVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFIMGLL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             A +IALG +  Y S+       +  +DS     N      S+P    + +
Sbjct: 61  LIANTIALGYL--YNSSNKNSLAEKVQIDSNATLPNLPANIPSAPSAPQLPS 110


>gi|256823566|ref|YP_003147529.1| preprotein translocase subunit SecG [Kangiella koreensis DSM 16069]
 gi|256797105|gb|ACV27761.1| preprotein translocase, SecG subunit [Kangiella koreensis DSM
           16069]
          Length = 152

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 49/131 (37%), Gaps = 6/131 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M++FLM+  L+V + LV +ILIQ    +  G+S                + L + T ILA
Sbjct: 1   MELFLMISLLVVALLLVGIILIQQGKGAEIGASFGAGASNTLFGAPGAGNFLTKSTTILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FFA ++ +  I +   T                  +         ++ S     +   
Sbjct: 61  IIFFALALTIHAIGQEEVTESGLLDDPESQVEEIGVQSSEIPTEVQDEIPSEIPTDTQEE 120

Query: 115 VAGKRSSSRTK 125
           ++ +  ++  +
Sbjct: 121 ISTEIPTADEQ 131


>gi|51243951|ref|YP_063835.1| secretion protein SecG [Desulfotalea psychrophila LSv54]
 gi|50874988|emb|CAG34828.1| related to secretion protein SecG [Desulfotalea psychrophila LSv54]
          Length = 111

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/110 (20%), Positives = 41/110 (37%), Gaps = 8/110 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-------SSSNFTSVRSTAHSLGRFTAIL 53
           M   L + H++V + L+ V+L+Q    +  G       SS +          L + T  +
Sbjct: 1   MDTLLTIAHVVVCLFLIGVVLLQHGKGADAGAAFGGGGSSQSLFGSEGPVPLLNKLTTAI 60

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKL 103
           A  F  TS+AL  IS   S       +     ++++           P +
Sbjct: 61  AIIFMLTSMALAFISSQ-SGSGSVMENVITTPAVQESKVATPAVSDVPAV 109


>gi|13470810|ref|NP_102379.1| preprotein translocase subunit SecG [Mesorhizobium loti MAFF303099]
 gi|14021553|dbj|BAB48165.1| protein-export membrane protein [Mesorhizobium loti MAFF303099]
          Length = 154

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 37/113 (32%), Positives = 54/113 (47%), Gaps = 3/113 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL+VV+ LV V+L+Q S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMVVLALVGVVLLQRSEGGGLGIGGGSGFMTARGAANALTRATAILAAAFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
            TS+ L +I+RY   +  D + R                  +P   +     S
Sbjct: 61  VTSLTLSIIARY-GEKPIDILDRVPATGKGVLNQLPGTTTPAPAGSTAPTPPS 112


>gi|330429054|gb|AEC20388.1| protein-export membrane protein [Pusillimonas sp. T7-7]
          Length = 160

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/108 (19%), Positives = 44/108 (40%), Gaps = 7/108 (6%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV------RSTAHSLGRFTAILAFFF 57
            LM + +I  + ++ ++L+Q    +  G+S    S          A+ L R T   A  F
Sbjct: 7   VLMAIQVISSLSVIVLVLLQQGKGADMGASFGGGSSGSLFGATGAANFLSRATKWAAIIF 66

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
           FA++ AL  ++ + +      +   ++   + Q   +    + P   S
Sbjct: 67  FASTGALAWVAHHPTGAP-SLIEGGVMQGFQSQEVPSTTGSAVPAAPS 113


>gi|282858125|ref|ZP_06267320.1| preprotein translocase, SecG subunit [Pyramidobacter piscolens
          W5455]
 gi|282584047|gb|EFB89420.1| preprotein translocase, SecG subunit [Pyramidobacter piscolens
          W5455]
          Length = 73

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 33/73 (45%), Gaps = 6/73 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAH------SLGRFTAILA 54
          M+ FL +V +++ V L+ V+++Q       G     T    TA+       L + T ++ 
Sbjct: 1  MKTFLAIVQILLCVVLMIVVMLQPRKQGRGGIFGGATLADPTANQWSRFSGLSKITVVVC 60

Query: 55 FFFFATSIALGMI 67
            F   S+ L ++
Sbjct: 61 ALFMLNSLVLIVL 73


>gi|326387874|ref|ZP_08209480.1| protein translocase subunit secG [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326207920|gb|EGD58731.1| protein translocase subunit secG [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 149

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 50/128 (39%), Gaps = 5/128 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFF 57
           + +FL VV  IV + LV VIL+Q S+    G   +   F S R  A  L R T ILA  F
Sbjct: 14  LFVFLSVVQAIVALLLVMVILMQKSEGGGLGVGGSPSGFMSARGAADFLTRATTILAAIF 73

Query: 58  FATSIALGMIS--RYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
              SI L  ++    ++ +   +++RSL            G           A  +    
Sbjct: 74  VGLSIVLAALAVGTNSTHQIDTSLNRSLPTQSAPDPLAGAGQAGGATGQVAPATQAQPSS 133

Query: 116 AGKRSSSR 123
             K   S 
Sbjct: 134 GAKPLPSD 141


>gi|238755153|ref|ZP_04616499.1| Protein-export membrane protein secG [Yersinia ruckeri ATCC 29473]
 gi|238706600|gb|EEP98971.1| Protein-export membrane protein secG [Yersinia ruckeri ATCC 29473]
          Length = 95

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/95 (16%), Positives = 33/95 (34%), Gaps = 6/95 (6%)

Query: 17  VCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY 70
           + +I++Q    +  G+S      +       + + + R TA+LA  FF  S+ LG +S  
Sbjct: 1   MALIMLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLATLFFVISLILGNMSTN 60

Query: 71  TSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
              +  +  +                   S  +  
Sbjct: 61  QGRQGSEWENLGQPAKAVQTTAPVAPAKPSSDIPQ 95


>gi|118580117|ref|YP_901367.1| preprotein translocase subunit SecG [Pelobacter propionicus DSM
           2379]
 gi|118502827|gb|ABK99309.1| protein translocase subunit secG [Pelobacter propionicus DSM 2379]
          Length = 117

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 36/101 (35%), Gaps = 6/101 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
           M IFL ++H+ V + L+ V+L+QS   +  G       S +          L + T   A
Sbjct: 1   MLIFLTILHVAVSLFLIAVVLLQSGKGAEMGASFGSSGSQSVFGAGGGTTFLSKLTTSAA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF 95
             F  TS+ L  +S   S+             +        
Sbjct: 61  VVFMLTSLTLAYLSGSPSSSSIMAGKVKAATKVPAPVTQPS 101


>gi|330431160|gb|AEC16219.1| conserved hypothetical protein [Gallibacterium anatis UMN179]
          Length = 118

 Score = 55.4 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 30/87 (34%), Gaps = 6/87 (6%)

Query: 22  IQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRY 75
           +Q    +  G+S                + L R T ILA  FFA S+ LG ++ ++S   
Sbjct: 22  VQQGKGADMGASFGAGASGTVFGASGAGNFLTRTTTILAIVFFAISLLLGNLTAHSSKPK 81

Query: 76  KDNMHRSLVDSIKDQGNDNFGDGSSPK 102
            +    S V     +          P 
Sbjct: 82  GNFDDLSGVAQQVKKEEAAKPVTELPA 108


>gi|237756334|ref|ZP_04584885.1| preprotein translocase, SecG subunit [Sulfurihydrogenibium
          yellowstonense SS-5]
 gi|237691504|gb|EEP60561.1| preprotein translocase, SecG subunit [Sulfurihydrogenibium
          yellowstonense SS-5]
          Length = 97

 Score = 55.4 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 36/93 (38%), Gaps = 6/93 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS-----AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +   L VV +IV V L+ ++L+Q +  +         ++      S A  L + T  L  
Sbjct: 4  LFGVLSVVLIIVSVLLIILVLMQKTKGAEIGAVFGSGAAKAVLGASAATILTKITYWLGA 63

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
           F    + L  +S +   + K  +     +  +
Sbjct: 64 IFLTLVLILSYLSVH-IAKSKSVIESIPAEQTQ 95


>gi|256751252|ref|ZP_05492132.1| preprotein translocase, SecG subunit [Thermoanaerobacter
          ethanolicus CCSD1]
 gi|256749807|gb|EEU62831.1| preprotein translocase, SecG subunit [Thermoanaerobacter
          ethanolicus CCSD1]
          Length = 79

 Score = 55.4 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS--------SSNFTSVRSTAHSLGRFTAI 52
          ++  LMV+H++V + L+ VIL+Q   ++                   R+   +L + T I
Sbjct: 2  LKTVLMVIHVLVSLFLIAVILLQKGKNAGISGVIEGGAETFFGKNKARTMEGTLEKLTTI 61

Query: 53 LAFFFFATSIALGMI 67
           A  F   S+ L ++
Sbjct: 62 AAALFIILSMVLTVM 76


>gi|160900613|ref|YP_001566195.1| preprotein translocase subunit SecG [Delftia acidovorans SPH-1]
 gi|160366197|gb|ABX37810.1| preprotein translocase, SecG subunit [Delftia acidovorans SPH-1]
          Length = 130

 Score = 55.4 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 37/85 (43%), Gaps = 6/85 (7%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAFF 56
            ++ V ++  +G++ +ILIQ    +  G+S    S  S       A+ L R TA LA  
Sbjct: 6  SVILAVQMLSALGMIGLILIQHGKGADMGASFGSGSSGSLFGASGSANFLSRSTAGLATV 65

Query: 57 FFATSIALGMISRYTSTRYKDNMHR 81
          FF  ++AL  +S          +  
Sbjct: 66 FFVATLALAYLSNARPVSSGSVLEG 90


>gi|308271818|emb|CBX28426.1| Protein-export membrane protein secG [uncultured Desulfobacterium
           sp.]
          Length = 101

 Score = 55.4 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/98 (15%), Positives = 33/98 (33%), Gaps = 5/98 (5%)

Query: 21  LIQSSDSS-----AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRY 75
           L+Q+   +       GSS         +  L + T ++A  F  TS++L  +S   +   
Sbjct: 2   LLQTGKGADMGAAFGGSSQTLFGSTGASTFLSKATTVVAIIFMITSLSLAYMSGNRNKSS 61

Query: 76  KDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
                +  V+      ++     S  +    +   +  
Sbjct: 62  IMEKVKIPVEQKAAPDSNAIAIPSGEQTAPAALPDTGE 99


>gi|57168361|ref|ZP_00367495.1| protein translocation protein, low temperature (secG)
           [Campylobacter coli RM2228]
 gi|305432777|ref|ZP_07401936.1| preprotein translocase subunit SecG [Campylobacter coli JV20]
 gi|57020169|gb|EAL56843.1| protein translocation protein, low temperature (secG)
           [Campylobacter coli RM2228]
 gi|304444174|gb|EFM36828.1| preprotein translocase subunit SecG [Campylobacter coli JV20]
          Length = 118

 Score = 55.4 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/116 (18%), Positives = 46/116 (39%), Gaps = 4/116 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L ++  ++VV +   +L+Q S      +  GS+ +    +  A  L +FT I+   
Sbjct: 1   MITLLTILQFVIVVIICIAVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFIMGIL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             A +I LG +   TS        +   ++      +     + P    +  +S++
Sbjct: 61  LIANTIGLGYLYNSTSKDSLAEKIKIETNTSIPTAPNAINVPAIPSAPQIPNESNT 116


>gi|308175109|ref|YP_003921814.1| protein-export membrane protein secG [Bacillus amyloliquefaciens
          DSM 7]
 gi|307607973|emb|CBI44344.1| probable protein-export membrane protein secG [Bacillus
          amyloliquefaciens DSM 7]
 gi|328555078|gb|AEB25570.1| hypothetical protein BAMTA208_17090 [Bacillus amyloliquefaciens
          TA208]
 gi|328913433|gb|AEB65029.1| putative protein-export membrane protein secG [Bacillus
          amyloliquefaciens LL3]
          Length = 76

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L+ + +IV + L+ V+L+QSS S+    + +  +         R     L R T +
Sbjct: 1  MHTLLITLLVIVSIALIIVVLLQSSKSAGLSGAISGGAEQLFGKQKARGLDLILHRTTVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +I+L  I
Sbjct: 61 LAVLFFVLTISLAYI 75


>gi|188997069|ref|YP_001931320.1| preprotein translocase, SecG subunit [Sulfurihydrogenibium sp.
          YO3AOP1]
 gi|188932136|gb|ACD66766.1| preprotein translocase, SecG subunit [Sulfurihydrogenibium sp.
          YO3AOP1]
          Length = 97

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 36/93 (38%), Gaps = 6/93 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS-----AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          +   L VV +IV V L+ ++L+Q +  +         ++      S A  L + T  L  
Sbjct: 4  LFGVLSVVLIIVSVLLIILVLMQKTKGAEIGAVFGSGAAKAVLGASAATILTKITYWLGA 63

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
           F    + L  +S +   + K  +     +  +
Sbjct: 64 IFLTLVLILSYLSIH-IAKSKSVIESIPAEQTQ 95


>gi|121593376|ref|YP_985272.1| protein translocase subunit secG [Acidovorax sp. JS42]
 gi|120605456|gb|ABM41196.1| protein translocase subunit secG [Acidovorax sp. JS42]
          Length = 126

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 37/92 (40%), Gaps = 6/92 (6%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAFF 56
            ++ V ++  +G++ +ILIQ    +  G++    S  S       A+ L R TA+LA  
Sbjct: 6  NVILAVQMLTALGMIGLILIQHGKGADMGAAFGSGSSGSLFGASGSANFLSRTTAVLATV 65

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
          FF  ++AL              +    V    
Sbjct: 66 FFVATLALAYFGNQRPVSTGSVLETPAVAVPA 97


>gi|224369884|ref|YP_002604048.1| SecG [Desulfobacterium autotrophicum HRM2]
 gi|223692601|gb|ACN15884.1| SecG [Desulfobacterium autotrophicum HRM2]
          Length = 99

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/99 (17%), Positives = 38/99 (38%), Gaps = 6/99 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
          M   +++ H+I  + L+ ++L+Q+   +  G+S               A  L + T  +A
Sbjct: 1  MTTLIIIAHVIACILLILIVLLQTGKGADMGASFGGASSQALFGGAGPATFLSKITTGVA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
            F  TS+ L  +S +          +  ++      + 
Sbjct: 61 VIFMLTSLTLAYMSSHKPETSIMPDIKIPIEQPATTDSK 99


>gi|154687493|ref|YP_001422654.1| preprotein translocase subunit SecG [Bacillus amyloliquefaciens
          FZB42]
 gi|154353344|gb|ABS75423.1| hypothetical protein RBAM_030920 [Bacillus amyloliquefaciens
          FZB42]
          Length = 76

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L+ + +IV + L+ V+L+Q+S S+    + +  +         R     L R T +
Sbjct: 1  MHTLLITLLVIVSIALIIVVLLQTSKSAGLSGAISGGAEQLFGKQKARGLDLILHRTTVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +I+L  I
Sbjct: 61 LAVLFFVLTISLAYI 75


>gi|167461761|ref|ZP_02326850.1| hypothetical protein Plarl_04265 [Paenibacillus larvae subsp.
          larvae BRL-230010]
          Length = 78

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M+I L +V +I  +GL+  +L+Q   S+    + +  +         R     L R T +
Sbjct: 1  MEIALKIVLIIASIGLIVAVLLQKGKSAGLSGAISGGAEHLFGKQKARGMDLFLSRVTMV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  SI +  I
Sbjct: 61 LAAIFFILSIVVAFI 75


>gi|78186597|ref|YP_374640.1| preprotein translocase subunit SecG [Chlorobium luteolum DSM 273]
 gi|78166499|gb|ABB23597.1| protein translocase subunit secG [Chlorobium luteolum DSM 273]
          Length = 114

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/115 (20%), Positives = 44/115 (38%), Gaps = 9/115 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-------NFTSVRSTAHSLGRFTAIL 53
           M +F++++ L+  + L+ VI++Q+  S +  +             VR T   LGR TA+L
Sbjct: 1   MHVFIVIMALLASLMLIGVIMLQNPKSGSGLTGGIASLGTVQTLGVRRTGDFLGRVTAVL 60

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
           A                 S   +    +S++             G+ P L  + A
Sbjct: 61  AGVVMVFCFIAEFTLPQRSGTAEG--RKSILQEEAPALPQQQPAGTVPVLPQMPA 113


>gi|28377648|ref|NP_784540.1| preprotein translocase subunit SecG [Lactobacillus plantarum
          WCFS1]
 gi|254555827|ref|YP_003062244.1| preprotein translocase subunit SecG [Lactobacillus plantarum
          JDM1]
 gi|300767617|ref|ZP_07077527.1| preprotein translocase subunit SecG [Lactobacillus plantarum
          subsp. plantarum ATCC 14917]
 gi|28270481|emb|CAD63383.1| preprotein translocase, SecG subunit [Lactobacillus plantarum
          WCFS1]
 gi|254044754|gb|ACT61547.1| preprotein translocase subunit SecG [Lactobacillus plantarum
          JDM1]
 gi|300494602|gb|EFK29760.1| preprotein translocase subunit SecG [Lactobacillus plantarum
          subsp. plantarum ATCC 14917]
          Length = 78

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 33/78 (42%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L+ + L+V V ++  +++Q S ++   SS    +         R     + + T +
Sbjct: 1  MYNLLLTLILVVSVLIIIAVMMQPSKTNDAMSSLTGGADDLFAKQKPRGFEAFMQKVTVV 60

Query: 53 LAFFFFATSIALGMISRY 70
          L   FF  ++AL   S  
Sbjct: 61 LGIAFFILALALAWYSSK 78


>gi|254457333|ref|ZP_05070761.1| preprotein translocase SecG subunit [Campylobacterales bacterium GD
           1]
 gi|207086125|gb|EDZ63409.1| preprotein translocase SecG subunit [Campylobacterales bacterium GD
           1]
          Length = 112

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/108 (20%), Positives = 45/108 (41%), Gaps = 4/108 (3%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
             FL++V +I+VV LV  +L+Q S      +  GS+ +    +     L + T ++ F F
Sbjct: 3   TSFLLIVQIILVVILVIAVLLQKSSSIGLGAYSGSNESVFGAKGPNSFLAKTTFLIGFLF 62

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
            + +IALG +   T+     +      + +           +  +  +
Sbjct: 63  VSNTIALGYLYSSTAQTSVVDNMVETTNVVAPVATTPVVAPAKDETPA 110


>gi|148555264|ref|YP_001262846.1| protein translocase subunit secG [Sphingomonas wittichii RW1]
 gi|148500454|gb|ABQ68708.1| protein translocase subunit secG [Sphingomonas wittichii RW1]
          Length = 124

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS---AFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
          +  FL+VVH+IV   LV +IL+Q S+     + GS     S R  A  L R TAILA  F
Sbjct: 2  LFTFLLVVHIIVATALVAIILVQRSEGGGLTSGGSPGGLMSARGAADFLTRTTAILAGIF 61

Query: 58 F 58
           
Sbjct: 62 V 62


>gi|238783518|ref|ZP_04627540.1| Protein-export membrane protein secG [Yersinia bercovieri ATCC
           43970]
 gi|238715573|gb|EEQ07563.1| Protein-export membrane protein secG [Yersinia bercovieri ATCC
           43970]
          Length = 91

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/90 (16%), Positives = 31/90 (34%), Gaps = 6/90 (6%)

Query: 21  LIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTR 74
           ++Q    +  G+S      +       + + + R TA+LA  FF  S+ LG +S     +
Sbjct: 1   MLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLAALFFVISLILGNMSTNQGHK 60

Query: 75  YKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             +  +       +           S  + 
Sbjct: 61  GSEWENLGQPAKTEQTTAPAAPVTPSSDIP 90


>gi|16080416|ref|NP_391243.1| preprotein translocase subunit SecG [Bacillus subtilis subsp.
          subtilis str. 168]
 gi|221311313|ref|ZP_03593160.1| hypothetical protein Bsubs1_18251 [Bacillus subtilis subsp.
          subtilis str. 168]
 gi|221315640|ref|ZP_03597445.1| hypothetical protein BsubsN3_18167 [Bacillus subtilis subsp.
          subtilis str. NCIB 3610]
 gi|221320556|ref|ZP_03601850.1| hypothetical protein BsubsJ_18135 [Bacillus subtilis subsp.
          subtilis str. JH642]
 gi|221324840|ref|ZP_03606134.1| hypothetical protein BsubsS_18286 [Bacillus subtilis subsp.
          subtilis str. SMY]
 gi|296330423|ref|ZP_06872903.1| hypothetical protein BSU6633_04944 [Bacillus subtilis subsp.
          spizizenii ATCC 6633]
 gi|305675969|ref|YP_003867641.1| preprotein translocase subunit [Bacillus subtilis subsp.
          spizizenii str. W23]
 gi|321312913|ref|YP_004205200.1| hypothetical protein BSn5_07735 [Bacillus subtilis BSn5]
 gi|6226126|sp|O32233|SECG_BACSU RecName: Full=Probable protein-export membrane protein secG
 gi|2635876|emb|CAB15368.1| preprotein translocase subunit [Bacillus subtilis subsp. subtilis
          str. 168]
 gi|291485895|dbj|BAI86970.1| preprotein translocase subunit SecG [Bacillus subtilis subsp.
          natto BEST195]
 gi|296152426|gb|EFG93295.1| hypothetical protein BSU6633_04944 [Bacillus subtilis subsp.
          spizizenii ATCC 6633]
 gi|305414213|gb|ADM39332.1| preprotein translocase subunit [Bacillus subtilis subsp.
          spizizenii str. W23]
 gi|320019187|gb|ADV94173.1| hypothetical protein BSn5_07735 [Bacillus subtilis BSn5]
          Length = 76

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L+ + +IV + L+ V+L+QSS S+    + +  +         R     L R T +
Sbjct: 1  MHAVLITLLVIVSIALIIVVLLQSSKSAGLSGAISGGAEQLFGKQKARGLDLILHRITVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +IAL  I
Sbjct: 61 LAVLFFVLTIALAYI 75


>gi|241663485|ref|YP_002981845.1| preprotein translocase subunit SecG [Ralstonia pickettii 12D]
 gi|309781851|ref|ZP_07676584.1| homoserine dehydrogenase [Ralstonia sp. 5_7_47FAA]
 gi|240865512|gb|ACS63173.1| preprotein translocase, SecG subunit [Ralstonia pickettii 12D]
 gi|308919492|gb|EFP65156.1| homoserine dehydrogenase [Ralstonia sp. 5_7_47FAA]
          Length = 120

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%), Gaps = 6/94 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  L+V  ++  +G++ ++L+Q    +        G+S +      +A+ L R TA+LA
Sbjct: 4  LKTLLLVAQILSALGVIGLVLLQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
            FF  ++AL +I     +     M      +  
Sbjct: 64 TVFFIATLALTLIGTSKGSVSAGVMGSVAPVTST 97


>gi|258648014|ref|ZP_05735483.1| preprotein translocase, SecG subunit [Prevotella tannerae ATCC
           51259]
 gi|260851861|gb|EEX71730.1| preprotein translocase, SecG subunit [Prevotella tannerae ATCC
           51259]
          Length = 109

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/113 (18%), Positives = 37/113 (32%), Gaps = 8/113 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L+++ +I  + L  V+LIQ S        F +S+    VR T   + + T  LA  
Sbjct: 1   MYTVLIILAVIAGILLTLVVLIQESKGGGLASGFSASNAIMGVRKTTDFIEKSTWTLAAL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
               S+A    +           +               G  +     +  A+
Sbjct: 61  LVIFSVASTFFTPKQDQAVNVVTNM----QTAPAPQTLPGQPAGGGTPTAPAQ 109


>gi|222110085|ref|YP_002552349.1| preprotein translocase subunit SecG [Acidovorax ebreus TPSY]
 gi|221729529|gb|ACM32349.1| preprotein translocase, SecG subunit [Acidovorax ebreus TPSY]
          Length = 126

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 36/92 (39%), Gaps = 6/92 (6%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAFF 56
            ++ V ++  +G++ +ILIQ    +  G++    S  S       A+ L R TA+LA  
Sbjct: 6  NVILAVQMLTALGMIGLILIQHGKGADMGAAFGSGSSGSLFGASGSANFLSRTTAVLATV 65

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
          FF  ++AL              +         
Sbjct: 66 FFVATLALAYFGNQRPVSTGSVLETPAAAVPA 97


>gi|193215566|ref|YP_001996765.1| preprotein translocase subunit SecG [Chloroherpeton thalassium ATCC
           35110]
 gi|193089043|gb|ACF14318.1| preprotein translocase, SecG subunit [Chloroherpeton thalassium
           ATCC 35110]
          Length = 120

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 47/119 (39%), Gaps = 8/119 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV------RSTAHSLGRFTAILA 54
           M  F++V+ +IV + LV VIL+Q+S  +   S  +          R TA  L + T++LA
Sbjct: 1   MHTFIVVLAIIVAILLVIVILLQNSKGAGLASGLSAAGSVQTLGVRQTADFLSKATSVLA 60

Query: 55  FFFFATSIA--LGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
             F    I   L M S   + + +  + +++                     S +   +
Sbjct: 61  TAFMVLCIIAELTMPSSSDTVQKESVIQKNVPGVPSSSIPLPGDASGEVNTPSETGTPA 119


>gi|238750123|ref|ZP_04611626.1| Protein-export membrane protein secG [Yersinia rohdei ATCC 43380]
 gi|238711667|gb|EEQ03882.1| Protein-export membrane protein secG [Yersinia rohdei ATCC 43380]
          Length = 91

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 15/91 (16%), Positives = 31/91 (34%), Gaps = 6/91 (6%)

Query: 21  LIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTR 74
           ++Q    +  G+S      +       + + + R TA+LA  FF  S+ LG +S     +
Sbjct: 1   MLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLATLFFVISLILGNMSTNQGNK 60

Query: 75  YKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             +  +       +           S  +  
Sbjct: 61  GSEWENLGQPAKTEQTAAPVAPTKPSSDIPQ 91


>gi|205375136|ref|ZP_03227927.1| preprotein translocase subunit SecG [Bacillus coahuilensis m4-4]
          Length = 76

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M    +V+ +IV +GL+ V+L+QS  S+    + +  +         R     L R T +
Sbjct: 1  MYTLSVVLLIIVSIGLIGVVLLQSGKSAGLSGAISGGAEQLFGKQKARGIDLVLHRVTVV 60

Query: 53 LAFFFFATSIALGMIS 68
          L+  FF  +IA+   S
Sbjct: 61 LSVLFFILTIAVAYFS 76


>gi|167037154|ref|YP_001664732.1| preprotein translocase subunit SecG [Thermoanaerobacter
          pseudethanolicus ATCC 33223]
 gi|167039954|ref|YP_001662939.1| preprotein translocase subunit SecG [Thermoanaerobacter sp. X514]
 gi|300915492|ref|ZP_07132804.1| preprotein translocase, SecG subunit [Thermoanaerobacter sp.
          X561]
 gi|307724722|ref|YP_003904473.1| preprotein translocase subunit SecG [Thermoanaerobacter sp. X513]
 gi|320115573|ref|YP_004185732.1| preprotein translocase subunit SecG [Thermoanaerobacter brockii
          subsp. finnii Ako-1]
 gi|166854194|gb|ABY92603.1| preprotein translocase, SecG subunit [Thermoanaerobacter sp.
          X514]
 gi|166855988|gb|ABY94396.1| preprotein translocase, SecG subunit [Thermoanaerobacter
          pseudethanolicus ATCC 33223]
 gi|300888444|gb|EFK83594.1| preprotein translocase, SecG subunit [Thermoanaerobacter sp.
          X561]
 gi|307581783|gb|ADN55182.1| preprotein translocase, SecG subunit [Thermoanaerobacter sp.
          X513]
 gi|319928664|gb|ADV79349.1| preprotein translocase, SecG subunit [Thermoanaerobacter brockii
          subsp. finnii Ako-1]
          Length = 79

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 34/75 (45%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS--------SSNFTSVRSTAHSLGRFTAI 52
          ++  LMV+H++V + L+ VIL+Q   S+                   R+   +L + T I
Sbjct: 2  LKTVLMVIHVLVSLFLIAVILLQKGKSAGISGVIEGGAETFFGKNKARTMEGTLEKLTTI 61

Query: 53 LAFFFFATSIALGMI 67
           A  F   S+ L ++
Sbjct: 62 AAALFIILSMVLTVM 76


>gi|85716535|ref|ZP_01047506.1| hypothetical protein NB311A_06321 [Nitrobacter sp. Nb-311A]
 gi|85696724|gb|EAQ34611.1| hypothetical protein NB311A_06321 [Nitrobacter sp. Nb-311A]
          Length = 129

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 34/126 (26%), Positives = 53/126 (42%), Gaps = 5/126 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  ++V+HLI+V  L  ++L+Q S+    G      F S R TA+ L R TA LA  FF
Sbjct: 1   MQTVVIVIHLIIVSVLTVIVLLQKSEGGGLGMGGGAGFMSSRGTANLLTRTTAFLAAGFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK--LDSVSAKSSSSVVA 116
           ATS+ L  ++     +    +  +     +  G             LDS+      +  A
Sbjct: 61  ATSLFLSWLAG-AHQKPSSILDGAPASQSQPAGGTAPVAPPGGGGLLDSLKQSERPATPA 119

Query: 117 GKRSSS 122
                +
Sbjct: 120 PAGPQA 125


>gi|313159352|gb|EFR58716.1| preprotein translocase, SecG subunit [Alistipes sp. HGB5]
          Length = 121

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 51/119 (42%), Gaps = 3/119 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA---FGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           +    + + LI  V ++  +L+Q+  S     FG+S+    VR T+  L +FT  +A   
Sbjct: 2   LYTICIALILIASVLIILAVLVQNPKSGMAANFGASNQVMGVRETSDFLEKFTWTMAIAI 61

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
              S+   +          ++     V +++++  ++    + P+ +  +A+  +   A
Sbjct: 62  VVLSLVATLAMDKGLVAESNSEISKDVKALQERVIESETPATMPQAEIPAAEVPAEQSA 120


>gi|88608627|ref|YP_506743.1| preprotein translocase, SecG subunit [Neorickettsia sennetsu str.
          Miyayama]
 gi|88600796|gb|ABD46264.1| preprotein translocase, SecG subunit [Neorickettsia sennetsu str.
          Miyayama]
          Length = 107

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 4/75 (5%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
          FL+V+  IV V +V ++L QSS      +           RS +    RFT +L   FF 
Sbjct: 3  FLIVLQFIVAVLIVTLVLCQSSGSDVAGTFTSGRRGLFPARSVSGLFVRFTWVLLLVFFL 62

Query: 60 TSIALGMISRYTSTR 74
           +I LG ++  ++T 
Sbjct: 63 NTILLGRLNFTSNTE 77


>gi|84368665|dbj|BAE69823.1| protein-export membrane protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 137

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/102 (15%), Positives = 37/102 (36%), Gaps = 6/102 (5%)

Query: 16  LVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFFFATSIALGMISR 69
           ++ +IL+Q    +A GS             +  ++ L + T  LA  FF+ S+ +   + 
Sbjct: 1   MIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLAVVFFSISLFMAWYAT 60

Query: 70  YTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
           + +     N+      ++             P+  +  A  +
Sbjct: 61  HGARPTDQNLGVMSQSAMPAPAAAGELTQPLPQAPAAGAVPT 102


>gi|89098801|ref|ZP_01171682.1| protein-export membrane protein [Bacillus sp. NRRL B-14911]
 gi|89086477|gb|EAR65597.1| protein-export membrane protein [Bacillus sp. NRRL B-14911]
          Length = 77

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L+ + +IV V L+ V+L+QS  S+    + +  +         R     L R T +
Sbjct: 1  MYTLLITLLIIVSVALIVVVLLQSGKSAGLSGAISGGAEQLFGKQKARGLDLILHRVTIV 60

Query: 53 LAFFFFATSIALGMI 67
          L+  FF  +IA+   
Sbjct: 61 LSVLFFVLTIAVAYF 75


>gi|167815035|ref|ZP_02446715.1| preprotein translocase subunit SecG [Burkholderia pseudomallei
          91]
          Length = 82

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/82 (21%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 11 IVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAFFFFATSIAL 64
          +  +G++ ++L+Q    +  G+      S +      +A+ L R TA+LA  FF  ++AL
Sbjct: 1  MSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTAVLATIFFVATLAL 60

Query: 65 GMISRYTSTRYKDNMHRSLVDS 86
            +  Y S      +  +   +
Sbjct: 61 TYLGSYKSAPSVGVLGAAPAPA 82


>gi|221068613|ref|ZP_03544718.1| preprotein translocase, SecG subunit [Comamonas testosteroni
          KF-1]
 gi|220713636|gb|EED69004.1| preprotein translocase, SecG subunit [Comamonas testosteroni
          KF-1]
          Length = 127

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 6/90 (6%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAF 55
             ++ V ++  +G++ +IL+Q    +  G+S    S  S       A+ L R TA LA 
Sbjct: 5  SSVILAVQMLAALGMIGLILMQHGKGADMGASFGSGSSGSLFGASGSANFLSRSTAALAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVD 85
           FF  ++AL  +           +  + V 
Sbjct: 65 VFFVATLALAYLGNARPVSSGSVLEGAAVS 94


>gi|78778260|ref|YP_394575.1| preprotein translocase subunit SecG [Sulfurimonas denitrificans DSM
           1251]
 gi|78498800|gb|ABB45340.1| protein translocase subunit secG [Sulfurimonas denitrificans DSM
           1251]
          Length = 133

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 49/127 (38%), Gaps = 5/127 (3%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
             FL++V +++VV LV  +L+Q S      +  GS+ +    +  A  L + T  + F F
Sbjct: 3   TSFLLIVQIVLVVMLVIAVLLQKSSSIGLGAYSGSNESVFGAKGPASFLAKTTFAIGFLF 62

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
              +IALG +    +T      + +    I           +         + ++ V   
Sbjct: 63  VINTIALGYMYSSAATD-SIVDNITPSTDIAAPSATVSVVPAVETKVVAPTQEAAPVQQS 121

Query: 118 KRSSSRT 124
            +  + T
Sbjct: 122 TQEQNNT 128


>gi|62184938|ref|YP_219723.1| preprotein translocase subunit SecG [Chlamydophila abortus S26/3]
 gi|62148005|emb|CAH63756.1| putative membrane translocase [Chlamydophila abortus S26/3]
 gi|313847846|emb|CBY16840.1| putative membrane translocase [Chlamydophila psittaci RD1]
 gi|325506703|gb|ADZ18341.1| preprotein translocase subunit [Chlamydophila psittaci 6BC]
 gi|328914506|gb|AEB55339.1| preprotein translocase, SecG subunit [Chlamydophila psittaci 6BC]
          Length = 104

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 37/96 (38%), Gaps = 9/96 (9%)

Query: 5   LMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS-----TAHSLGRFTAILAFFFFA 59
            + + L++ V L  +ILIQ S S   GSS    S  S     T   L + TA LA  F  
Sbjct: 8   FLFIFLLLCVILCGLILIQESKSMGLGSSFGVDSGDSVFGVSTPDILKKVTAWLAVVFCF 67

Query: 60  TSIAL----GMISRYTSTRYKDNMHRSLVDSIKDQG 91
           + + L      + + +       + +   D  +   
Sbjct: 68  SCLFLSFATTYLGKNSQEPPVHVLEQVSSDGEEISS 103


>gi|332181440|gb|AEE17128.1| preprotein translocase, SecG subunit [Treponema brennaborense DSM
           12168]
          Length = 118

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 22/112 (19%), Positives = 48/112 (42%), Gaps = 4/112 (3%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSS----SNFTSVRSTAHSLGRFTAILAFFFFA 59
            L+V  +I+ + LVC++L+Q+ +    G      ++      + + L + T IL   FF 
Sbjct: 7   ILLVAFVIICILLVCIVLVQNEEGGGMGGLFGGGNSAAFGSRSGNVLTKTTYILVTLFFL 66

Query: 60  TSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
           +S  L +I++  S +  D+  +        +G       +S    +  + + 
Sbjct: 67  SSFGLALINKAPSVKSLDSAVQQEQAGSASEGFWLDEAAASGTAPAEISPAE 118


>gi|299530741|ref|ZP_07044156.1| preprotein translocase, SecG subunit [Comamonas testosteroni S44]
 gi|298721257|gb|EFI62199.1| preprotein translocase, SecG subunit [Comamonas testosteroni S44]
          Length = 131

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 36/86 (41%), Gaps = 6/86 (6%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAF 55
             ++ V ++  +G++ +IL+Q    +  G+S    S  S       A+ L R TA LA 
Sbjct: 5  SSVILAVQMLAALGMIGLILMQHGKGADMGASFGSGSSGSLFGASGSANFLSRSTAALAT 64

Query: 56 FFFATSIALGMISRYTSTRYKDNMHR 81
           FF  ++AL  +           +  
Sbjct: 65 VFFVATLALAYLGNARPVSSGSVLEG 90


>gi|160880998|ref|YP_001559966.1| preprotein translocase, SecG subunit [Clostridium phytofermentans
          ISDg]
 gi|160429664|gb|ABX43227.1| preprotein translocase, SecG subunit [Clostridium phytofermentans
          ISDg]
          Length = 81

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 8/71 (11%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF--------TSVRSTAHSLGRFTAILAF 55
           + V+++++ +GLV V+L+Q   S+    S N            RS   +L + T +L  
Sbjct: 7  IVTVLYVLICLGLVVVVLMQEGKSAGLSGSINGVADTYWGKNKGRSMEGALVKITKLLGA 66

Query: 56 FFFATSIALGM 66
           F   SI L M
Sbjct: 67 LFIVISIVLNM 77


>gi|291513704|emb|CBK62914.1| protein translocase, SecG subunit [Alistipes shahii WAL 8301]
          Length = 121

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 49/119 (41%), Gaps = 3/119 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA---FGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           +    + + L+  V ++  +L+Q+  S     FG+S+    VR T + L +FT  +A   
Sbjct: 2   LYTICIALILVASVLVILAVLVQNPKSGMAANFGASNQVMGVRETTNFLEKFTWSMAIAI 61

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
              S+A  +          +        +++++  ++    + P+ +  SA  +    A
Sbjct: 62  VVLSLAATLAMDRGLVADSNLEISKDAKALQERVIESEAAATMPQAEIPSAGQTEQQQA 120


>gi|148269581|ref|YP_001244041.1| preprotein translocase, SecG subunit [Thermotoga petrophila
          RKU-1]
 gi|170288257|ref|YP_001738495.1| preprotein translocase, SecG subunit [Thermotoga sp. RQ2]
 gi|281411700|ref|YP_003345779.1| preprotein translocase, SecG subunit [Thermotoga naphthophila
          RKU-10]
 gi|209156624|pdb|3DIN|E Chain E, Crystal Structure Of The Protein-Translocation Complex
          Formed By The Secy Channel And The Seca Atpase
 gi|209156628|pdb|3DIN|H Chain H, Crystal Structure Of The Protein-Translocation Complex
          Formed By The Secy Channel And The Seca Atpase
 gi|147735125|gb|ABQ46465.1| protein translocase subunit secG [Thermotoga petrophila RKU-1]
 gi|170175760|gb|ACB08812.1| preprotein translocase, SecG subunit [Thermotoga sp. RQ2]
 gi|281372803|gb|ADA66365.1| preprotein translocase, SecG subunit [Thermotoga naphthophila
          RKU-10]
          Length = 76

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 6/73 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSS--NFTSVRSTAHSLGRFTAILA 54
          M+ F ++VH I+ V L+ ++ +Q S       AFGS         R    + G+ T +L+
Sbjct: 1  MKTFFLIVHTIISVALIYMVQVQMSKFSELGGAFGSGGLHTVFGRRKGLDTGGKITLVLS 60

Query: 55 FFFFATSIALGMI 67
            FF + +    +
Sbjct: 61 VLFFVSCVVTAFV 73


>gi|331701671|ref|YP_004398630.1| preprotein translocase subunit SecG [Lactobacillus buchneri NRRL
          B-30929]
 gi|329129014|gb|AEB73567.1| preprotein translocase, SecG subunit [Lactobacillus buchneri NRRL
          B-30929]
          Length = 78

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M  FL+ + LI  V +   +L+Q S      S+  G + +  +    R     + + T +
Sbjct: 1  MYNFLLTLLLIDCVLITIAVLMQPSKTNDAMSALTGGADDLFAKQKPRGFEAFMQKTTLV 60

Query: 53 LAFFFFATSIALGMISRY 70
          L   FF  ++AL  IS +
Sbjct: 61 LGIIFFLLALALVWISSH 78


>gi|319957834|ref|YP_004169097.1| preprotein translocase, secg subunit [Nitratifractor salsuginis DSM
           16511]
 gi|319420238|gb|ADV47348.1| preprotein translocase, SecG subunit [Nitratifractor salsuginis DSM
           16511]
          Length = 114

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 43/113 (38%), Gaps = 4/113 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   LM+V +I+ + +   IL+Q SD     +  GS+ +    +  +  L + T  LA  
Sbjct: 1   MTSTLMIVQIILSILITITILLQKSDSIGLGAYSGSNESLFGAKGPSGFLAKATFTLALL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
           F   ++ALG +    S R   +       S+            +P   +    
Sbjct: 61  FVINTLALGYLYNKESNRSVTDTLSKQKTSVPVPAPAPKSAPQAPAAPTEKTS 113


>gi|157693785|ref|YP_001488247.1| preprotein translocase subunit SecG [Bacillus pumilus SAFR-032]
 gi|194015216|ref|ZP_03053832.1| preprotein translocase, SecG subunit [Bacillus pumilus ATCC 7061]
 gi|157682543|gb|ABV63687.1| preprotein translocase subunit SecG [Bacillus pumilus SAFR-032]
 gi|194012620|gb|EDW22186.1| preprotein translocase, SecG subunit [Bacillus pumilus ATCC 7061]
          Length = 77

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 37/76 (48%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M  F++ + +IV + L+ V+L+QSS S+    + +  +         R     L R T I
Sbjct: 1  MHAFVITLLVIVSIALIIVVLLQSSKSAGLSGAISGGAEQLFGKQKARGLDLILHRLTVI 60

Query: 53 LAFFFFATSIALGMIS 68
          L+  FF  ++AL  + 
Sbjct: 61 LSVLFFILTLALAYLG 76


>gi|326316098|ref|YP_004233770.1| preprotein translocase subunit SecG [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323372934|gb|ADX45203.1| preprotein translocase, SecG subunit [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 129

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 38/103 (36%), Gaps = 6/103 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILA 54
           +   ++ V ++  + ++ ++LIQ    +  G++    S  S       A+ L R TA+LA
Sbjct: 4   LVNVILAVQMLAALAMIGLVLIQHGKGADMGAAFGSGSSGSLFGASGSANFLSRSTAVLA 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGD 97
             FFA ++AL              +          Q       
Sbjct: 64  GVFFAATLALAYFGNVRPAGVGSVLETPAAAPAAVQSVSPSST 106


>gi|120609949|ref|YP_969627.1| protein translocase subunit secG [Acidovorax citrulli AAC00-1]
 gi|120588413|gb|ABM31853.1| protein translocase subunit secG [Acidovorax citrulli AAC00-1]
          Length = 129

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 37/86 (43%), Gaps = 6/86 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILA 54
          +   ++ V ++  + ++ ++LIQ    +  G++    S  S       A+ L R TA+LA
Sbjct: 4  LVNVILAVQMLAALAMIGLVLIQHGKGADMGAAFGSGSSGSLFGASGSANFLSRSTAVLA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNMH 80
            FFA ++AL              + 
Sbjct: 64 GVFFAATLALAYFGNVRPAGVGSVLE 89


>gi|327313752|ref|YP_004329189.1| preprotein translocase subunit SecG [Prevotella denticola F0289]
 gi|326945719|gb|AEA21604.1| preprotein translocase, SecG subunit [Prevotella denticola F0289]
          Length = 128

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 35/89 (39%), Gaps = 4/89 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M    +++ +I  + ++ V+LIQ S        F SS+    VR T   + + T  LA  
Sbjct: 1  MYTLFVILIVIAALLMIGVVLIQESKGGGLSSNFSSSNAIMGVRKTTDFIEKTTWGLAIA 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVD 85
              S+A   ++   +T        +   
Sbjct: 61 MVVISVASAYVAPTANTDESVIEKAATEG 89


>gi|325859948|ref|ZP_08173075.1| preprotein translocase, SecG subunit [Prevotella denticola CRIS
          18C-A]
 gi|325482474|gb|EGC85480.1| preprotein translocase, SecG subunit [Prevotella denticola CRIS
          18C-A]
          Length = 128

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 35/89 (39%), Gaps = 4/89 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M    +++ +I  + ++ V+LIQ S        F SS+    VR T   + + T  LA  
Sbjct: 1  MYTLFVILIVIAALLMIGVVLIQESKGGGLSSNFSSSNAIMGVRKTTDFIEKTTWGLAIA 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVD 85
              S+A   ++   +T        +   
Sbjct: 61 MVVISVASAYVAPTANTDESVIEKAATEG 89


>gi|329850641|ref|ZP_08265486.1| preprotein translocase, SecG subunit [Asticcacaulis biprosthecum
          C19]
 gi|328840956|gb|EGF90527.1| preprotein translocase, SecG subunit [Asticcacaulis biprosthecum
          C19]
          Length = 221

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT---SVRSTAHSLGRFTAILAFFF 57
          +   L+ + ++V + L  ++LIQ S+  A G         S R   + L + T++L   F
Sbjct: 2  LFGILLTIQILVCLALGGLVLIQRSEGGALGMGGGPAGLVSARGAGNLLTKATSVLGILF 61

Query: 58 FATSIALGMISRYTSTR 74
          FA +IA+ ++    S R
Sbjct: 62 FALAIAMTIVGNIESRR 78


>gi|313904160|ref|ZP_07837539.1| preprotein translocase, SecG subunit [Eubacterium cellulosolvens
          6]
 gi|313470962|gb|EFR66285.1| preprotein translocase, SecG subunit [Eubacterium cellulosolvens
          6]
          Length = 81

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 10/74 (13%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF----------TSVRSTAHSLGRFTAI 52
            L V+  +  +G++ VIL+Q       G+ +               RS   +L R T I
Sbjct: 6  TVLTVLFALDCIGMIIVILMQQGKDRGLGAIAGVSNNTETYWSKNKGRSKEGNLIRITRI 65

Query: 53 LAFFFFATSIALGM 66
          LA  FFA S+ L +
Sbjct: 66 LAILFFALSVVLNI 79


>gi|254455461|ref|ZP_05068890.1| preprotein translocase SecG subunit [Candidatus Pelagibacter sp.
          HTCC7211]
 gi|207082463|gb|EDZ59889.1| preprotein translocase SecG subunit [Candidatus Pelagibacter sp.
          HTCC7211]
          Length = 79

 Score = 53.9 bits (128), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 29/73 (39%), Gaps = 3/73 (4%)

Query: 21 LIQSSDSS---AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKD 77
          ++Q S+        S  NF   RS    + + TAI+A  F   S+AL +ISR   T    
Sbjct: 1  MLQKSEGGALGIGVSQENFMLSRSAGSFMTKATAIVATLFIICSLALTIISRAELTPTSS 60

Query: 78 NMHRSLVDSIKDQ 90
           +      +    
Sbjct: 61 VLDTVEEKAEDTP 73


>gi|283955659|ref|ZP_06373152.1| putative protein-export membrane protein [Campylobacter jejuni
           subsp. jejuni 1336]
 gi|283792884|gb|EFC31660.1| putative protein-export membrane protein [Campylobacter jejuni
           subsp. jejuni 1336]
          Length = 122

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 22/116 (18%), Positives = 44/116 (37%), Gaps = 8/116 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L+++  I+VV +   +L+Q S      +  GS+ +    +  A  L +FT I+   
Sbjct: 1   MITLLIILQFIIVVVICIAVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFIMGIL 60

Query: 57  FFATSIALGMISRYTSTRYKD----NMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
             A +I LG +    S           + + + S          +  +P    + +
Sbjct: 61  LIANTIGLGYLYNKASKDSLAEKIKVENNTTIPSAPIAPATPNTNSIAPSAPQLPS 116


>gi|239828272|ref|YP_002950896.1| preprotein translocase subunit SecG [Geobacillus sp. WCH70]
 gi|239808565|gb|ACS25630.1| preprotein translocase, SecG subunit [Geobacillus sp. WCH70]
          Length = 77

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L+ + +IV +GL+ ++L+QS  S+    +    +         R     L R T +
Sbjct: 1  MHTLLVTLLVIVSIGLIVIVLLQSGRSAGLSGAITGGAEQLFGKQKARGLDAVLQRITVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  SIA+  +
Sbjct: 61 LAVLFFVLSIAVTYM 75


>gi|154253596|ref|YP_001414420.1| preprotein translocase subunit SecG [Parvibaculum lavamentivorans
           DS-1]
 gi|154157546|gb|ABS64763.1| preprotein translocase, SecG subunit [Parvibaculum lavamentivorans
           DS-1]
          Length = 144

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 42/109 (38%), Gaps = 3/109 (2%)

Query: 17  VCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTST 73
           V  +L+Q S+  A G       F S R   ++L R TA+LA  F  TS+ LG+++    +
Sbjct: 17  VATVLLQRSEGGALGIGGGGDGFMSGRGAGNALTRATAVLAALFITTSLVLGILASRGGS 76

Query: 74  RYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSS 122
                   +   +  D+   +       +   +    +++        +
Sbjct: 77  ADGILDRIAPPTAGGDETVPDVPAPLGSEFPDLEQTPAANQPETATDEA 125


>gi|21108986|gb|AAM37551.1| protein-export membrane protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 141

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 16/99 (16%), Positives = 35/99 (35%), Gaps = 6/99 (6%)

Query: 16  LVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFFFATSIALGMISR 69
           ++ +IL+Q    +A GS             +  ++ L + T  LA  FF+ S+ +   + 
Sbjct: 1   MIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLAVVFFSISLFMAWYAT 60

Query: 70  YTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
           + +     N+      +              P+  +  A
Sbjct: 61  HGARPTDQNLGVMSQSATPAPAAAGELTQPLPQAPAAGA 99


>gi|295401520|ref|ZP_06811489.1| preprotein translocase, SecG subunit [Geobacillus
          thermoglucosidasius C56-YS93]
 gi|312109555|ref|YP_003987871.1| preprotein translocase subunit SecG [Geobacillus sp. Y4.1MC1]
 gi|294976432|gb|EFG52041.1| preprotein translocase, SecG subunit [Geobacillus
          thermoglucosidasius C56-YS93]
 gi|311214656|gb|ADP73260.1| preprotein translocase, SecG subunit [Geobacillus sp. Y4.1MC1]
          Length = 77

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L+ + +IV + L+ V+L+QS  S+    +    +         R     L R T +
Sbjct: 1  MHTLLVTLLVIVSIALIVVVLLQSGRSAGLSGAITGGAEQLFGKQKARGLDAVLQRITVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  SIA+  +
Sbjct: 61 LAVLFFVLSIAVTYM 75


>gi|254454511|ref|ZP_05067948.1| preprotein translocase, SecG subunit [Octadecabacter antarcticus
           238]
 gi|198268917|gb|EDY93187.1| preprotein translocase, SecG subunit [Octadecabacter antarcticus
           238]
          Length = 122

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 54/122 (44%), Gaps = 4/122 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M+  ++VVHL++ + L+ V+L+Q S     G          S RS A +LG+ T +LA  
Sbjct: 1   MENVVLVVHLLLALTLIGVVLLQRSQGGGLGIGGGGGGGAMSSRSAATALGKITWVLAIA 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           F  TS+AL ++S   ++        +L+ + +   +     GS        A +   V  
Sbjct: 61  FICTSLALTILSAQKASDASVVGGDALLPASEQSTDAPSAAGSLLPPTVAPASNDPLVPD 120

Query: 117 GK 118
             
Sbjct: 121 AD 122


>gi|126700789|ref|YP_001089686.1| putative subunit of preprotein translocase [Clostridium difficile
          630]
 gi|254976756|ref|ZP_05273228.1| putative subunit of preprotein translocase [Clostridium difficile
          QCD-66c26]
 gi|255094140|ref|ZP_05323618.1| putative subunit of preprotein translocase [Clostridium difficile
          CIP 107932]
 gi|255102312|ref|ZP_05331289.1| putative subunit of preprotein translocase [Clostridium difficile
          QCD-63q42]
 gi|255308204|ref|ZP_05352375.1| putative subunit of preprotein translocase [Clostridium difficile
          ATCC 43255]
 gi|255315892|ref|ZP_05357475.1| putative subunit of preprotein translocase [Clostridium difficile
          QCD-76w55]
 gi|255518552|ref|ZP_05386228.1| putative subunit of preprotein translocase [Clostridium difficile
          QCD-97b34]
 gi|255651672|ref|ZP_05398574.1| putative subunit of preprotein translocase [Clostridium difficile
          QCD-37x79]
 gi|255657115|ref|ZP_05402524.1| putative subunit of preprotein translocase [Clostridium difficile
          QCD-23m63]
 gi|260684707|ref|YP_003215992.1| putative subunit of preprotein translocase [Clostridium difficile
          CD196]
 gi|260688365|ref|YP_003219499.1| putative subunit of preprotein translocase [Clostridium difficile
          R20291]
 gi|296452049|ref|ZP_06893762.1| preprotein translocase subunit SecG [Clostridium difficile NAP08]
 gi|296879555|ref|ZP_06903536.1| preprotein translocase subunit SecG [Clostridium difficile NAP07]
 gi|306521473|ref|ZP_07407820.1| putative subunit of preprotein translocase [Clostridium difficile
          QCD-32g58]
 gi|115252226|emb|CAJ70066.1| Protein-export membrane protein SecG [Clostridium difficile]
 gi|260210870|emb|CBA66007.1| putative subunit of preprotein translocase [Clostridium difficile
          CD196]
 gi|260214382|emb|CBE06780.1| putative subunit of preprotein translocase [Clostridium difficile
          R20291]
 gi|296259122|gb|EFH06004.1| preprotein translocase subunit SecG [Clostridium difficile NAP08]
 gi|296429437|gb|EFH15303.1| preprotein translocase subunit SecG [Clostridium difficile NAP07]
          Length = 74

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 5/72 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS-----AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          M   LM V +++ + LV  I+ Q S ++         S  +   +     L R T I A 
Sbjct: 1  MSNILMGVQVVLGILLVISIMPQDSKNALPSEFGGEGSQAYFKPKGKQAFLARVTKITAV 60

Query: 56 FFFATSIALGMI 67
           FF  ++AL ++
Sbjct: 61 LFFINALALLIV 72


>gi|331000851|ref|ZP_08324497.1| preprotein translocase, SecG subunit [Parasutterella
           excrementihominis YIT 11859]
 gi|329570379|gb|EGG52112.1| preprotein translocase, SecG subunit [Parasutterella
           excrementihominis YIT 11859]
          Length = 125

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 47/122 (38%), Gaps = 6/122 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           +    +V+ +I  V ++ ++L+Q    +  G++       +      +A+ L R TA+ +
Sbjct: 4   LITVAVVLQVISAVAIIVLVLLQHGKGADMGAAFGGGASGSLFGATGSANFLSRSTAVAS 63

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF  ++AL    +         +  ++    K          S+   DS +  + + +
Sbjct: 64  TIFFCATLALTFGGQVRKAPAAGGVLSTVTTEQKAPAQPASPAPSTNTSDSTNKPAQNQI 123

Query: 115 VA 116
             
Sbjct: 124 PR 125


>gi|194337115|ref|YP_002018909.1| preprotein translocase, SecG subunit [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|194309592|gb|ACF44292.1| preprotein translocase, SecG subunit [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 120

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 43/125 (34%), Gaps = 15/125 (12%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-------NFTSVRSTAHSLGRFTAIL 53
           M +F+++V L+  + L+ VIL+QS  S +  +             VR T   L + TAIL
Sbjct: 1   MHVFIVIVGLLASILLIGVILLQSPKSGSGLTGGIASLGTVQTLGVRRTGDFLSKMTAIL 60

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS--SPKLDSVSAKSS 111
           A                  T     +  +   S++          +   P      A   
Sbjct: 61  AATVMLLCFVAAF------TLPGRTVKEAPEGSMQQNVPAMPAPSANKVPSAPVSPAPVI 114

Query: 112 SSVVA 116
            ++ A
Sbjct: 115 PALPA 119


>gi|303241633|ref|ZP_07328132.1| preprotein translocase, SecG subunit [Acetivibrio cellulolyticus
          CD2]
 gi|302590853|gb|EFL60602.1| preprotein translocase, SecG subunit [Acetivibrio cellulolyticus
          CD2]
          Length = 78

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 8/77 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          MQI + ++H++  + L+ ++L+QS        +  G +  F      R+    LG++TA+
Sbjct: 1  MQIAVNILHVLFCISLIVIVLLQSGKQAGLSGAIAGGAETFFGKNKGRTIDALLGKWTAV 60

Query: 53 LAFFFFATSIALGMISR 69
           A  F  TSIAL ++  
Sbjct: 61 AAIGFLITSIALQIMIN 77


>gi|313672826|ref|YP_004050937.1| preprotein translocase, secg subunit [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939582|gb|ADR18774.1| preprotein translocase, SecG subunit [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 106

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 23/105 (21%), Positives = 36/105 (34%), Gaps = 5/105 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDS-----SAFGSSSNFTSVRSTAHSLGRFTAILAF 55
           M   ++  H+   + L+  ILIQS        +  G SS+     +  + + + T IL  
Sbjct: 1   MYAIVLGFHIFFTILLILAILIQSGKGSSLKEAFGGGSSDMFGPGTPENIMTKITTILVI 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSS 100
            FF TSI L ++S                       N       S
Sbjct: 61  LFFTTSITLTIMSSSGKAGSSIVNKLQDTPVKTIPQNKPVVPTES 105


>gi|264677197|ref|YP_003277103.1| preprotein translocase, SecG subunit [Comamonas testosteroni CNB-2]
 gi|262207709|gb|ACY31807.1| preprotein translocase, SecG subunit [Comamonas testosteroni CNB-2]
          Length = 131

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 39/103 (37%), Gaps = 6/103 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAF 55
              ++ V ++  +G++ +IL+Q    +  G+S    S  S       A+ L R TA LA 
Sbjct: 5   SSVILAVQMLAALGMIGLILMQHGKGADMGASFGSGSSGSLFGASGSANFLSRSTAALAT 64

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
            FF  ++AL  +           +  +   S      +     
Sbjct: 65  VFFVATLALAYLGNARPVSSGSVLEGAAPVSAPVPAANVSPAT 107


>gi|148543628|ref|YP_001270998.1| preprotein translocase, SecG subunit [Lactobacillus reuteri DSM
          20016]
 gi|227363401|ref|ZP_03847527.1| Sec family type I general secretory protein SecG [Lactobacillus
          reuteri MM2-3]
 gi|227545087|ref|ZP_03975136.1| Sec family type I general secretory protein SecG [Lactobacillus
          reuteri CF48-3A]
 gi|300909243|ref|ZP_07126704.1| preprotein translocase subunit SecG [Lactobacillus reuteri
          SD2112]
 gi|325681991|ref|ZP_08161509.1| preprotein translocase subunit SecG [Lactobacillus reuteri
          MM4-1A]
 gi|148530662|gb|ABQ82661.1| preprotein translocase, SecG subunit [Lactobacillus reuteri DSM
          20016]
 gi|227071590|gb|EEI09887.1| Sec family type I general secretory protein SecG [Lactobacillus
          reuteri MM2-3]
 gi|227184936|gb|EEI65007.1| Sec family type I general secretory protein SecG [Lactobacillus
          reuteri CF48-3A]
 gi|300893108|gb|EFK86467.1| preprotein translocase subunit SecG [Lactobacillus reuteri
          SD2112]
 gi|324978635|gb|EGC15584.1| preprotein translocase subunit SecG [Lactobacillus reuteri
          MM4-1A]
          Length = 79

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 33/79 (41%), Gaps = 9/79 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHS---LGRFTA 51
          M   LM + LI  V L+  +++Q +       S+  G + +  S R        +   T 
Sbjct: 1  MYNTLMTLFLIDCVVLIACVMMQPAKNDNDAMSALTGGAGDLFSRRKARGFEAVMQIVTT 60

Query: 52 ILAFFFFATSIALGMISRY 70
          I    FF  ++A+  +S +
Sbjct: 61 ICGALFFILALAMIYVSSH 79


>gi|30023168|ref|NP_834799.1| preprotein translocase subunit SecG [Bacillus cereus ATCC 14579]
 gi|29898728|gb|AAP12000.1| Protein translocase subunit SecG [Bacillus cereus ATCC 14579]
          Length = 77

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 31/75 (41%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSS-----DSSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M   L V+ +IV + ++ ++L+Q S       +  G +         R     L R T +
Sbjct: 1  MHTLLSVLLIIVSILMIVMVLMQCSNSSGLSGAISGGAEQLFGKQKARGIEAVLNRITIV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +I +   
Sbjct: 61 LAVLFFVLTIGVTYF 75


>gi|229825460|ref|ZP_04451529.1| hypothetical protein GCWU000182_00820 [Abiotrophia defectiva ATCC
          49176]
 gi|229790023|gb|EEP26137.1| hypothetical protein GCWU000182_00820 [Abiotrophia defectiva ATCC
          49176]
          Length = 78

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 29/70 (41%), Gaps = 7/70 (10%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF-------TSVRSTAHSLGRFTAILAFF 56
           + V++ I+ V L  ++L+Q       G+ S            RS   +L + T ++A  
Sbjct: 7  VVTVIYCIICVALAAIVLLQEGKQQGLGTISGMADTYWGKNKSRSMEGNLNKATTVVAIG 66

Query: 57 FFATSIALGM 66
          F   S  L M
Sbjct: 67 FIVLSFVLNM 76


>gi|222099166|ref|YP_002533734.1| Protein translocase subunit secG [Thermotoga neapolitana DSM
          4359]
 gi|221571556|gb|ACM22368.1| Protein translocase subunit secG [Thermotoga neapolitana DSM
          4359]
          Length = 83

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 34/73 (46%), Gaps = 6/73 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSS--NFTSVRSTAHSLGRFTAILA 54
          M+ F ++VH I+ V L+ ++ +Q S       AFGS         +    + G+ T +L+
Sbjct: 8  MKTFFLIVHTIISVALIYMVQVQMSKFSELGGAFGSGGLHTVFGRKRGLDTGGKITLVLS 67

Query: 55 FFFFATSIALGMI 67
            FF + +    +
Sbjct: 68 VLFFISCVITAFV 80


>gi|291295527|ref|YP_003506925.1| preprotein translocase subunit SecG [Meiothermus ruber DSM 1279]
 gi|290470486|gb|ADD27905.1| preprotein translocase, SecG subunit [Meiothermus ruber DSM 1279]
          Length = 75

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 31/72 (43%), Gaps = 3/72 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ---SSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
          +Q  L+  ++ +   LV ++L Q         FG S++  S R     L R T +L   F
Sbjct: 4  LQNVLIFFYIAIAGLLVYLVLSQEPRQGAGDMFGGSTDLFSTRGVTGGLYRITVVLGVLF 63

Query: 58 FATSIALGMISR 69
           A + +    +R
Sbjct: 64 VALAFSFRFFTR 75


>gi|289665172|ref|ZP_06486753.1| preprotein translocase subunit SecG [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 124

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 12/84 (14%), Positives = 28/84 (33%)

Query: 27  SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDS 86
               G+S      +  ++ L + T  LA  FF+ S+ +   + + +     N+      +
Sbjct: 2   GFGAGASGTVFGSQGASNFLSKSTKWLAVVFFSISLFMAWYATHGARPTDQNLGVMSQSA 61

Query: 87  IKDQGNDNFGDGSSPKLDSVSAKS 110
                         PK  + +  +
Sbjct: 62  TPAPAAAGELTQPLPKAPAGAVPT 85


>gi|326791903|ref|YP_004309724.1| preprotein translocase, SecG subunit [Clostridium lentocellum DSM
           5427]
 gi|326542667|gb|ADZ84526.1| preprotein translocase, SecG subunit [Clostridium lentocellum DSM
           5427]
          Length = 135

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 51/131 (38%), Gaps = 11/131 (8%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHS---------LGRFTAILA 54
            L++V LI    +  V+L+Q   S+  GS     +  S               R+T I+A
Sbjct: 7   ILIIVFLIAAFAITVVVLLQEGKSAGLGSIGGAANSDSYWDKNKKHTLEGKFERWTKIMA 66

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             F   +  L ++   T+      +      S   +  DN G  ++P  ++     +S+ 
Sbjct: 67  GVFVLAAFILMLMPNNTNASNAQIVQ--PSASASAEATDNAGASTAPTTEATDNADASAS 124

Query: 115 VAGKRSSSRTK 125
            + + S+S  +
Sbjct: 125 PSAEPSASPAQ 135


>gi|254488395|ref|ZP_05101600.1| preprotein translocase, SecG subunit [Roseobacter sp. GAI101]
 gi|214045264|gb|EEB85902.1| preprotein translocase, SecG subunit [Roseobacter sp. GAI101]
          Length = 119

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 48/121 (39%), Gaps = 5/121 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA---HSLGRFTAILAFFF 57
           M+  +++VHLI+ +GL+ V+L+Q S+    G         S      ++G+ T +LA  F
Sbjct: 1   MENVVLIVHLILALGLIAVVLLQRSEGGGLGMGGGGGGAVSGRAAATAMGKITWVLATLF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
             TSI L +I+   S                ++        +   L    A ++  V   
Sbjct: 61  IITSITLTIIAAEKSAGSSVIDRLGATPPALNE--APAMPDADSLLPPTPADNTPQVPTA 118

Query: 118 K 118
            
Sbjct: 119 D 119


>gi|238797555|ref|ZP_04641052.1| Protein-export membrane protein secG [Yersinia mollaretii ATCC
           43969]
 gi|238718552|gb|EEQ10371.1| Protein-export membrane protein secG [Yersinia mollaretii ATCC
           43969]
          Length = 91

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/90 (16%), Positives = 31/90 (34%), Gaps = 6/90 (6%)

Query: 21  LIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTR 74
           ++Q    +  G+S      +       + + + R TA+LA  FF  S+ LG +S     +
Sbjct: 1   MLQQGKGADMGASFGAGASATLFGSNGSGNFMTRMTAVLAALFFVISLILGNMSTNQGQK 60

Query: 75  YKDNMHRSLVDSIKDQGNDNFGDGSSPKLD 104
             +  +       +           S  + 
Sbjct: 61  GSEWENLGQPAKTEQTTAPAAPITPSSDIP 90


>gi|307824618|ref|ZP_07654842.1| preprotein translocase, SecG subunit [Methylobacter tundripaludum
           SV96]
 gi|307734272|gb|EFO05125.1| preprotein translocase, SecG subunit [Methylobacter tundripaludum
           SV96]
          Length = 136

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 31/131 (23%), Positives = 53/131 (40%), Gaps = 6/131 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
           M   ++VVH+++ +G+V ++L+Q    +        GSS +    +  A  L R TAILA
Sbjct: 1   MYQVIIVVHVLLGLGVVGLVLMQQGKGADAGAAFGTGSSGSVFGAQGAASFLSRATAILA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FF TS+ L +++      Y       +        + +   GS         KS    
Sbjct: 61  TLFFMTSLGLAVLNGKQGAAYDLMNAPKVEQDTLGIPDVSGAKGSGSAAPVTDPKSEEVP 120

Query: 115 VAGKRSSSRTK 125
           VA    +   +
Sbjct: 121 VAAPAVTGAEQ 131


>gi|260459246|ref|ZP_05807501.1| preprotein translocase, SecG subunit [Mesorhizobium opportunistum
           WSM2075]
 gi|259034800|gb|EEW36056.1| preprotein translocase, SecG subunit [Mesorhizobium opportunistum
           WSM2075]
          Length = 158

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 56/115 (48%), Gaps = 2/115 (1%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V+HL+VV+ LV V+L+Q S+    G      F + R  A++L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMVVLALVGVVLLQRSEGGGLGIGGGSGFMTARGAANALTRATAILAAAFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
            TS+ L +I+RY                   +G  N   G++    + +A  +  
Sbjct: 61  VTSLTLSIIARYGEKPIDILDRVPATSGEAGKGVLNQLPGTTTPAPAGNATPTPP 115


>gi|260893460|ref|YP_003239557.1| preprotein translocase, SecG subunit [Ammonifex degensii KC4]
 gi|260865601|gb|ACX52707.1| preprotein translocase, SecG subunit [Ammonifex degensii KC4]
          Length = 77

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/72 (22%), Positives = 33/72 (45%), Gaps = 6/72 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
          ++  + +V+++V + L+ VI++QS  S+    +            +     L + T  LA
Sbjct: 2  LKTLVTIVYVLVCLLLITVIIMQSGRSAGLSGAIGGAAETLLGKKKGLDEWLAKVTVWLA 61

Query: 55 FFFFATSIALGM 66
            F A S+ L +
Sbjct: 62 VAFGALSLLLVV 73


>gi|85860571|ref|YP_462773.1| protein translocase subunit [Syntrophus aciditrophicus SB]
 gi|85723662|gb|ABC78605.1| protein translocase subunit [Syntrophus aciditrophicus SB]
          Length = 130

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 5/79 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS-----AFGSSSNFTSVRSTAHSLGRFTAILAF 55
          M I + ++H++    LV V+L+Q+   +       GSS            LG+ T  +A 
Sbjct: 1  MHILINILHILSCFVLVLVVLLQAGKGANMGAAFGGSSQTVFGSSGAGTFLGKMTTAVAI 60

Query: 56 FFFATSIALGMISRYTSTR 74
           F  TS++L   S   ++ 
Sbjct: 61 VFMLTSLSLSYTSVNKTSS 79


>gi|21113692|gb|AAM41802.1| protein-export membrane protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573244|gb|AAY48654.1| protein-export membrane protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 146

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/104 (15%), Positives = 37/104 (35%), Gaps = 6/104 (5%)

Query: 16  LVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFFFATSIALGMISR 69
           ++ +IL+Q    +A GS             +  ++ L + T  LA  FF+ S+ +   + 
Sbjct: 1   MIALILMQRGAGAAAGSGFGAGASGTVFGSQGASNFLSKSTKWLAVVFFSISLFMAWYAT 60

Query: 70  YTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
           + +     N+      +              P+  +  A  ++ 
Sbjct: 61  HGARPTDQNLGVMSQSATPAPAAAGELTQPLPQAPAAGAVPTAP 104


>gi|315633855|ref|ZP_07889144.1| preprotein translocase subunit SecG [Aggregatibacter segnis ATCC
           33393]
 gi|315477105|gb|EFU67848.1| preprotein translocase subunit SecG [Aggregatibacter segnis ATCC
           33393]
          Length = 116

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 42/104 (40%), Gaps = 6/104 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M   L++++L+V + L+  IL+Q    +  G+S                + L R TA+LA
Sbjct: 1   MYSALLIIYLVVSIALIAFILLQQGKGADAGASFGGGASGTVFGSAGAGNFLSRTTAVLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
             FF  SI +G I+ + +   +         + + Q        
Sbjct: 61  IIFFVISIVIGNINSHKNNAKQGAFDDLSGTAEQIQQQQQKAPA 104


>gi|253575492|ref|ZP_04852829.1| preprotein translocase, SecG subunit [Paenibacillus sp. oral
          taxon 786 str. D14]
 gi|251845139|gb|EES73150.1| preprotein translocase, SecG subunit [Paenibacillus sp. oral
          taxon 786 str. D14]
          Length = 77

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF--------TSVRSTAHSLGRFTAI 52
          M I L V+ +I  +GL+ V+L+Q   S+    + +         T  R     L R T  
Sbjct: 1  MDILLKVLLVIFSIGLIAVVLLQKGKSAGLSGAISGGAEHLFGKTKARGMELVLERVTVG 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  SI + ++
Sbjct: 61 LAVGFFILSIIVAIV 75


>gi|319650508|ref|ZP_08004648.1| preprotein translocase [Bacillus sp. 2_A_57_CT2]
 gi|317397689|gb|EFV78387.1| preprotein translocase [Bacillus sp. 2_A_57_CT2]
          Length = 77

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L+ + +IV +GL+ V+L+QS  S+    + +  +         R     L R T +
Sbjct: 1  MHTLLITLLVIVSIGLIVVVLLQSGKSAGLSGAISGGAEQLFGKQKARGIDLILHRITIV 60

Query: 53 LAFFFFATSIALGMIS 68
          L+  FF  ++ +   +
Sbjct: 61 LSVLFFILTVLVSYFA 76


>gi|89900285|ref|YP_522756.1| preprotein translocase subunit SecG [Rhodoferax ferrireducens
          T118]
 gi|89345022|gb|ABD69225.1| protein translocase subunit secG [Rhodoferax ferrireducens T118]
          Length = 117

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 35/85 (41%), Gaps = 6/85 (7%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAFF 56
            L+ V +I  V +V +IL+Q    +  G++       S       A+ L R TA+LA  
Sbjct: 6  TILLAVQMISAVAMVGLILVQHGKGADMGAAFGSGGSGSLFGASGSANFLSRTTAVLATV 65

Query: 57 FFATSIALGMISRYTSTRYKDNMHR 81
          FF  ++ L        T    ++  
Sbjct: 66 FFVCTLLLAYFGTARPTVSSGSVLE 90


>gi|322379721|ref|ZP_08054034.1| preprotein translocase subunit SecG [Helicobacter suis HS5]
 gi|321147870|gb|EFX42457.1| preprotein translocase subunit SecG [Helicobacter suis HS5]
          Length = 120

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/118 (19%), Positives = 39/118 (33%), Gaps = 16/118 (13%)

Query: 21  LIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYK 76
           L+Q S      +  GS+ +    +  A  L + T  L F F + +IALG           
Sbjct: 2   LLQKSSSIGLGAYSGSNESLFGAKGPASFLAKLTMFLGFLFLSNTIALGYFYNKEYN--I 59

Query: 77  DNMHRSLVDSIKDQGNDNF----------GDGSSPKLDSVSAKSSSSVVAGKRSSSRT 124
             + R+  +S+                       P    V  KS   + A  ++  +T
Sbjct: 60  SVLDRAPKNSLSPAPLVPQNPNSNPLNNPLLTPPPAGPLVPKKSEGLMPAPSQTPPKT 117


>gi|296113983|ref|YP_003627921.1| protein translocase subunit SecG [Moraxella catarrhalis RH4]
 gi|295921677|gb|ADG62028.1| protein translocase subunit SecG [Moraxella catarrhalis RH4]
 gi|326559305|gb|EGE09732.1| preprotein translocase subunit SecG [Moraxella catarrhalis 7169]
 gi|326564319|gb|EGE14549.1| preprotein translocase subunit SecG [Moraxella catarrhalis
          103P14B1]
 gi|326565084|gb|EGE15277.1| preprotein translocase subunit SecG [Moraxella catarrhalis
          46P47B1]
 gi|326567252|gb|EGE17372.1| preprotein translocase subunit SecG [Moraxella catarrhalis
          12P80B1]
 gi|326568242|gb|EGE18324.1| preprotein translocase subunit SecG [Moraxella catarrhalis BC8]
 gi|326569943|gb|EGE19990.1| preprotein translocase subunit SecG [Moraxella catarrhalis BC1]
 gi|326570021|gb|EGE20067.1| preprotein translocase subunit SecG [Moraxella catarrhalis BC7]
 gi|326572879|gb|EGE22864.1| preprotein translocase subunit SecG [Moraxella catarrhalis CO72]
 gi|326573673|gb|EGE23631.1| preprotein translocase subunit SecG [Moraxella catarrhalis O35E]
 gi|326574704|gb|EGE24640.1| preprotein translocase subunit SecG [Moraxella catarrhalis
          101P30B1]
          Length = 100

 Score = 52.7 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 6/98 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+ +H+I+ + +V  ILIQ    +        G++        +A+ L R TA+LA
Sbjct: 1  MLTILLAIHIIIAIVMVGFILIQHGKGADAGASFGSGAAGTVFGAAGSANFLTRTTAVLA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
            FFATS+AL   ++  +         ++V    +   
Sbjct: 61 TIFFATSLALAHFAQKQAEDQLRLDVPAVVSETPNTPP 98


>gi|304391670|ref|ZP_07373612.1| preprotein translocase subunit SecG [Ahrensia sp. R2A130]
 gi|303295899|gb|EFL90257.1| preprotein translocase subunit SecG [Ahrensia sp. R2A130]
          Length = 132

 Score = 52.7 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 7/128 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
           M   L+VVH+++V+ L+ ++L+Q S+  A G          F S R  A +L + T I+A
Sbjct: 1   MTTVLIVVHIMLVLALIVLVLLQKSEGGALGIGGGGGGGGGFISARGAADALTKTTTIVA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
             FFATS+ALG+++     R +D + +          +       +   D+    +    
Sbjct: 61  AGFFATSVALGVVANRD-NRTEDILRQVETAPTGVPTDSGTATPPANVPDAGGLLNDLEN 119

Query: 115 VAGKRSSS 122
           +   + S+
Sbjct: 120 LGTPQPST 127


>gi|254440645|ref|ZP_05054138.1| preprotein translocase, SecG subunit, putative [Octadecabacter
           antarcticus 307]
 gi|198250723|gb|EDY75038.1| preprotein translocase, SecG subunit, putative [Octadecabacter
           antarcticus 307]
          Length = 122

 Score = 52.7 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 55/122 (45%), Gaps = 4/122 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFF 56
           M+  ++VVHL++ + L+ V+L+Q S+    G          S RS A +LG+ T +LA  
Sbjct: 1   MENVVLVVHLLLALTLIGVVLLQRSEGGGLGIGGGGGGGAMSSRSAATALGKVTWVLAVA 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           F  TS+AL ++S   ++        +L+ S +   +   G GS        +     V  
Sbjct: 61  FICTSLALTILSAQKASDASVVGGDALLPSSEQSSDAPSGAGSLLPPVVTPSSDEPLVPD 120

Query: 117 GK 118
             
Sbjct: 121 AD 122


>gi|121609763|ref|YP_997570.1| preprotein translocase subunit SecG [Verminephrobacter eiseniae
          EF01-2]
 gi|121554403|gb|ABM58552.1| protein translocase subunit secG [Verminephrobacter eiseniae
          EF01-2]
          Length = 120

 Score = 52.7 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 35/84 (41%), Gaps = 6/84 (7%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAFF 56
            ++VV ++  + ++ +ILIQ    +  G++    S  S       A+ L R TA+LA  
Sbjct: 6  NLILVVQMLAALVMIVLILIQHGKGADMGAAFGSGSSGSLFGASGSANFLSRTTAVLASV 65

Query: 57 FFATSIALGMISRYTSTRYKDNMH 80
          F   ++AL              + 
Sbjct: 66 FLLATLALAHFGNSRPAGAGSVLE 89


>gi|194468186|ref|ZP_03074172.1| preprotein translocase, SecG subunit [Lactobacillus reuteri
          100-23]
 gi|194453039|gb|EDX41937.1| preprotein translocase, SecG subunit [Lactobacillus reuteri
          100-23]
          Length = 79

 Score = 52.7 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 34/79 (43%), Gaps = 9/79 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHS---LGRFTA 51
          M   LM + LI  V L+  +++Q +       S+  G + +  S R        +   T 
Sbjct: 1  MYNTLMTLFLIDCVVLIACVMMQPAKNDNDAMSALTGGAGDLFSRRKARGFEAVMQIVTT 60

Query: 52 ILAFFFFATSIALGMISRY 70
          I   FFF  ++A+  +S +
Sbjct: 61 ICGAFFFILALAMIYVSSH 79


>gi|163942815|ref|YP_001647699.1| preprotein translocase subunit SecG [Bacillus weihenstephanensis
          KBAB4]
 gi|229014288|ref|ZP_04171407.1| preprotein translocase subunit SecG [Bacillus mycoides DSM 2048]
 gi|229062772|ref|ZP_04200077.1| preprotein translocase subunit SecG [Bacillus cereus AH603]
 gi|229135931|ref|ZP_04264693.1| preprotein translocase subunit SecG [Bacillus cereus BDRD-ST196]
 gi|229169832|ref|ZP_04297528.1| preprotein translocase subunit SecG [Bacillus cereus AH621]
 gi|163865012|gb|ABY46071.1| preprotein translocase, SecG subunit [Bacillus weihenstephanensis
          KBAB4]
 gi|228613546|gb|EEK70675.1| preprotein translocase subunit SecG [Bacillus cereus AH621]
 gi|228647544|gb|EEL03617.1| preprotein translocase subunit SecG [Bacillus cereus BDRD-ST196]
 gi|228716532|gb|EEL68235.1| preprotein translocase subunit SecG [Bacillus cereus AH603]
 gi|228746888|gb|EEL96772.1| preprotein translocase subunit SecG [Bacillus mycoides DSM 2048]
          Length = 77

 Score = 52.7 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L V+ +IV + ++ ++L+QSS+SS    + +  +         R     L R T +
Sbjct: 1  MHTLLSVLLIIVSILMIVMVLMQSSNSSGLSGAISGGAEQLFGKQKARGIEAVLNRVTVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +I +  +
Sbjct: 61 LAVLFFVLTIGVTYL 75


>gi|57237295|ref|YP_178308.1| preprotein translocase subunit SecG [Campylobacter jejuni RM1221]
 gi|86151457|ref|ZP_01069672.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|148926383|ref|ZP_01810067.1| putative protein-export membrane protein [Campylobacter jejuni
           subsp. jejuni CG8486]
 gi|205356535|ref|ZP_03223298.1| putative protein export membrane protein [Campylobacter jejuni
           subsp. jejuni CG8421]
 gi|315123822|ref|YP_004065826.1| protein-export membrane protein [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|57166099|gb|AAW34878.1| preprotein translocase, SecG subunit [Campylobacter jejuni RM1221]
 gi|85841804|gb|EAQ59051.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|145844775|gb|EDK21880.1| putative protein-export membrane protein [Campylobacter jejuni
           subsp. jejuni CG8486]
 gi|205345540|gb|EDZ32180.1| putative protein export membrane protein [Campylobacter jejuni
           subsp. jejuni CG8421]
 gi|315017544|gb|ADT65637.1| protein-export membrane protein [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|315057665|gb|ADT71994.1| Preprotein translocase subunit SecG [Campylobacter jejuni subsp.
           jejuni S3]
          Length = 123

 Score = 52.7 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 52/125 (41%), Gaps = 7/125 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L+++  I+VV +   +L+Q S      +  GS+ +    +  A  L +FT ++   
Sbjct: 1   MITLLIILQFIIVVVICIAVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFVMGIL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
             A +I LG +  Y          +  V++            ++P  +S+ A S+  + +
Sbjct: 61  LIANTIGLGYL--YNKASKDSLAEKIKVENNNTTIPSAPIVPATPNTNSI-APSAPQLPS 117

Query: 117 GKRSS 121
              SS
Sbjct: 118 DVNSS 122


>gi|300770380|ref|ZP_07080259.1| preprotein translocase subunit SecG [Sphingobacterium
          spiritivorum ATCC 33861]
 gi|300762856|gb|EFK59673.1| preprotein translocase subunit SecG [Sphingobacterium
          spiritivorum ATCC 33861]
          Length = 123

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 35/96 (36%), Gaps = 4/96 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS----NFTSVRSTAHSLGRFTAILAFF 56
          MQ  L+V+ ++  V L  ++LIQ+       S      N   V+ T   L + T  L   
Sbjct: 1  MQTLLIVLIILTSVLLALMVLIQNPKGGGLSSGFSGGSNLMGVKRTGDFLEKGTWTLVIA 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
               +A+ ++                +++   QG 
Sbjct: 61 LMVFCLAVNILGPSKGGAASKGGLSDQIEAPAQQGP 96


>gi|227538851|ref|ZP_03968900.1| preprotein translocase subunit SecG [Sphingobacterium
          spiritivorum ATCC 33300]
 gi|227241360|gb|EEI91375.1| preprotein translocase subunit SecG [Sphingobacterium
          spiritivorum ATCC 33300]
          Length = 119

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 35/96 (36%), Gaps = 4/96 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS----NFTSVRSTAHSLGRFTAILAFF 56
          MQ  L+V+ ++  V L  ++LIQ+       S      N   V+ T   L + T  L   
Sbjct: 1  MQTLLIVLIILTSVLLALMVLIQNPKGGGLSSGFSGGSNLMGVKRTGDFLEKGTWTLVIA 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
               +A+ ++                +++   QG 
Sbjct: 61 LMVFCLAVNILGPSKGGAASKGGLSDQIEAPAQQGP 96


>gi|46199727|ref|YP_005394.1| preprotein translocase subunit SecG [Thermus thermophilus HB27]
 gi|55981753|ref|YP_145050.1| preprotein translocase subunit SecG [Thermus thermophilus HB8]
 gi|46197353|gb|AAS81767.1| hypothetical protein TT_C1425 [Thermus thermophilus HB27]
 gi|55773166|dbj|BAD71607.1| putative preprotein translocase, SecG subunit [Thermus thermophilus
           HB8]
          Length = 117

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 3/69 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQ---SSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           +   +++ +L V   LV ++L+Q          G S++  S R     L R T IL   F
Sbjct: 46  LYTLVILFYLGVAGLLVYLVLVQEPKQGAGDLMGGSADLFSARGVTGGLYRLTVILGVVF 105

Query: 58  FATSIALGM 66
            A ++ +G+
Sbjct: 106 AALALVIGL 114


>gi|209885422|ref|YP_002289279.1| preprotein translocase SecG subunit [Oligotropha carboxidovorans
          OM5]
 gi|209873618|gb|ACI93414.1| preprotein translocase SecG subunit [Oligotropha carboxidovorans
          OM5]
          Length = 122

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 45/99 (45%), Gaps = 7/99 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M   ++++HLI+V+ L  V+L+Q S+    G          F S R T + L R TAIL 
Sbjct: 1  MHTVIIIIHLIIVIALTGVVLVQRSEGGGLGIGGGGGGAGGFMSSRGTTNLLTRTTAILG 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
            FF TS+ L  ++ Y     +  ++ +          +
Sbjct: 61 TAFFITSLILSWLAGYE-QAPRSLINTTPATQSGQAAPE 98


>gi|86149692|ref|ZP_01067922.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|86153675|ref|ZP_01071878.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|88597303|ref|ZP_01100538.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|121613335|ref|YP_999948.1| preprotein translocase subunit SecG [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|157414533|ref|YP_001481789.1| preprotein translocase subunit SecG [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|167004905|ref|ZP_02270663.1| protein-export membrane protein secG [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|218561899|ref|YP_002343678.1| preprotein translocase subunit SecG [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|85839960|gb|EAQ57219.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|85842636|gb|EAQ59848.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|87250080|gb|EAQ73038.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|88190364|gb|EAQ94338.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112359605|emb|CAL34390.1| putative protein-export membrane protein [Campylobacter jejuni
           subsp. jejuni NCTC 11168]
 gi|157385497|gb|ABV51812.1| protein-export membrane protein secG [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|284925511|gb|ADC27863.1| preprotein translocase subunit SecG [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|307747175|gb|ADN90445.1| Preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
           jejuni M1]
 gi|315928163|gb|EFV07481.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
           jejuni DFVF1099]
 gi|315930895|gb|EFV09880.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
           jejuni 305]
 gi|315932034|gb|EFV10987.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 123

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 52/125 (41%), Gaps = 7/125 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L+++  I+VV +   +L+Q S      +  GS+ +    +  A  L +FT ++   
Sbjct: 1   MITLLIILQFIIVVVICIAVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFVMGIL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
             A +I LG +  Y          +  V++            ++P  +S+ A S+  + +
Sbjct: 61  LIANTIGLGYL--YNKASKDSLAEKIKVENNNTTIPSAPIVPTTPNTNSI-APSAPQLPS 117

Query: 117 GKRSS 121
              SS
Sbjct: 118 DVNSS 122


>gi|260588163|ref|ZP_05854076.1| preprotein translocase, SecG subunit [Blautia hansenii DSM 20583]
 gi|331082271|ref|ZP_08331398.1| preprotein translocase [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260541690|gb|EEX22259.1| preprotein translocase, SecG subunit [Blautia hansenii DSM 20583]
 gi|330403065|gb|EGG82630.1| preprotein translocase [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 78

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 7/67 (10%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF-------TSVRSTAHSLGRFTAILAFFF 57
          L V+ +I  + L  +IL+Q   S   GS S            RS   +L + T IL   F
Sbjct: 8  LTVLFIIDCIALSVIILMQEGKSQGLGSLSGMSETYWGKNKGRSMEGTLVKVTRILGVLF 67

Query: 58 FATSIAL 64
          F  ++ L
Sbjct: 68 FVLALVL 74


>gi|210621901|ref|ZP_03292898.1| hypothetical protein CLOHIR_00843 [Clostridium hiranonis DSM
          13275]
 gi|210154532|gb|EEA85538.1| hypothetical protein CLOHIR_00843 [Clostridium hiranonis DSM
          13275]
          Length = 74

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA-----FGSSSNFTSVRSTAHSLGRFTAILAF 55
          M   LM + + + + L+ VI+ Q + ++         +  +   +     L + T +++ 
Sbjct: 1  MVNVLMALQVALGIALIIVIMPQENKTAMPSQYGAEGNQTYFKPKGKQAFLNKVTKVVSV 60

Query: 56 FFFATSIALGMISR 69
           FF  ++AL ++++
Sbjct: 61 LFFLNALALIIVTK 74


>gi|260911591|ref|ZP_05918176.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260634297|gb|EEX52402.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 123

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 38/119 (31%), Gaps = 6/119 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFFF 57
               +V+ +I  + ++ ++LIQ S      S  +       VR T   + + T  LA   
Sbjct: 3   YSLFVVLIVIAALLMIAIVLIQESKGGGLSSQFSSSNSIMGVRKTTDVVEKATWGLAIAM 62

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN--FGDGSSPKLDSVSAKSSSSV 114
              S+    ++  + T      + +      +                 S  A + + V
Sbjct: 63  VVFSVVCAYVAPKSVTDTSVLENAATETQTTNPNTTPGFGAGSQGTATPSTPAPTKAPV 121


>gi|29840074|ref|NP_829180.1| preprotein translocase subunit SecG [Chlamydophila caviae GPIC]
 gi|29834422|gb|AAP05058.1| preprotein translocase, SecG subunit [Chlamydophila caviae GPIC]
          Length = 104

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 39/92 (42%), Gaps = 5/92 (5%)

Query: 5  LMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS-----TAHSLGRFTAILAFFFFA 59
           + + L++ V L  +ILIQ S S   GSS    S  S     T   L R TA LA  F  
Sbjct: 8  FLFIFLLLCVILCGLILIQESKSMGLGSSFGVDSGDSVFGVSTPDILKRVTAWLAVAFCC 67

Query: 60 TSIALGMISRYTSTRYKDNMHRSLVDSIKDQG 91
          + + L   + +   + ++   ++L     D  
Sbjct: 68 SCLLLSFATTHLGKKAQELPTKALEQVAPDGE 99


>gi|304407263|ref|ZP_07388916.1| preprotein translocase, SecG subunit [Paenibacillus
          curdlanolyticus YK9]
 gi|304343704|gb|EFM09545.1| preprotein translocase, SecG subunit [Paenibacillus
          curdlanolyticus YK9]
          Length = 78

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 31/78 (39%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M I   ++ +I  +GL+ V+L+Q   S+    + +  +         R     L R T  
Sbjct: 1  MDILFKILLIIAALGLISVVLLQKGKSAGLSGAISGGAEHLFGKQKARGLDLFLQRLTIG 60

Query: 53 LAFFFFATSIALGMISRY 70
           A  FF  ++ +    + 
Sbjct: 61 FAASFFILALVVSYFVKN 78


>gi|282858864|ref|ZP_06268008.1| preprotein translocase, SecG subunit [Prevotella bivia JCVIHMP010]
 gi|282588370|gb|EFB93531.1| preprotein translocase, SecG subunit [Prevotella bivia JCVIHMP010]
          Length = 106

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 38/103 (36%), Gaps = 9/103 (8%)

Query: 16  LVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYT 71
           ++ ++LIQ S        F SS+    VR T   + + T +LA      SIA   ++   
Sbjct: 1   MIGIVLIQESKGGGLSSNFSSSNAIMGVRKTTDFVEKTTWVLAATMVVISIACAHVAPTG 60

Query: 72  STRYKDNMHRSLVDSIKDQGNDN-----FGDGSSPKLDSVSAK 109
           +T      + +  D   +  N           ++P   +  A 
Sbjct: 61  NTDASVIENATSGDQSTNPNNLPNFGASQQKQAAPVKPTAPAP 103


>gi|310639662|ref|YP_003944420.1| preprotein translocase, secg subunit [Paenibacillus polymyxa SC2]
 gi|309244612|gb|ADO54179.1| Preprotein translocase, SecG subunit [Paenibacillus polymyxa SC2]
          Length = 77

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 35/77 (45%), Gaps = 8/77 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF--------TSVRSTAHSLGRFTAI 52
          M+IFL V+ ++  + ++ V+L+Q   S+    + +         T  R     L R TA+
Sbjct: 1  MEIFLKVLLVVFSIAVIAVVLLQKGKSAGLSGAISGGAEHLFGKTKARGMDLILQRVTAV 60

Query: 53 LAFFFFATSIALGMISR 69
          L   F   S+ +   ++
Sbjct: 61 LGACFMIVSVLVAFFAK 77


>gi|114569957|ref|YP_756637.1| protein translocase subunit SecG [Maricaulis maris MCS10]
 gi|114340419|gb|ABI65699.1| protein translocase subunit secG [Maricaulis maris MCS10]
          Length = 112

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/107 (25%), Positives = 41/107 (38%), Gaps = 5/107 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS-----TAHSLGRFTAILAF 55
           M   L+++ L+V +GL+ VIL+Q S+  A G                A+ L R T IL  
Sbjct: 5   MTTVLLIIQLLVALGLIGVILLQRSEGGALGIGGGGGGGGMMSGRGAANILTRTTMILGA 64

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
            F   SI L +++  T+             +I     D  G      
Sbjct: 65  VFIGNSILLAIVTGVTAEGTSVFDTEIDNPAIGVIEQDESGAPVPTD 111


>gi|17982794|gb|AAL52028.1| hypothetical protein BMEI0847 [Brucella melitensis bv. 1 str. 16M]
          Length = 129

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 34/104 (32%), Positives = 49/104 (47%), Gaps = 12/104 (11%)

Query: 21  LIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDN 78
           LIQ S+    G      F + R  A++L R TAILA  FFATS+ LG+++RY   R  D 
Sbjct: 2   LIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFFATSLLLGIMARY-GERPTDI 60

Query: 79  MHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSS 122
           ++R    +         G  S+P   S +       + G+ S S
Sbjct: 61  LNRIPATT---------GSQSAPAGGSTNGGGILDQLGGEPSGS 95


>gi|85703176|ref|ZP_01034280.1| preprotein translocase, SecG subunit [Roseovarius sp. 217]
 gi|85672104|gb|EAQ26961.1| preprotein translocase, SecG subunit [Roseovarius sp. 217]
          Length = 120

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 47/121 (38%), Gaps = 4/121 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA---HSLGRFTAILAFFF 57
           M+  ++ +HL++ + L+ V+L+Q S+    G         +      +LG+ T ILA  F
Sbjct: 1   MENVVLTIHLLLALALIGVVLLQRSEGGGLGMGGGGGGAMTGRAAATALGKMTWILAASF 60

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
             TSI L +I+   +      + R        + +      +   L   S  ++      
Sbjct: 61  IVTSITLTIIAAQNAAGV-SVLDRLTDSPPTTEQSVPALPDADSLLPPPSGDTAPLTPTA 119

Query: 118 K 118
            
Sbjct: 120 D 120


>gi|212640320|ref|YP_002316840.1| preprotein translocase subunit SecG [Anoxybacillus flavithermus
          WK1]
 gi|212561800|gb|ACJ34855.1| Preprotein translocase subunit SecG [Anoxybacillus flavithermus
          WK1]
          Length = 82

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L+ + +IV +G++ V+L+QS  S+    +    +         R     L R T +
Sbjct: 6  MHALLVTLLVIVSLGMIVVVLLQSGRSAGLSGAITGGAEQLFGKQKARGIDAVLHRITVV 65

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +IA+   
Sbjct: 66 LAVLFFVLAIAVTYF 80


>gi|311069886|ref|YP_003974809.1| preprotein translocase subunit SecG [Bacillus atrophaeus 1942]
 gi|310870403|gb|ADP33878.1| preprotein translocase subunit SecG [Bacillus atrophaeus 1942]
          Length = 76

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L+ + +IV + L+ V+L+QSS S+    + +  +         R     L R T +
Sbjct: 1  MHAVLITLLVIVSIALIIVVLLQSSKSAGLSGAISGGAEQLFGKQKARGLDLILHRITVV 60

Query: 53 LAFFFFATSIALGMI 67
          L+  FF  +I+L  I
Sbjct: 61 LSALFFVLTISLAYI 75


>gi|118603035|ref|YP_904250.1| protein translocase subunit secG [Candidatus Ruthia magnifica str.
           Cm (Calyptogena magnifica)]
 gi|118567974|gb|ABL02779.1| protein translocase subunit secG [Candidatus Ruthia magnifica str.
           Cm (Calyptogena magnifica)]
          Length = 121

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 50/120 (41%), Gaps = 8/120 (6%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILAF 55
              ++VVH+++ +GL+ +ILIQ    +  G+      S +    R     L + T  LAF
Sbjct: 3   FQLILVVHILLALGLIALILIQHGKGADAGTAFGAGTSGSVFGARGANSFLYKLTTSLAF 62

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115
            FF TS+ L  ++   S+   +    S+++ +         D        ++    S + 
Sbjct: 63  GFFLTSLTLAYLATNDSSVNNEL--TSVMERVTTIEGAVPSDVPMVVTPILTESDISDIS 120


>gi|255067210|ref|ZP_05319065.1| preprotein translocase, SecG subunit [Neisseria sicca ATCC 29256]
 gi|255048578|gb|EET44042.1| preprotein translocase, SecG subunit [Neisseria sicca ATCC 29256]
          Length = 120

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/106 (21%), Positives = 43/106 (40%), Gaps = 9/106 (8%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA--------FGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + +V ++L+Q    +          GS+         A+ L R TAI 
Sbjct: 5   KTLIWIINIISALSVVVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRATAIA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
           A FFFAT +A+  I  +T+    D            +      + S
Sbjct: 65  ATFFFATCMAMVYIHTHTNKHGLD-FSNVKQTQQAPKPAAPAENQS 109


>gi|262196453|ref|YP_003267662.1| preprotein translocase, SecG subunit [Haliangium ochraceum DSM
           14365]
 gi|262079800|gb|ACY15769.1| preprotein translocase, SecG subunit [Haliangium ochraceum DSM
           14365]
          Length = 215

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/135 (16%), Positives = 43/135 (31%), Gaps = 10/135 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLG--------RFTAI 52
           M   + ++H+ V + L+  +L+QS      G++             G        + TA+
Sbjct: 1   MSTLVTIIHVAVCIFLMVTVLLQSGKGGGMGAAFGGGGGGGQTVFGGAGAGGLLRKLTAV 60

Query: 53  LAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA--KS 110
            A  F  TSI L  +S  T             +  + +   +        +D   A    
Sbjct: 61  CAATFMLTSITLAYLSSNTGADALKQYAEQQRELREQREKISQDALLQNPVDGEDAVEPP 120

Query: 111 SSSVVAGKRSSSRTK 125
           +  +  G       +
Sbjct: 121 TFELPEGTEGEDDAE 135


>gi|103486659|ref|YP_616220.1| preprotein translocase, SecG subunit [Sphingopyxis alaskensis
           RB2256]
 gi|98976736|gb|ABF52887.1| protein translocase subunit secG [Sphingopyxis alaskensis RB2256]
          Length = 154

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 5/113 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG---SSSNFTSVRSTAHSLGRFTAILAFFF 57
           +  FL+VV  +V   ++ VIL+Q S+    G   S +   S R  A  + R T +LA  F
Sbjct: 5   LFTFLLVVQALVAAAMIGVILMQKSEGGGLGVGGSPAGLLSARGAADFMTRATTVLACLF 64

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
              SI L  ++     R    +  SL  S +  G  +    ++P   +    +
Sbjct: 65  VGLSILLAAMAS--VGRGGSTIDTSLSKSAQTSGGASTSSITAPAQPAEGVAT 115


>gi|206970468|ref|ZP_03231421.1| preprotein translocase, SecG subunit [Bacillus cereus AH1134]
 gi|218231699|ref|YP_002369902.1| preprotein translocase subunit SecG [Bacillus cereus B4264]
 gi|228955360|ref|ZP_04117366.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar kurstaki str. T03a001]
 gi|228961352|ref|ZP_04122967.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar pakistani str. T13001]
 gi|229049784|ref|ZP_04194341.1| protein-export membrane protein secG [Bacillus cereus AH676]
 gi|229072578|ref|ZP_04205780.1| protein-export membrane protein secG [Bacillus cereus F65185]
 gi|229082337|ref|ZP_04214800.1| protein-export membrane protein secG [Bacillus cereus Rock4-2]
 gi|229112539|ref|ZP_04242076.1| protein-export membrane protein secG [Bacillus cereus Rock1-15]
 gi|229130376|ref|ZP_04259334.1| protein-export membrane protein secG [Bacillus cereus BDRD-Cer4]
 gi|229147657|ref|ZP_04276000.1| protein-export membrane protein secG [Bacillus cereus BDRD-ST24]
 gi|229153281|ref|ZP_04281459.1| protein-export membrane protein secG [Bacillus cereus m1550]
 gi|229175794|ref|ZP_04303300.1| protein-export membrane protein secG [Bacillus cereus MM3]
 gi|229181386|ref|ZP_04308714.1| protein-export membrane protein secG [Bacillus cereus 172560W]
 gi|229193873|ref|ZP_04320796.1| protein-export membrane protein secG [Bacillus cereus ATCC 10876]
 gi|206735045|gb|EDZ52214.1| preprotein translocase, SecG subunit [Bacillus cereus AH1134]
 gi|218159656|gb|ACK59648.1| preprotein translocase, SecG subunit [Bacillus cereus B4264]
 gi|228589611|gb|EEK47507.1| protein-export membrane protein secG [Bacillus cereus ATCC 10876]
 gi|228601961|gb|EEK59454.1| protein-export membrane protein secG [Bacillus cereus 172560W]
 gi|228607745|gb|EEK65061.1| protein-export membrane protein secG [Bacillus cereus MM3]
 gi|228629885|gb|EEK86536.1| protein-export membrane protein secG [Bacillus cereus m1550]
 gi|228635670|gb|EEK92157.1| protein-export membrane protein secG [Bacillus cereus BDRD-ST24]
 gi|228653075|gb|EEL08955.1| protein-export membrane protein secG [Bacillus cereus BDRD-Cer4]
 gi|228670919|gb|EEL26226.1| protein-export membrane protein secG [Bacillus cereus Rock1-15]
 gi|228700769|gb|EEL53292.1| protein-export membrane protein secG [Bacillus cereus Rock4-2]
 gi|228710554|gb|EEL62527.1| protein-export membrane protein secG [Bacillus cereus F65185]
 gi|228722697|gb|EEL74085.1| protein-export membrane protein secG [Bacillus cereus AH676]
 gi|228798310|gb|EEM45308.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar pakistani str. T13001]
 gi|228804307|gb|EEM50920.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar kurstaki str. T03a001]
          Length = 77

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 32/75 (42%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSS-----DSSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M   L V+ +IV + ++ ++L+QSS       +  G +         R     L R T +
Sbjct: 1  MHTLLSVLLIIVSILMIVMVLMQSSNSSGLSGAISGGAEQLFGKQKARGIEAVLNRITIV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +I +   
Sbjct: 61 LAVLFFVLTIGVTYF 75


>gi|153951054|ref|YP_001397464.1| preprotein translocase subunit SecG [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152938500|gb|ABS43241.1| preprotein translocase, SecG subunit [Campylobacter jejuni subsp.
           doylei 269.97]
          Length = 122

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/120 (17%), Positives = 45/120 (37%), Gaps = 8/120 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L+++  I+VV +   +L+Q S      +  GS+ +    +  A  L +FT ++   
Sbjct: 1   MITLLIILQFIIVVVICIAVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFVMGIL 60

Query: 57  FFATSIALGMISRYTSTRYKD----NMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             A +I L  +    S           + + + S          +  +P    + +  +S
Sbjct: 61  LIANTIGLSYLYNKASKDSLAEKIKVENNTTIPSAPIIPTTPNTNSVAPSAPQLPSDINS 120


>gi|87200034|ref|YP_497291.1| protein translocase subunit secG [Novosphingobium aromaticivorans
          DSM 12444]
 gi|87135715|gb|ABD26457.1| protein translocase subunit secG [Novosphingobium aromaticivorans
          DSM 12444]
          Length = 131

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 38/76 (50%), Gaps = 3/76 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
          + IFL VV  I+   LV VIL+Q S+       GS + F S R  A  + R T +LA  F
Sbjct: 3  LFIFLTVVQAIIAALLVVVILMQKSEGGGLGVGGSPAGFMSARGAADFMTRATTVLASLF 62

Query: 58 FATSIALGMISRYTST 73
             SI L  ++   ++
Sbjct: 63 VLLSIILAALAVGATS 78


>gi|261364896|ref|ZP_05977779.1| preprotein translocase, SecG subunit [Neisseria mucosa ATCC 25996]
 gi|288566945|gb|EFC88505.1| preprotein translocase, SecG subunit [Neisseria mucosa ATCC 25996]
          Length = 120

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/102 (21%), Positives = 41/102 (40%), Gaps = 9/102 (8%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSA--------FGSSSNFTSVRSTAHSLGRFTAIL 53
           +  + ++++I  + +V ++L+Q    +          GS+         A+ L R TAI 
Sbjct: 5   KTLIWIINIISALSVVVLVLLQHGKGADAGATFGSGSGSAQGVFGSAGNANFLSRATAIA 64

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF 95
           A FFFAT +A+  I  +T+    D            +     
Sbjct: 65  ATFFFATCMAMVYIHTHTNKHGLD-FSNVQQTQQAPKPATPA 105


>gi|120556258|ref|YP_960609.1| preprotein translocase subunit SecG [Marinobacter aquaeolei VT8]
 gi|120326107|gb|ABM20422.1| protein translocase subunit secG [Marinobacter aquaeolei VT8]
          Length = 127

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/102 (17%), Positives = 38/102 (37%), Gaps = 10/102 (9%)

Query: 18  CVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYT 71
            ++LIQ    +  G++            + +   L R T  +A  FF TS +L + ++  
Sbjct: 21  GLVLIQQGKGADAGAAFGGGASQTVFGSQGSGSFLTRMTTFMAVIFFVTSFSLAIFAKQR 80

Query: 72  STRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSS 113
           +         + +  +++          +P  D  +A S S 
Sbjct: 81  AEVAG----EAGIPVVQESSQVGAQAEQAPSADEPAANSESE 118


>gi|212550420|ref|YP_002308737.1| putative preprotein translocase SecG subunit [Candidatus
           Azobacteroides pseudotrichonymphae genomovar. CFP2]
 gi|212548658|dbj|BAG83326.1| putative preprotein translocase SecG subunit [Candidatus
           Azobacteroides pseudotrichonymphae genomovar. CFP2]
          Length = 109

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 33/87 (37%), Gaps = 4/87 (4%)

Query: 19  VILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTR 74
           V+++Q+S        F S++    VR T     + T  LA  F    I   +I  + S  
Sbjct: 19  VVVVQNSKGGGLASGFTSANQVMGVRKTTDLFEKITWWLAGSFIVLCILASVIMSHQSPL 78

Query: 75  YKDNMHRSLVDSIKDQGNDNFGDGSSP 101
               +   ++++I  Q   N      P
Sbjct: 79  EDSIIKEDILETIPQQQEQNENVLPIP 105


>gi|194333655|ref|YP_002015515.1| preprotein translocase subunit SecG [Prosthecochloris aestuarii DSM
           271]
 gi|194311473|gb|ACF45868.1| preprotein translocase, SecG subunit [Prosthecochloris aestuarii
           DSM 271]
          Length = 118

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 41/117 (35%), Gaps = 10/117 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-------NFTSVRSTAHSLGRFTAIL 53
           M +FL+++ L+  + L+ VIL+Q+    +  +S            VR T   L + TAIL
Sbjct: 1   MHLFLVILTLLASLVLIAVILLQNPKGGSGLTSGMSSLGTVQTLGVRRTGDFLTKLTAIL 60

Query: 54  AFFFFATSIALGMISRYTSTRYK---DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
           A      S          +         + + L  +         G     +L   S
Sbjct: 61  AGAVMVLSFIAQFTLPSRAGGPDARESVLQKELPAAPASNLPAMPGTTEQQELPGSS 117


>gi|218296122|ref|ZP_03496891.1| preprotein translocase, SecG subunit [Thermus aquaticus Y51MC23]
 gi|218243499|gb|EED10028.1| preprotein translocase, SecG subunit [Thermus aquaticus Y51MC23]
          Length = 75

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 3/69 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ---SSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
          +   +++++L V   LV ++L+Q          G S++  S R     L R T IL   F
Sbjct: 4  LYTLVILLYLGVAGLLVYLVLVQEPKQGAGDLMGGSADLFSARGVTGGLYRLTVILGAVF 63

Query: 58 FATSIALGM 66
           A ++ +G+
Sbjct: 64 AALALLIGL 72


>gi|17546782|ref|NP_520184.1| preprotein translocase subunit SecG [Ralstonia solanacearum
          GMI1000]
 gi|17429082|emb|CAD15770.1| putative-export membrane protein secg (translocase) transmembrane
          [Ralstonia solanacearum GMI1000]
          Length = 115

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 39/85 (45%), Gaps = 6/85 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  L+V  ++  +G++ ++L+Q    +        G+S +      +A+ L R TAILA
Sbjct: 4  LKTLLLVAQILSALGVIGLVLLQHGKGADVGAAFGSGASGSLFGATGSANFLSRTTAILA 63

Query: 55 FFFFATSIALGMISRYTSTRYKDNM 79
            FF  ++ L ++           M
Sbjct: 64 TVFFVATLTLTLLGTSKGNVSAGVM 88


>gi|254779798|ref|YP_003057904.1| preprotein translocase subunit SecG [Helicobacter pylori B38]
 gi|254001710|emb|CAX29941.1| Protein-export membrane protein SecG [Helicobacter pylori B38]
          Length = 201

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 13/103 (12%), Positives = 26/103 (25%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG              +   K
Sbjct: 31  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSILDETKTNK 90

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           D           +   +   + +   L+               
Sbjct: 91  DLSPLVPATGTLNPTLNPTLNPTLNPLEQAPTNPLMPQQTPNE 133


>gi|317013042|gb|ADU83650.1| preprotein translocase subunit SecG [Helicobacter pylori
           Lithuania75]
          Length = 196

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 13/103 (12%), Positives = 26/103 (25%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG              +   K
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSILDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           D           +   +   + +   L+               
Sbjct: 89  DLSPLVPATGTLNPTLNPTLNPTLNPLEQAPTNPLMPQQTPNE 131


>gi|289422968|ref|ZP_06424790.1| preprotein translocase, SecG subunit [Peptostreptococcus
          anaerobius 653-L]
 gi|289156648|gb|EFD05291.1| preprotein translocase, SecG subunit [Peptostreptococcus
          anaerobius 653-L]
          Length = 77

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 30/70 (42%), Gaps = 6/70 (8%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDS------SAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           LM + + + + ++  +L Q S            +S  +   +     L + T I++  F
Sbjct: 6  ILMGIQVFLSILMIITVLPQESKQNQPQVFLEDNASQAYFKPKGKEAFLNKMTKIISVLF 65

Query: 58 FATSIALGMI 67
          F  +IAL ++
Sbjct: 66 FINAIALVIV 75


>gi|291334200|gb|ADD93867.1| hypothetical protein [uncultured marine bacterium
          MedDCM-OCT-S08-C1340]
          Length = 84

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 37/79 (46%), Gaps = 6/79 (7%)

Query: 21 LIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTR 74
          L+Q    +        G+SS     R +A  + + T ++A  FF TS++L  IS   S+ 
Sbjct: 2  LVQQGKGADAGAAFGSGASSTVFGARGSATFMNKVTTVIALCFFVTSLSLAYISSNKSSG 61

Query: 75 YKDNMHRSLVDSIKDQGND 93
           K  ++ ++ +   D+  +
Sbjct: 62 SKSLINDTVQEGNIDKQEE 80


>gi|184154845|ref|YP_001843185.1| preprotein translocase SecG subunit [Lactobacillus fermentum IFO
          3956]
 gi|260663125|ref|ZP_05864017.1| preprotein translocase, SecG subunit [Lactobacillus fermentum
          28-3-CHN]
 gi|183226189|dbj|BAG26705.1| preprotein translocase SecG subunit [Lactobacillus fermentum IFO
          3956]
 gi|260552317|gb|EEX25368.1| preprotein translocase, SecG subunit [Lactobacillus fermentum
          28-3-CHN]
          Length = 79

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 9/79 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS------SDSSAFGSSSNFTSVRSTAHS---LGRFTA 51
          M+  LM + LI  V ++  +++Q       S S+  G S +  S R        +   T 
Sbjct: 1  MENTLMTLFLIDCVVMIACVMMQPAKNDNDSMSALTGGSGDLFSRRKARGFEAVMQIVTV 60

Query: 52 ILAFFFFATSIALGMISRY 70
          I+   FF  ++AL  +S +
Sbjct: 61 IVGIIFFVLALALVYVSSH 79


>gi|149196803|ref|ZP_01873856.1| hypothetical protein LNTAR_10371 [Lentisphaera araneosa HTCC2155]
 gi|149139913|gb|EDM28313.1| hypothetical protein LNTAR_10371 [Lentisphaera araneosa HTCC2155]
          Length = 115

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 11/80 (13%), Positives = 28/80 (35%), Gaps = 5/80 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+ + +++ V ++  +L+Q S             ++     S+   L + T  +  
Sbjct: 1  MSSVLLAIVVLLAVLIIVSVLMQPSKADGGLGGLASGMTSDVLGASSNDFLAKATWWMFG 60

Query: 56 FFFATSIALGMISRYTSTRY 75
           F    +  G +    +   
Sbjct: 61 IFVVACLFFGKMKATENAEK 80


>gi|153813797|ref|ZP_01966465.1| hypothetical protein RUMTOR_00003 [Ruminococcus torques ATCC
          27756]
 gi|317501943|ref|ZP_07960127.1| preprotein translocase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331088241|ref|ZP_08337160.1| preprotein translocase [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145848193|gb|EDK25111.1| hypothetical protein RUMTOR_00003 [Ruminococcus torques ATCC
          27756]
 gi|316896623|gb|EFV18710.1| preprotein translocase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330408485|gb|EGG87951.1| preprotein translocase [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 80

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 33/71 (46%), Gaps = 7/71 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF-------TSVRSTAHSLGRFTAIL 53
          ++  L ++ +I  + L C+IL+Q   S+  G+ S            RS   +L + T ++
Sbjct: 4  LKTVLTIIFVIDCIALACIILLQEGKSAGLGTISGAADTYWGHNKGRSMEGALVKATRVI 63

Query: 54 AFFFFATSIAL 64
          A  F   ++ L
Sbjct: 64 AVLFIVLAVVL 74


>gi|226227082|ref|YP_002761188.1| protein-export membrane protein SecG [Gemmatimonas aurantiaca T-27]
 gi|226090273|dbj|BAH38718.1| protein-export membrane protein SecG [Gemmatimonas aurantiaca T-27]
          Length = 136

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/114 (16%), Positives = 37/114 (32%), Gaps = 11/114 (9%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA--------FGSSSNFTSVRSTAHSLGRFTAI 52
           M  FL+++ ++  V L   IL+QS               S+ +    R   + L + +  
Sbjct: 1   MYTFLLILLILDAVVLAAAILLQSGKGGGLAASFGGASSSADSVIGSRQAGNLLTKASWW 60

Query: 53  LAFFFFATSIALGMISRYTSTRYKDNMH---RSLVDSIKDQGNDNFGDGSSPKL 103
               F   +  L ++S   S            +   +     N N    ++P  
Sbjct: 61  CGGIFLGLAFILQIMSTRASAPKSVLDQLAAPATQAAPTAPSNANTVAPAAPLT 114


>gi|228923840|ref|ZP_04087118.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar huazhongensis BGSC 4BD1]
 gi|229020336|ref|ZP_04177102.1| protein-export membrane protein secG [Bacillus cereus AH1273]
 gi|229026567|ref|ZP_04182916.1| protein-export membrane protein secG [Bacillus cereus AH1272]
 gi|229032743|ref|ZP_04188703.1| protein-export membrane protein secG [Bacillus cereus AH1271]
 gi|229099555|ref|ZP_04230483.1| protein-export membrane protein secG [Bacillus cereus Rock3-29]
 gi|229105730|ref|ZP_04236359.1| protein-export membrane protein secG [Bacillus cereus Rock3-28]
 gi|229118620|ref|ZP_04247972.1| protein-export membrane protein secG [Bacillus cereus Rock1-3]
 gi|229164068|ref|ZP_04292005.1| protein-export membrane protein secG [Bacillus cereus R309803]
 gi|228619451|gb|EEK76340.1| protein-export membrane protein secG [Bacillus cereus R309803]
 gi|228664812|gb|EEL20302.1| protein-export membrane protein secG [Bacillus cereus Rock1-3]
 gi|228677619|gb|EEL31867.1| protein-export membrane protein secG [Bacillus cereus Rock3-28]
 gi|228683851|gb|EEL37801.1| protein-export membrane protein secG [Bacillus cereus Rock3-29]
 gi|228728570|gb|EEL79586.1| protein-export membrane protein secG [Bacillus cereus AH1271]
 gi|228734744|gb|EEL85389.1| protein-export membrane protein secG [Bacillus cereus AH1272]
 gi|228740972|gb|EEL91204.1| protein-export membrane protein secG [Bacillus cereus AH1273]
 gi|228835969|gb|EEM81332.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar huazhongensis BGSC 4BD1]
          Length = 77

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L V+ +IV + ++ ++L+QSS+SS    + +  +         R     L R T +
Sbjct: 1  MHTLLSVLLIIVSILMIVMVLMQSSNSSGLSGAISGGAEQLFGKQKARGIEAVLNRITIV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +IA+  +
Sbjct: 61 LAVLFFVLTIAVTYL 75


>gi|291519265|emb|CBK74486.1| protein translocase, SecG subunit [Butyrivibrio fibrisolvens
          16/4]
          Length = 80

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 31/74 (41%), Gaps = 8/74 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF--------TSVRSTAHSLGRFTAI 52
          ++  L+++ +++ V L  +IL Q    +  GS S             RS    L + T++
Sbjct: 4  LKYVLIILLIVICVALTVIILFQEGKQNGLGSLSGQQFDSYWSRNKGRSREGLLVKLTSV 63

Query: 53 LAFFFFATSIALGM 66
              FF  S  L +
Sbjct: 64 CVILFFVLSAVLNI 77


>gi|322379207|ref|ZP_08053598.1| preprotein translocase subunit SecG [Helicobacter suis HS1]
 gi|321148347|gb|EFX42856.1| preprotein translocase subunit SecG [Helicobacter suis HS1]
          Length = 120

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/118 (19%), Positives = 39/118 (33%), Gaps = 16/118 (13%)

Query: 21  LIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYK 76
           L+Q S      +  GS+ +    +  A  L + T  L F F + +IALG           
Sbjct: 2   LLQKSSSIGLGAYSGSNESLFGAKGPASFLAKLTMFLGFLFLSNTIALGYFYNKEYN--I 59

Query: 77  DNMHRSLVDSIKDQGNDNF----------GDGSSPKLDSVSAKSSSSVVAGKRSSSRT 124
             + R+  +S+                       P    V  KS   + A  ++  +T
Sbjct: 60  SVLDRAPKNSLSAAPLVPQNPNSNPLNNPLLTPPPAGPLVPKKSEGLMPAPSQTPPKT 117


>gi|154484689|ref|ZP_02027137.1| hypothetical protein EUBVEN_02406 [Eubacterium ventriosum ATCC
          27560]
 gi|149734537|gb|EDM50454.1| hypothetical protein EUBVEN_02406 [Eubacterium ventriosum ATCC
          27560]
          Length = 81

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/71 (22%), Positives = 28/71 (39%), Gaps = 8/71 (11%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF--------TSVRSTAHSLGRFTAILAF 55
           L VV +++ + +  VIL+Q    +    + +            RS    L + T +   
Sbjct: 6  VLTVVFVLICLAITVVILLQEGKQAGLTGAISGAADSYWGKNKGRSMEGKLEKATKVFVV 65

Query: 56 FFFATSIALGM 66
           FF  +I L M
Sbjct: 66 LFFVIAIVLNM 76


>gi|229087600|ref|ZP_04219730.1| protein-export membrane protein secG [Bacillus cereus Rock3-44]
 gi|228695716|gb|EEL48571.1| protein-export membrane protein secG [Bacillus cereus Rock3-44]
          Length = 77

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L V+ +IV + ++ ++L+QSS+SS    + +  +         R     L R T +
Sbjct: 1  MHTLLSVLLIIVSILMIVLVLMQSSNSSGLSGAISGGAEQLFGKQKARGVEAVLNRITVV 60

Query: 53 LAFFFFATSIALGMIS 68
          LA  FFA +IA+  +S
Sbjct: 61 LAVLFFALTIAVTYLS 76


>gi|317009939|gb|ADU80519.1| preprotein translocase subunit SecG [Helicobacter pylori India7]
          Length = 199

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 13/103 (12%), Positives = 26/103 (25%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG              +   K
Sbjct: 29  GLGAYSGSNDSLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSILDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           D           +   +   + +   L+               
Sbjct: 89  DLSPLVPATGTLNPTLNPTLNPTLNPLEQAPTNPLMPKQTPDE 131


>gi|225164458|ref|ZP_03726715.1| preprotein translocase, SecG subunit [Opitutaceae bacterium TAV2]
 gi|224800928|gb|EEG19267.1| preprotein translocase, SecG subunit [Opitutaceae bacterium TAV2]
          Length = 142

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 39/121 (32%), Gaps = 13/121 (10%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSDS------SAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
            L  V ++V V L+ V+L+Q   S      +  G  +  T    T + L + T   A  F
Sbjct: 7   LLTFVLILVCVFLILVVLMQKPKSDGGMGAALGGGMTEATFGADTGNVLTKATIRAAIIF 66

Query: 58  FATSIAL-------GMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKS 110
           F  S  L           R            +  +           D S+  + +  AKS
Sbjct: 67  FILSFGLYLGHIWQSKTVRNRGALPTIPAAEAPAEPATSATPATVPDASATTITAEPAKS 126

Query: 111 S 111
            
Sbjct: 127 D 127


>gi|225028609|ref|ZP_03717801.1| hypothetical protein EUBHAL_02888 [Eubacterium hallii DSM 3353]
 gi|224954091|gb|EEG35300.1| hypothetical protein EUBHAL_02888 [Eubacterium hallii DSM 3353]
          Length = 70

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 9/64 (14%)

Query: 10 LIVVVGLVCVILIQSSDSSAFGSSSNF---------TSVRSTAHSLGRFTAILAFFFFAT 60
          +++ + ++ V+++Q S +S FG+ S              R+    L R TAIL F FF  
Sbjct: 1  MLICLVMIIVVMMQESKNSGFGALSGQVDSDSYVRKNRGRTKEGKLERITAILGFLFFVV 60

Query: 61 SIAL 64
          +I L
Sbjct: 61 AIGL 64


>gi|329767610|ref|ZP_08259131.1| preprotein translocase [Gemella haemolysans M341]
 gi|328839237|gb|EGF88821.1| preprotein translocase [Gemella haemolysans M341]
          Length = 76

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 7/74 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-------SSAFGSSSNFTSVRSTAHSLGRFTAIL 53
          M  FLM + ++  + L+ V+L+Q S        +           VR     L R T +L
Sbjct: 1  MHTFLMTIAIVSSILLIVVVLLQESKSGGLSGLTGGAEELFGKQKVRGAELVLQRITIVL 60

Query: 54 AFFFFATSIALGMI 67
             FF T + L  +
Sbjct: 61 GLIFFITLVCLTWL 74


>gi|308185003|ref|YP_003929136.1| preprotein translocase subunit SecG [Helicobacter pylori SJM180]
 gi|308060923|gb|ADO02819.1| preprotein translocase subunit SecG [Helicobacter pylori SJM180]
          Length = 199

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 12/103 (11%), Positives = 26/103 (25%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG              +   K
Sbjct: 29  GLGAYSGSNDSLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSILDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +           +   +   + +   L+               
Sbjct: 89  ELSPLVPATGTLNPTLNPTLNPTLNPLEQAPTNPLMPQQTPNE 131


>gi|83815198|ref|YP_446220.1| putative protein-export membrane protein [Salinibacter ruber DSM
           13855]
 gi|83756592|gb|ABC44705.1| putative protein-export membrane protein [Salinibacter ruber DSM
           13855]
          Length = 127

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/108 (18%), Positives = 39/108 (36%), Gaps = 8/108 (7%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDS------SAFGSSSNFTSVRSTAHSLGRFTAILA 54
           M  F++V+  ++   L+ VIL+QS         ++ G++      R     L + T  LA
Sbjct: 1   MFSFMVVLIALIAAVLILVILMQSGQGQGLSGIASGGATRQVLGTRQAPDMLEKATWTLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
             F +  +         +   +  + +   D+   QG      G    
Sbjct: 61  AVFISLCVITNFF--IDTGEQESVIQQRAQDTPSQQGQTPPSQGGGAA 106


>gi|220904447|ref|YP_002479759.1| preprotein translocase, SecG subunit [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219868746|gb|ACL49081.1| preprotein translocase, SecG subunit [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 145

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 22/115 (19%), Positives = 49/115 (42%), Gaps = 5/115 (4%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFFF 57
           Q  ++ +H+IV V LV ++L+QS          G +++          L + T ++A  F
Sbjct: 20  QTLILTLHIIVCVLLVILVLLQSGKEGMGVIFGGGNTSVFGSGGAGGILAKLTTLMAVIF 79

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
             TS++   +S    +     ++  + D +  +      + + P   +  A++ S
Sbjct: 80  VITSLSYTYVSSSRPSSESTILNVKIEDPVAPKPAPAPIESALPGT-TAPAETQS 133


>gi|261839974|gb|ACX99739.1| protein translocation protein [Helicobacter pylori 52]
          Length = 192

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/88 (17%), Positives = 28/88 (31%), Gaps = 2/88 (2%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLV 84
              +  GS+ +    +  A  + + T  L   F A +IALG    Y     K  +  +  
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVANTIALGYF--YNKEYGKSILDETKT 86

Query: 85  DSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
           +          G  +        A ++ 
Sbjct: 87  NKELSPLVPATGTLNPTLNPLEQAPTNP 114


>gi|296134186|ref|YP_003641433.1| preprotein translocase, SecG subunit [Thermincola sp. JR]
 gi|296032764|gb|ADG83532.1| preprotein translocase, SecG subunit [Thermincola potens JR]
          Length = 74

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 6/73 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
          M+I +++VH+++ +G++  +L+QS  S+        G+ + F   +     L + +   A
Sbjct: 1  MKIAVIIVHILLALGVIVTVLLQSGKSAGLSGAIAGGADAIFGKKKGMDEFLSKLSTTFA 60

Query: 55 FFFFATSIALGMI 67
            F  TS+AL +I
Sbjct: 61 IGFLITSLALSII 73


>gi|222086038|ref|YP_002544570.1| protein-export translocase protein [Agrobacterium radiobacter K84]
 gi|221723486|gb|ACM26642.1| protein-export translocase protein [Agrobacterium radiobacter K84]
          Length = 168

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 63/124 (50%), Gaps = 3/124 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
           MQ  L+V++L++VV L+ V+LIQ S+    G      F S R TA++L R TAILA  FF
Sbjct: 1   MQTVLLVIYLMIVVALIGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAILAALFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           A ++ + ++SR+   R  D ++R    S +  G  +   G      + S    ++     
Sbjct: 61  ALALGMNVLSRFEG-RPTDILNRIPSTSGQGNGILDSLGGQKGAAPAGSQTQPANNSGVP 119

Query: 119 RSSS 122
            S +
Sbjct: 120 NSGA 123


>gi|152977350|ref|YP_001376867.1| preprotein translocase subunit SecG [Bacillus cereus subsp.
          cytotoxis NVH 391-98]
 gi|152026102|gb|ABS23872.1| preprotein translocase, SecG subunit [Bacillus cytotoxicus NVH
          391-98]
          Length = 77

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M  FL V+ +IV + ++ ++L+QSS+SS    + +  +         R     L R T +
Sbjct: 1  MHTFLSVLLIIVSILMIVMVLMQSSNSSGLSGAISGGAEQLFGKQKARGIEAVLSRITVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +I +   
Sbjct: 61 LAVLFFGLTIGVTYF 75


>gi|311695961|gb|ADP98834.1| preprotein translocase SecG subunit [marine bacterium HP15]
          Length = 126

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 41/105 (39%), Gaps = 7/105 (6%)

Query: 18  CVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYT 71
            ++LIQ    +  G++            + +   L RFT +LA  FF TS +L + ++  
Sbjct: 21  GLVLIQQGKGADAGAAFGGGASQTVFGSQGSGSFLTRFTTLLAVVFFVTSFSLAIFAKQR 80

Query: 72  STRYKDNMHRSLVDSIKDQGNDNFGD-GSSPKLDSVSAKSSSSVV 115
           +    +     + +S      D   D G +   ++   +S    +
Sbjct: 81  AEVAGEAGIPVVQESSSAAPADTAADNGEAAASEAEGGESDLPEL 125


>gi|322506554|gb|ADX02008.1| secG [Acinetobacter baumannii 1656-2]
          Length = 94

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 40/96 (41%), Gaps = 8/96 (8%)

Query: 16  LVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAFFFFATSIALGMISR 69
           ++ +IL+Q    +  G+S              + + L R TAIL   FF TS+ L + ++
Sbjct: 1   MIALILVQHGKGADAGASFGGGGAATVFGASGSGNFLTRVTAILTALFFVTSLTLAVFAK 60

Query: 70  YTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
             +T       +++  ++  Q        ++PK   
Sbjct: 61  KQTTEAYSL--KTVQTTVPVQTTSPETSPNAPKTGQ 94


>gi|315651153|ref|ZP_07904185.1| preprotein translocase subunit SecG [Eubacterium saburreum DSM
          3986]
 gi|315486618|gb|EFU76968.1| preprotein translocase subunit SecG [Eubacterium saburreum DSM
          3986]
          Length = 76

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 14/71 (19%), Positives = 27/71 (38%), Gaps = 7/71 (9%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSD-------SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           + ++ ++V V L  V+L Q  +            +       RS    L + T + A  
Sbjct: 5  LISIIFILVCVFLTTVVLFQEGNEQGLGSIGGIADTYWGKNRGRSVEGLLEKLTKVAAAL 64

Query: 57 FFATSIALGMI 67
          F   S+ L ++
Sbjct: 65 FLILSLVLNIV 75


>gi|307266216|ref|ZP_07547758.1| preprotein translocase, SecG subunit [Thermoanaerobacter wiegelii
          Rt8.B1]
 gi|326390580|ref|ZP_08212136.1| preprotein translocase, SecG subunit [Thermoanaerobacter
          ethanolicus JW 200]
 gi|306918746|gb|EFN48978.1| preprotein translocase, SecG subunit [Thermoanaerobacter wiegelii
          Rt8.B1]
 gi|325993405|gb|EGD51841.1| preprotein translocase, SecG subunit [Thermoanaerobacter
          ethanolicus JW 200]
          Length = 79

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS--------SSNFTSVRSTAHSLGRFTAI 52
          ++  LMV+ ++V + L+ VIL+Q   S+                   R+   +L R T I
Sbjct: 2  LKTVLMVIQILVSIFLIVVILLQKGKSAGISGVIAGGAETFFGKNKARTMEGTLERLTTI 61

Query: 53 LAFFFFATSIALGMI 67
           A  F   S+ L ++
Sbjct: 62 AAALFIILSMVLTIM 76


>gi|228993836|ref|ZP_04153740.1| protein-export membrane protein secG [Bacillus pseudomycoides DSM
          12442]
 gi|228999862|ref|ZP_04159434.1| protein-export membrane protein secG [Bacillus mycoides Rock3-17]
 gi|229007416|ref|ZP_04165013.1| protein-export membrane protein secG [Bacillus mycoides Rock1-4]
 gi|228753804|gb|EEM03245.1| protein-export membrane protein secG [Bacillus mycoides Rock1-4]
 gi|228759804|gb|EEM08778.1| protein-export membrane protein secG [Bacillus mycoides Rock3-17]
 gi|228765892|gb|EEM14542.1| protein-export membrane protein secG [Bacillus pseudomycoides DSM
          12442]
          Length = 77

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L V+ +IV + ++ ++L+QSS+SS    + +  +         R     L R T +
Sbjct: 1  MHTLLSVLLIIVSILMIVMVLMQSSNSSGLSGAISGGAEQLFGKQKARGIEAVLNRITVV 60

Query: 53 LAFFFFATSIALGMIS 68
          LA  FFA +I +  +S
Sbjct: 61 LAVLFFALTIGVTYLS 76


>gi|109946850|ref|YP_664078.1| preprotein translocase subunit SecG [Helicobacter acinonychis str.
           Sheeba]
 gi|109714071|emb|CAJ99079.1| protein-export membrane protein [Helicobacter acinonychis str.
           Sheeba]
          Length = 187

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 14/108 (12%), Positives = 30/108 (27%), Gaps = 8/108 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG +            +   K
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVINTIALGYLYNKEYGKSILDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSSRT 124
           +           +   +   + +   L+           A K     +
Sbjct: 89  ELSPLVPATGTLNSTLNPTLNPTLNPLEQAPTNPLIPKEAPKTLPKES 136


>gi|15645869|ref|NP_208047.1| preprotein translocase subunit SecG [Helicobacter pylori 26695]
 gi|2314422|gb|AAD08301.1| protein translocation protein, low temperature (secG) [Helicobacter
           pylori 26695]
          Length = 201

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 12/103 (11%), Positives = 26/103 (25%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG              +   K
Sbjct: 31  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSVLDETKTNK 90

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +           +   +   + +   L+               
Sbjct: 91  ELSPLVPATGTLNPALNPTLNPTLNPLEQAPTNPLMPQQTPNE 133


>gi|157364572|ref|YP_001471339.1| preprotein translocase, SecG subunit [Thermotoga lettingae TMO]
 gi|157315176|gb|ABV34275.1| preprotein translocase, SecG subunit [Thermotoga lettingae TMO]
          Length = 76

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 34/76 (44%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRSTA-HSLGRFTAILA 54
          M++F+++VH ++ V L+ ++L Q S       +    S +    R     + G+ T  L+
Sbjct: 1  MKVFMVIVHSLISVALIYMVLQQMSKFAELGGAFGSGSLHTMFGRKKGLDTSGKITLWLS 60

Query: 55 FFFFATSIALGMISRY 70
            FF +SI        
Sbjct: 61 VAFFVSSILTAFFISR 76


>gi|10720400|sp|O25847|SECG_HELPY RecName: Full=Protein-export membrane protein secG
          Length = 199

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 12/103 (11%), Positives = 26/103 (25%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG              +   K
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSVLDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +           +   +   + +   L+               
Sbjct: 89  ELSPLVPATGTLNPALNPTLNPTLNPLEQAPTNPLMPQQTPNE 131


>gi|15616117|ref|NP_244422.1| preprotein translocase subunit SecG [Bacillus halodurans C-125]
 gi|10176179|dbj|BAB07274.1| protein translocation protein [Bacillus halodurans C-125]
          Length = 76

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          MQ    V+ +IV + L+ V+L+QS  S+    + +  +         R     L R T +
Sbjct: 1  MQTVAFVLLIIVSISLIAVVLLQSGRSAGLSGAISGGAEQLVGKQKARGIDAFLARATVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +IA+   
Sbjct: 61 LAVLFFVLTIAVAYF 75


>gi|313885304|ref|ZP_07819055.1| preprotein translocase, SecG subunit [Eremococcus coleocola
          ACS-139-V-Col8]
 gi|312619410|gb|EFR30848.1| preprotein translocase, SecG subunit [Eremococcus coleocola
          ACS-139-V-Col8]
          Length = 76

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
          M+  L +  LIV V ++  +++Q +  +A    S        T  R     L + T++L+
Sbjct: 1  MEQILTIALLIVAVLIIIAVIMQPTKGNAASMLSGSDDGQAKTKARGFEAFLIKTTSVLS 60

Query: 55 FFFFATSIALGMISRY 70
            FF  +IAL  +S  
Sbjct: 61 VLFFVLTIALAYLSAK 76


>gi|68171308|ref|ZP_00544708.1| Preprotein translocase SecG subunit [Ehrlichia chaffeensis str.
          Sapulpa]
 gi|88657611|ref|YP_506997.1| preprotein translocase subunit SecG [Ehrlichia chaffeensis str.
          Arkansas]
 gi|67999289|gb|EAM85938.1| Preprotein translocase SecG subunit [Ehrlichia chaffeensis str.
          Sapulpa]
 gi|88599068|gb|ABD44537.1| preprotein translocase, SecG subunit [Ehrlichia chaffeensis str.
          Arkansas]
          Length = 110

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 17/82 (20%), Positives = 36/82 (43%), Gaps = 7/82 (8%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-------FTSVRSTAHSLGRFTAILAFF 56
           L V+ L++V  LV +IL+Q  +S       +         +  S+++ + + T I+A  
Sbjct: 2  VLTVIQLVLVFFLVILILLQPPESDNLSGFGSTQSNLDSMFTTGSSSNFITKLTVIIATA 61

Query: 57 FFATSIALGMISRYTSTRYKDN 78
          F   ++ L  I+  +  +    
Sbjct: 62 FIINTVLLVGINAKSVHKESIV 83


>gi|30265135|ref|NP_847512.1| preprotein translocase subunit SecG [Bacillus anthracis str.
          Ames]
 gi|42784280|ref|NP_981527.1| preprotein translocase subunit SecG [Bacillus cereus ATCC 10987]
 gi|47530645|ref|YP_021994.1| preprotein translocase subunit SecG [Bacillus anthracis str.
          'Ames Ancestor']
 gi|47567337|ref|ZP_00238050.1| preprotein translocase, secG subunit [Bacillus cereus G9241]
 gi|49187945|ref|YP_031198.1| preprotein translocase subunit SecG [Bacillus anthracis str.
          Sterne]
 gi|49479336|ref|YP_039119.1| preprotein translocase subunit SecG [Bacillus thuringiensis
          serovar konkukian str. 97-27]
 gi|52140438|ref|YP_086391.1| preprotein translocase subunit SecG [Bacillus cereus E33L]
 gi|165869905|ref|ZP_02214562.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          A0488]
 gi|167636709|ref|ZP_02394995.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          A0442]
 gi|167641777|ref|ZP_02400019.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          A0193]
 gi|170689390|ref|ZP_02880583.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          A0465]
 gi|170709412|ref|ZP_02899822.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          A0389]
 gi|177656094|ref|ZP_02937154.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          A0174]
 gi|196032817|ref|ZP_03100230.1| preprotein translocase, SecG subunit [Bacillus cereus W]
 gi|196039474|ref|ZP_03106779.1| preprotein translocase, SecG subunit [Bacillus cereus NVH0597-99]
 gi|196045685|ref|ZP_03112915.1| preprotein translocase, SecG subunit [Bacillus cereus 03BB108]
 gi|206976636|ref|ZP_03237541.1| preprotein translocase, SecG subunit [Bacillus cereus H3081.97]
 gi|217962600|ref|YP_002341172.1| preprotein translocase subunit SecG [Bacillus cereus AH187]
 gi|218906304|ref|YP_002454138.1| preprotein translocase, SecG subunit [Bacillus cereus AH820]
 gi|222098568|ref|YP_002532626.1| preprotein translocase subunit secg [Bacillus cereus Q1]
 gi|225867077|ref|YP_002752455.1| preprotein translocase, SecG subunit [Bacillus cereus 03BB102]
 gi|227817867|ref|YP_002817876.1| preprotein translocase, SecG subunit [Bacillus anthracis str. CDC
          684]
 gi|228917734|ref|ZP_04081275.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar pulsiensis BGSC 4CC1]
 gi|228930130|ref|ZP_04093140.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar pondicheriensis BGSC 4BA1]
 gi|228936415|ref|ZP_04099213.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar andalousiensis BGSC 4AW1]
 gi|228948834|ref|ZP_04111109.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar monterrey BGSC 4AJ1]
 gi|228988354|ref|ZP_04148446.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar tochigiensis BGSC 4Y1]
 gi|229094217|ref|ZP_04225296.1| protein-export membrane protein secG [Bacillus cereus Rock3-42]
 gi|229124632|ref|ZP_04253817.1| protein-export membrane protein secG [Bacillus cereus 95/8201]
 gi|229141853|ref|ZP_04270380.1| protein-export membrane protein secG [Bacillus cereus BDRD-ST26]
 gi|229158695|ref|ZP_04286753.1| protein-export membrane protein secG [Bacillus cereus ATCC 4342]
 gi|229187340|ref|ZP_04314483.1| protein-export membrane protein secG [Bacillus cereus BGSC 6E1]
 gi|229199860|ref|ZP_04326452.1| protein-export membrane protein secG [Bacillus cereus m1293]
 gi|229604161|ref|YP_002869328.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          A0248]
 gi|254686464|ref|ZP_05150323.1| preprotein translocase subunit SecG [Bacillus anthracis str.
          CNEVA-9066]
 gi|254724463|ref|ZP_05186247.1| preprotein translocase subunit SecG [Bacillus anthracis str.
          A1055]
 gi|254735671|ref|ZP_05193378.1| preprotein translocase subunit SecG [Bacillus anthracis str.
          Western North America USA6153]
 gi|254744243|ref|ZP_05201923.1| preprotein translocase subunit SecG [Bacillus anthracis str.
          Kruger B]
 gi|254755540|ref|ZP_05207573.1| preprotein translocase subunit SecG [Bacillus anthracis str.
          Vollum]
 gi|254756995|ref|ZP_05209023.1| preprotein translocase subunit SecG [Bacillus anthracis str.
          Australia 94]
 gi|296505531|ref|YP_003667231.1| preprotein translocase subunit SecG [Bacillus thuringiensis
          BMB171]
 gi|301056590|ref|YP_003794801.1| membrane protein [Bacillus anthracis CI]
 gi|30259812|gb|AAP28998.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          Ames]
 gi|42740211|gb|AAS44135.1| preprotein translocase, SecG subunit [Bacillus cereus ATCC 10987]
 gi|47505793|gb|AAT34469.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          'Ames Ancestor']
 gi|47555958|gb|EAL14296.1| preprotein translocase, secG subunit [Bacillus cereus G9241]
 gi|49181872|gb|AAT57248.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          Sterne]
 gi|49330892|gb|AAT61538.1| probable protein-export membrane protein [Bacillus thuringiensis
          serovar konkukian str. 97-27]
 gi|51973907|gb|AAU15457.1| probable protein-export membrane protein [Bacillus cereus E33L]
 gi|164714228|gb|EDR19748.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          A0488]
 gi|167510260|gb|EDR85664.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          A0193]
 gi|167527863|gb|EDR90693.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          A0442]
 gi|170125689|gb|EDS94606.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          A0389]
 gi|170666686|gb|EDT17456.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          A0465]
 gi|172079860|gb|EDT64971.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          A0174]
 gi|195994246|gb|EDX58201.1| preprotein translocase, SecG subunit [Bacillus cereus W]
 gi|196023516|gb|EDX62193.1| preprotein translocase, SecG subunit [Bacillus cereus 03BB108]
 gi|196029634|gb|EDX68236.1| preprotein translocase, SecG subunit [Bacillus cereus NVH0597-99]
 gi|206745122|gb|EDZ56524.1| preprotein translocase, SecG subunit [Bacillus cereus H3081.97]
 gi|217067195|gb|ACJ81445.1| preprotein translocase, SecG subunit [Bacillus cereus AH187]
 gi|218536573|gb|ACK88971.1| preprotein translocase, SecG subunit [Bacillus cereus AH820]
 gi|221242627|gb|ACM15337.1| probable protein-export membrane protein [Bacillus cereus Q1]
 gi|225786913|gb|ACO27130.1| preprotein translocase, SecG subunit [Bacillus cereus 03BB102]
 gi|227003720|gb|ACP13463.1| preprotein translocase, SecG subunit [Bacillus anthracis str. CDC
          684]
 gi|228583620|gb|EEK41846.1| protein-export membrane protein secG [Bacillus cereus m1293]
 gi|228596044|gb|EEK53721.1| protein-export membrane protein secG [Bacillus cereus BGSC 6E1]
 gi|228624679|gb|EEK81448.1| protein-export membrane protein secG [Bacillus cereus ATCC 4342]
 gi|228641609|gb|EEK97913.1| protein-export membrane protein secG [Bacillus cereus BDRD-ST26]
 gi|228658972|gb|EEL14627.1| protein-export membrane protein secG [Bacillus cereus 95/8201]
 gi|228689209|gb|EEL43031.1| protein-export membrane protein secG [Bacillus cereus Rock3-42]
 gi|228771335|gb|EEM19809.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar tochigiensis BGSC 4Y1]
 gi|228810796|gb|EEM57142.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar monterrey BGSC 4AJ1]
 gi|228823247|gb|EEM69081.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar andalousiensis BGSC 4AW1]
 gi|228829629|gb|EEM75256.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar pondicheriensis BGSC 4BA1]
 gi|228841971|gb|EEM87077.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar pulsiensis BGSC 4CC1]
 gi|229268569|gb|ACQ50206.1| preprotein translocase, SecG subunit [Bacillus anthracis str.
          A0248]
 gi|296326583|gb|ADH09511.1| preprotein translocase subunit SecG [Bacillus thuringiensis
          BMB171]
 gi|300378759|gb|ADK07663.1| hypothetical membrane protein [Bacillus cereus biovar anthracis
          str. CI]
 gi|324329034|gb|ADY24294.1| preprotein translocase subunit SecG [Bacillus thuringiensis
          serovar finitimus YBT-020]
          Length = 77

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L V+ +IV + ++ ++L+QSS+SS    + +  +         R     L R T +
Sbjct: 1  MHTLLSVLLIIVSILMIVMVLMQSSNSSGLSGAISGGAEQLFGKQKARGIEAVLNRITIV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FFA +I +  +
Sbjct: 61 LAVLFFALTIGVTYL 75


>gi|320449376|ref|YP_004201472.1| preprotein translocase subunit SecG [Thermus scotoductus SA-01]
 gi|320149545|gb|ADW20923.1| preprotein translocase, subunit SecG [Thermus scotoductus SA-01]
          Length = 75

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ---SSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
          +   +++++L V   LV ++L+Q          G+S++  S R     L R T +L   F
Sbjct: 4  LYTLVILLYLGVAGLLVYLVLVQEPKQGAGDLMGASADLFSARGVTGGLYRLTILLGVIF 63

Query: 58 FATSIALGMISR 69
           A ++ +G+ +R
Sbjct: 64 VALALVIGLWTR 75


>gi|193084251|gb|ACF09913.1| preprotein translocase subunit SecG [uncultured marine group III
           euryarchaeote KM3-28-E8]
          Length = 109

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 1/62 (1%)

Query: 37  TSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFG 96
            SVR TA+ L R TA++A  F  TSI L +++       +  + R      ++Q      
Sbjct: 46  MSVRGTANFLTRATAVIAACFMVTSITLAILAGNRG-GSESILDRPGTSVPQNQEPKEGQ 104

Query: 97  DG 98
             
Sbjct: 105 VP 106


>gi|312892371|ref|ZP_07751866.1| preprotein translocase, SecG subunit [Mucilaginibacter paludis DSM
           18603]
 gi|311295155|gb|EFQ72329.1| preprotein translocase, SecG subunit [Mucilaginibacter paludis DSM
           18603]
          Length = 109

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 43/102 (42%), Gaps = 5/102 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT----SVRSTAHSLGRFTAILAFF 56
           M   L+++ +IV   L  ++LIQ+       S+ + +     V+ T   L + T ILA  
Sbjct: 1   MY-LLVIIAIIVCALLGLIVLIQNPKGGGLSSNFSSSSQLLGVQKTGDILEKGTWILAIA 59

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
               S+A+ +I +  S + ++     +  + +     N    
Sbjct: 60  LIVLSLAINVIGKGGSGKVENVNQEQIDKASRPSTPTNAPAT 101


>gi|241763287|ref|ZP_04761344.1| preprotein translocase, SecG subunit [Acidovorax delafieldii 2AN]
 gi|241367562|gb|EER61849.1| preprotein translocase, SecG subunit [Acidovorax delafieldii 2AN]
          Length = 128

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 33/83 (39%), Gaps = 6/83 (7%)

Query: 9  HLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAFFFFATSI 62
           ++  +G++ +IL+Q    +  G++    S  S       A+ L R T ILA  FF  ++
Sbjct: 12 QMLTALGMIGLILVQHGKGADMGAAFGSGSSGSLFGASGSANFLSRTTGILATVFFVATL 71

Query: 63 ALGMISRYTSTRYKDNMHRSLVD 85
          AL        +     +      
Sbjct: 72 ALAYFGNARPSSSGSVLETPAAA 94


>gi|197302760|ref|ZP_03167813.1| hypothetical protein RUMLAC_01489 [Ruminococcus lactaris ATCC
          29176]
 gi|197298158|gb|EDY32705.1| hypothetical protein RUMLAC_01489 [Ruminococcus lactaris ATCC
          29176]
          Length = 80

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 7/71 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-------FTSVRSTAHSLGRFTAIL 53
          ++I L +V +I  + L  +IL+Q   S+  G+              RS   +L + T  L
Sbjct: 4  LKIVLYIVFVIDCIALSAIILLQEGKSAGLGTIGGVADSYWGQNKGRSMEGALVKSTKFL 63

Query: 54 AFFFFATSIAL 64
          A  F   S+ L
Sbjct: 64 AILFLVLSVVL 74


>gi|327398329|ref|YP_004339198.1| preprotein translocase subunit SecG [Hippea maritima DSM 10411]
 gi|327180958|gb|AEA33139.1| preprotein translocase, SecG subunit [Hippea maritima DSM 10411]
          Length = 110

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 19/109 (17%), Positives = 37/109 (33%), Gaps = 6/109 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILA 54
           M   ++++ + + + LV +IL+Q    +  G      ++            L + T  LA
Sbjct: 1   MLTLMVILQVFLGLILVGLILLQKGKGAEMGVAFGTGAADTLFGPTGAMSFLAKITWGLA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKL 103
           F F   SI +  I   ++T        +         N      + P  
Sbjct: 61  FVFMLNSIGISYIIYKSNTSSITTSIPTTTTQTNKTANVPVNPETKPIT 109


>gi|229823090|ref|ZP_04449159.1| hypothetical protein GCWU000282_00385 [Catonella morbi ATCC
          51271]
 gi|229787256|gb|EEP23370.1| hypothetical protein GCWU000282_00385 [Catonella morbi ATCC
          51271]
          Length = 78

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 31/78 (39%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD--------SSAFGSSSNFTSVRSTAHSLGRFTAI 52
          M   L V  +IV + L+ ++++Q S           +  +  + T  R     L R T +
Sbjct: 1  MSEVLTVALVIVSIILIMLVIMQPSKSNAASSLSGGSAENQMSKTKARGFEAFLIRTTVV 60

Query: 53 LAFFFFATSIALGMISRY 70
              FF  ++AL   S  
Sbjct: 61 FGVLFFVLALALAYFSSK 78


>gi|169830518|ref|YP_001716500.1| preprotein translocase subunit SecG [Candidatus Desulforudis
          audaxviator MP104C]
 gi|169637362|gb|ACA58868.1| preprotein translocase, SecG subunit [Candidatus Desulforudis
          audaxviator MP104C]
          Length = 76

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 17/72 (23%), Positives = 33/72 (45%), Gaps = 6/72 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS-VRSTAHSLGRFTAILA 54
          ++  +M +H ++ + L+ VIL+QS        +  G +  F    +      G+ T +LA
Sbjct: 3  LKSIVMGIHALIALALIAVILLQSGKSAGLSGAIAGGAETFFGKKKGLDQFFGKVTVVLA 62

Query: 55 FFFFATSIALGM 66
            F   S+ L +
Sbjct: 63 VIFGLLSVVLTV 74


>gi|217032315|ref|ZP_03437811.1| hypothetical protein HPB128_132g13 [Helicobacter pylori B128]
 gi|298735721|ref|YP_003728246.1| preprotein translocase subunit SecG [Helicobacter pylori B8]
 gi|216945981|gb|EEC24595.1| hypothetical protein HPB128_132g13 [Helicobacter pylori B128]
 gi|298354910|emb|CBI65782.1| preprotein translocase SecG subunit [Helicobacter pylori B8]
          Length = 198

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 13/103 (12%), Positives = 26/103 (25%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG              +   K
Sbjct: 29  GLGAYSGSNDSLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSILDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           D           +   +   + +   L+               
Sbjct: 89  DLSPLVPATGTLNPTLNPTLNPTLNPLEQAPTNPLMPTQTPNE 131


>gi|332034955|gb|EGI71478.1| preprotein translocase subunit SecG [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 117

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 16/100 (16%), Positives = 33/100 (33%), Gaps = 6/100 (6%)

Query: 18  CVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYT 71
            ++LIQ    +  GSS                + + + T  LA  FF  SI LG ++   
Sbjct: 18  GMVLIQQGKGADMGSSFGAGASGTVFGSSGAGNFMTKTTTSLATVFFVLSIVLGNLTAGQ 77

Query: 72  STRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSS 111
             +  +  +     +++           +   +  S   +
Sbjct: 78  IKKTDEWENLEAAPAVETVVPVEEDVPVTSTKEQSSDVPN 117


>gi|328953656|ref|YP_004370990.1| preprotein translocase, SecG subunit [Desulfobacca acetoxidans
          DSM 11109]
 gi|328453980|gb|AEB09809.1| preprotein translocase, SecG subunit [Desulfobacca acetoxidans
          DSM 11109]
          Length = 123

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 5/79 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQ-----SSDSSAFGSSSNFTSVRSTAHSLGRFTAILAF 55
          M   +++VH+IV + L+ ++L+Q        ++  G+S  F         L + TA  A 
Sbjct: 20 MTNIIVIVHIIVCLALIFIVLLQTGKGAGIGAAFGGASQTFFGSSGATPFLAKLTAAAAI 79

Query: 56 FFFATSIALGMISRYTSTR 74
           F  TS+AL  I       
Sbjct: 80 LFMVTSLALTFIGHQGGAS 98


>gi|15612241|ref|NP_223894.1| preprotein translocase subunit SecG [Helicobacter pylori J99]
 gi|10720278|sp|Q9ZJX2|SECG_HELPJ RecName: Full=Protein-export membrane protein secG
 gi|4155798|gb|AAD06774.1| PROTEIN-EXPORT MEMBRANE PROTEIN [Helicobacter pylori J99]
          Length = 198

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 13/103 (12%), Positives = 27/103 (26%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG              +   K
Sbjct: 29  GLGAYSGSNDSLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSVLDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +           +   +   + +   L+             K 
Sbjct: 89  ELSPLVPATGTLNPTLNPTLNPTLNPLEQAPTNPLMPTQTPKE 131


>gi|294501758|ref|YP_003565458.1| preprotein translocase subunit SecG [Bacillus megaterium QM
          B1551]
 gi|295707108|ref|YP_003600183.1| preprotein translocase subunit SecG [Bacillus megaterium DSM 319]
 gi|294351695|gb|ADE72024.1| preprotein translocase, SecG subunit [Bacillus megaterium QM
          B1551]
 gi|294804767|gb|ADF41833.1| preprotein translocase, SecG subunit [Bacillus megaterium DSM
          319]
          Length = 77

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 33/75 (44%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M   L+ + +IV + L+ V+++QSS       +  G +         R     L R T +
Sbjct: 1  MHTLLITLLVIVSIALIVVVVLQSSKTTGLSGAISGGAETLFGKQKARGIDLVLHRLTVV 60

Query: 53 LAFFFFATSIALGMI 67
          L+  FF  ++A+   
Sbjct: 61 LSILFFVLTLAVSYF 75


>gi|217976696|ref|YP_002360843.1| preprotein translocase, SecG subunit [Methylocella silvestris BL2]
 gi|217502072|gb|ACK49481.1| preprotein translocase, SecG subunit [Methylocella silvestris BL2]
          Length = 123

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 36/125 (28%), Positives = 57/125 (45%), Gaps = 4/125 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS--TAHSLGRFTAILAFFFF 58
           MQ  L+V+HL++VV LV  +L+Q S+  A G       +     A+ L R TAILA  FF
Sbjct: 1   MQTVLIVIHLMIVVALVVTVLLQRSEGGALGVGGGGGFMTGRGQANVLTRATAILAALFF 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           ATS+ L  +++Y  T+   ++ + +  +  +             LD +         A  
Sbjct: 61  ATSLGLTALAKY--TQAPSSILQHVPAAAPEPNAPAAPSTGGGLLDQLKQLEDQRQSAPP 118

Query: 119 RSSSR 123
            S  R
Sbjct: 119 ASPPR 123


>gi|119471551|ref|ZP_01613965.1| protein-export membrane protein secG(General Secretory Pathway)
          [Alteromonadales bacterium TW-7]
 gi|119445494|gb|EAW26780.1| protein-export membrane protein secG(General Secretory Pathway)
          [Alteromonadales bacterium TW-7]
          Length = 117

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 29/78 (37%), Gaps = 6/78 (7%)

Query: 18 CVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYT 71
           ++LIQ    +  GSS                + + + T  LA  FF  SI LG ++   
Sbjct: 18 GMVLIQQGKGADMGSSFGAGASGTVFGSSGAGNFMTKTTTSLATVFFVLSIVLGNLTAGQ 77

Query: 72 STRYKDNMHRSLVDSIKD 89
            +  +  +     +I+ 
Sbjct: 78 IKQTDEWENLEAAPAIET 95


>gi|125972668|ref|YP_001036578.1| preprotein translocase, SecG subunit [Clostridium thermocellum
          ATCC 27405]
 gi|125712893|gb|ABN51385.1| preprotein translocase, SecG subunit [Clostridium thermocellum
          ATCC 27405]
          Length = 83

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 8/79 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          MQI + ++HLI  + L+ ++L+QS        S  G +  F      R+    LG++TA+
Sbjct: 5  MQIAVTILHLIFSISLIVIVLLQSGRRAGLSGSIAGGAETFFGKNKGRTIDAILGKYTAV 64

Query: 53 LAFFFFATSIALGMISRYT 71
           A  F  TS+ L +I    
Sbjct: 65 AAIGFLITSVVLQLIINSK 83


>gi|307244692|ref|ZP_07526795.1| preprotein translocase, SecG subunit [Peptostreptococcus stomatis
          DSM 17678]
 gi|306491943|gb|EFM63993.1| preprotein translocase, SecG subunit [Peptostreptococcus stomatis
          DSM 17678]
          Length = 76

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 31/71 (43%), Gaps = 6/71 (8%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDS------SAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
            LM + + + + ++ V+L Q S            SS  +   +     L + T I++  
Sbjct: 4  NILMAIQIFLSIVMIIVVLPQQSKQNQPQVFIEDSSSQAYFKPKGKEAFLNKMTKIVSIL 63

Query: 57 FFATSIALGMI 67
          FF  +IAL M+
Sbjct: 64 FFINAIALVMV 74


>gi|114565842|ref|YP_752996.1| preprotein translocase subunit SecG [Syntrophomonas wolfei subsp.
          wolfei str. Goettingen]
 gi|114336777|gb|ABI67625.1| preprotein translocase, SecG subunit [Syntrophomonas wolfei
          subsp. wolfei str. Goettingen]
          Length = 77

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 33/74 (44%), Gaps = 7/74 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS-------VRSTAHSLGRFTAIL 53
          ++  ++++ +I  +GL+  IL+QS  S+    S             +     L + TA +
Sbjct: 2  LKTIILILQVICALGLISTILLQSGKSAGLSGSIAGAGETIFGGKKKGLDDLLAKITAYV 61

Query: 54 AFFFFATSIALGMI 67
          A  F   ++ L ++
Sbjct: 62 AVLFMILTLTLAIM 75


>gi|58040708|ref|YP_192672.1| hypothetical protein GOX2283 [Gluconobacter oxydans 621H]
 gi|58003122|gb|AAW62016.1| Hypothetical protein GOX2283 [Gluconobacter oxydans 621H]
          Length = 113

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 5/66 (7%)

Query: 17 VCVILIQSSDSSAFGS-----SSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYT 71
          + VILIQ S+    G        +F S R TA  L R T++LA  F    + L +++R  
Sbjct: 17 IGVILIQRSEGGGLGIGSGQGMGSFMSGRGTATLLTRATSVLAGIFMLLCLVLAVMNRGA 76

Query: 72 STRYKD 77
          S+    
Sbjct: 77 SSGVGS 82


>gi|319783644|ref|YP_004143120.1| preprotein translocase, SecG subunit [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
 gi|317169532|gb|ADV13070.1| preprotein translocase, SecG subunit [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
          Length = 156

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 35/88 (39%), Positives = 52/88 (59%), Gaps = 3/88 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          M+  L+V+HL+VV+ LV V+L+Q S+    G      F + R  A++L R TAILA  FF
Sbjct: 1  METVLIVIHLMVVLALVGVVLLQRSEGGGLGIGGGSGFMTARGAANALTRATAILAAAFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDS 86
          ATS+ L +++RY   +  D + R    S
Sbjct: 61 ATSLTLSIVARY-GEKPIDILDRVPATS 87


>gi|225175326|ref|ZP_03729321.1| preprotein translocase, SecG subunit [Dethiobacter alkaliphilus
          AHT 1]
 gi|225169078|gb|EEG77877.1| preprotein translocase, SecG subunit [Dethiobacter alkaliphilus
          AHT 1]
          Length = 76

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 34/76 (44%), Gaps = 7/76 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-------FTSVRSTAHSLGRFTAIL 53
          M++ L +V+L+  +G++  +L+QS  S+    +         F   +     L + T + 
Sbjct: 1  MEVVLNLVYLVAAIGMIASVLMQSGKSAGMSGAFGGGGAQSAFGKKKGVDDFLSKLTIVF 60

Query: 54 AFFFFATSIALGMISR 69
          A  F   +I L  +S 
Sbjct: 61 AVLFMVLAIVLTSLSA 76


>gi|288927897|ref|ZP_06421744.1| preprotein translocase, SecG subunit [Prevotella sp. oral taxon
          317 str. F0108]
 gi|288330731|gb|EFC69315.1| preprotein translocase, SecG subunit [Prevotella sp. oral taxon
          317 str. F0108]
          Length = 122

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/79 (18%), Positives = 29/79 (36%), Gaps = 4/79 (5%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFFF 57
              +V+ +I  V ++ ++LIQ S      S  +       VR T   + + T  LA   
Sbjct: 3  YSLFVVLIVIAAVLMIAIVLIQESKGGGLSSQFSSSNSIMGVRKTTDVVEKTTWGLAIAM 62

Query: 58 FATSIALGMISRYTSTRYK 76
             S+    ++  +     
Sbjct: 63 VVFSVVCAYVAPKSLAETS 81


>gi|256848063|ref|ZP_05553507.1| preprotein translocase, SecG subunit [Lactobacillus coleohominis
          101-4-CHN]
 gi|256715123|gb|EEU30100.1| preprotein translocase, SecG subunit [Lactobacillus coleohominis
          101-4-CHN]
          Length = 79

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 9/79 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHS---LGRFTA 51
          MQ  LM + LI  V L+  +++Q +       S+  G + +  S R        +   T 
Sbjct: 1  MQSMLMTLFLIDCVVLIACVMMQPAKNDNDAMSALTGGAGDLFSRRKARGFEAVMQIVTT 60

Query: 52 ILAFFFFATSIALGMISRY 70
          I+   FF  ++AL  +S +
Sbjct: 61 IVGALFFILALALVYVSAH 79


>gi|225570840|ref|ZP_03779863.1| hypothetical protein CLOHYLEM_06944 [Clostridium hylemonae DSM
          15053]
 gi|225160302|gb|EEG72921.1| hypothetical protein CLOHYLEM_06944 [Clostridium hylemonae DSM
          15053]
          Length = 89

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 29/71 (40%), Gaps = 7/71 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF-------TSVRSTAHSLGRFTAIL 53
          ++  L+++  I  + L  ++L+Q   S+  G+              RS   +L + T  L
Sbjct: 13 LKTILLIIFAIDCIALAAIVLLQEGKSAGLGTIGGMADTYWGQNKGRSMEGALVKSTKFL 72

Query: 54 AFFFFATSIAL 64
          A  F   +  L
Sbjct: 73 AILFIVLAAVL 83


>gi|289578737|ref|YP_003477364.1| preprotein translocase, SecG subunit [Thermoanaerobacter italicus
          Ab9]
 gi|289528450|gb|ADD02802.1| preprotein translocase, SecG subunit [Thermoanaerobacter italicus
          Ab9]
          Length = 79

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 31/75 (41%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS--------SSNFTSVRSTAHSLGRFTAI 52
          ++  LM + ++V + L+ VIL+Q   S+                   R+    L + T I
Sbjct: 2  LKTVLMGIQILVSIFLIVVILLQKGRSAGISGVIAGGAETFFGKNKARTMEGVLEKLTTI 61

Query: 53 LAFFFFATSIALGMI 67
           A  F   S+ L ++
Sbjct: 62 AAVLFIILSMVLTVM 76


>gi|253580867|ref|ZP_04858130.1| preprotein translocase, SecG subunit [Ruminococcus sp.
          5_1_39B_FAA]
 gi|251847937|gb|EES75904.1| preprotein translocase, SecG subunit [Ruminococcus sp.
          5_1_39BFAA]
          Length = 78

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 30/72 (41%), Gaps = 7/72 (9%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF-------TSVRSTAHSLGRFTAILAFF 56
           L V+ +I  + L  V+L+Q       G+ +            RS    L + T I+   
Sbjct: 7  ILSVIFIIDCIALTVVVLMQEGKQQGLGAIAGAAETYWGKNKGRSMEGGLVKATTIMGIL 66

Query: 57 FFATSIALGMIS 68
          FF  S+AL M+ 
Sbjct: 67 FFVISVALNMLG 78


>gi|294624679|ref|ZP_06703349.1| protein-export membrane protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294666778|ref|ZP_06732012.1| protein-export membrane protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292601035|gb|EFF45102.1| protein-export membrane protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292603439|gb|EFF46856.1| protein-export membrane protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 135

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 10/77 (12%), Positives = 25/77 (32%)

Query: 35  NFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN 94
                +  ++ L + T  LA  FF+ S+ +   + + +     N+      +        
Sbjct: 20  TVFGSQGASNFLSKSTKWLAVVFFSISLFMAWYATHGARPTDQNLGVMSQSATPAPAAAG 79

Query: 95  FGDGSSPKLDSVSAKSS 111
                 P+  +  A  +
Sbjct: 80  ELTQPLPQAPAAGAVPT 96


>gi|210135414|ref|YP_002301853.1| preprotein translocase subunit SecG [Helicobacter pylori P12]
 gi|210133382|gb|ACJ08373.1| preprotein translocase subunit SecG [Helicobacter pylori P12]
          Length = 201

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 13/102 (12%), Positives = 26/102 (25%), Gaps = 8/102 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG              +   K
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSILDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGK 118
           D           +   +   + +   L+              
Sbjct: 89  DLSPLVPATGTLNPTLNPTLNPTLNPLEQAPTNPLMPKQTPD 130


>gi|323340207|ref|ZP_08080471.1| preprotein translocase subunit SecG [Lactobacillus ruminis ATCC
          25644]
 gi|323092398|gb|EFZ35006.1| preprotein translocase subunit SecG [Lactobacillus ruminis ATCC
          25644]
          Length = 78

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 35/78 (44%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV--------RSTAHSLGRFTAI 52
          M   L+ + +I  V ++  +++Q + +    ++ +  +         R     + + T +
Sbjct: 1  MYNTLLTLLMIDSVLIIISVMMQPAKTDNASTALSGGAADLFSKQKPRGFEAFMQKVTTV 60

Query: 53 LAFFFFATSIALGMISRY 70
          L   FFA ++AL  IS +
Sbjct: 61 LGIVFFALALALVYISSH 78


>gi|317178451|dbj|BAJ56239.1| preprotein translocase subunit SecG [Helicobacter pylori F30]
          Length = 199

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 12/103 (11%), Positives = 27/103 (26%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRY--------K 76
              +  GS+ +    +  A  + + T  L   F   +IALG       ++         K
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYSKSILDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +           +   +   + +   L+               
Sbjct: 89  ELSPLVPATGTLNPTLNPTLNPTLNPLEQAPTNPLMPKQTPNE 131


>gi|308067017|ref|YP_003868622.1| Probable protein-export membrane protein secG [Paenibacillus
          polymyxa E681]
 gi|305856296|gb|ADM68084.1| Probable protein-export membrane protein secG [Paenibacillus
          polymyxa E681]
          Length = 77

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 35/77 (45%), Gaps = 8/77 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF--------TSVRSTAHSLGRFTAI 52
          M+IFL V+ ++  + ++ V+L+Q   S+    + +         T  R     L R TA+
Sbjct: 1  MEIFLKVLLVVFSIAVIAVVLLQKGKSAGLSGAISGGAEHLFGKTKARGMDLILQRATAV 60

Query: 53 LAFFFFATSIALGMISR 69
          L   F   S+ +   ++
Sbjct: 61 LGAGFMIVSVLVAFFAK 77


>gi|291277174|ref|YP_003516946.1| putative protein-export membrane protein [Helicobacter mustelae
           12198]
 gi|290964368|emb|CBG40218.1| putative protein-export membrane protein [Helicobacter mustelae
           12198]
          Length = 116

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 14/83 (16%), Positives = 24/83 (28%), Gaps = 3/83 (3%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLV 84
                 GS+ +    +  A  L + T  L   F   +++LG +  Y     +        
Sbjct: 29  GLGVYSGSNESLFGAKGPAGFLAKLTFFLGILFLINTVSLGYL--YNKDYGRSITDNVEK 86

Query: 85  DSIKDQGNDNFGDGSSPKLDSVS 107
            S+  Q          P   S  
Sbjct: 87  KSLIPQNPFENKLQ-LPATPSAP 108


>gi|154250389|ref|YP_001411214.1| preprotein translocase, SecG subunit [Fervidobacterium nodosum
          Rt17-B1]
 gi|154154325|gb|ABS61557.1| preprotein translocase, SecG subunit [Fervidobacterium nodosum
          Rt17-B1]
          Length = 77

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 29/73 (39%), Gaps = 6/73 (8%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRSTA-HSLGRFTAILAFFF 57
           L+VVH I+ VGL+ ++L + S       +    ++     R     + G+ T  LA  F
Sbjct: 5  VLIVVHTIIAVGLIWMVLQEMSKFAELGGAFGSGAAYTMFGRKKGLDTSGKITVALAIAF 64

Query: 58 FATSIALGMISRY 70
          F        +   
Sbjct: 65 FVMCFLTSWVLSR 77


>gi|295689358|ref|YP_003593051.1| preprotein translocase subunit SecG [Caulobacter segnis ATCC 21756]
 gi|295431261|gb|ADG10433.1| preprotein translocase, SecG subunit [Caulobacter segnis ATCC
           21756]
          Length = 171

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/122 (18%), Positives = 49/122 (40%), Gaps = 3/122 (2%)

Query: 4   FLMVVHLIVVVGLVCVILIQSSD---SSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
            L+ ++++V +GL+ V+L+Q S+       G SS+F + R     L R T IL   F   
Sbjct: 5   VLLAINIVVCLGLIGVVLLQRSEGGALGMGGGSSSFMTARGAGDLLTRITWILFSIFLLI 64

Query: 61  SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120
           S+ L +++   ++         + +      N      +         ++ +  +     
Sbjct: 65  SLTLTILTGRLNSGGSVVDRLDIQNLDSKALNAAPAAPAPADAAPGPIQAPAPQLNTPAP 124

Query: 121 SS 122
           ++
Sbjct: 125 TA 126


>gi|317014646|gb|ADU82082.1| preprotein translocase subunit SecG [Helicobacter pylori
           Gambia94/24]
          Length = 200

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/103 (11%), Positives = 26/103 (25%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG              +   K
Sbjct: 29  GLGAYSGSNDSLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSVLDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +           +   +   + +   L+               
Sbjct: 89  ELSPLVPATGTLNPTLNPTLNPTLNPLEQAPTNPLMPTQTPNE 131


>gi|15965192|ref|NP_385545.1| preprotein translocase subunit SecG [Sinorhizobium meliloti 1021]
 gi|307309206|ref|ZP_07588877.1| preprotein translocase, SecG subunit [Sinorhizobium meliloti
          BL225C]
 gi|307321536|ref|ZP_07600931.1| preprotein translocase, SecG subunit [Sinorhizobium meliloti
          AK83]
 gi|15074372|emb|CAC46018.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306892843|gb|EFN23634.1| preprotein translocase, SecG subunit [Sinorhizobium meliloti
          AK83]
 gi|306900352|gb|EFN30968.1| preprotein translocase, SecG subunit [Sinorhizobium meliloti
          BL225C]
          Length = 161

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 3/90 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V++L+VVV L+ V+LIQ S+    G      F S R TA++L R TA+LAF FF
Sbjct: 1  MQTVLLVIYLMVVVALIGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAVLAFLFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
          A ++A+G++SRY   +  D + R    S  
Sbjct: 61 ALALAMGILSRYEP-QATDILDRIPGTSSS 89


>gi|307637927|gb|ADN80377.1| Preprotein translocase subunit [Helicobacter pylori 908]
 gi|325996530|gb|ADZ51935.1| Preprotein translocase subunit [Helicobacter pylori 2018]
 gi|325998119|gb|ADZ50327.1| Preprotein translocase subunit [Helicobacter pylori 2017]
          Length = 195

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/103 (12%), Positives = 27/103 (26%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG              +   K
Sbjct: 29  GLGAYSGSNDSLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSVLDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +           +   +   + +   L+             K 
Sbjct: 89  ELSPLVPATGTLNPTLNPTLNPTLNPLEQAPTNPLMPTQTPKE 131


>gi|323488678|ref|ZP_08093920.1| hypothetical protein GPDM_05019 [Planococcus donghaensis MPA1U2]
 gi|323397696|gb|EGA90500.1| hypothetical protein GPDM_05019 [Planococcus donghaensis MPA1U2]
          Length = 75

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 8/73 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   LM + +IV + L+ V+L+QS  S+    + +  +         R     L R T +
Sbjct: 1  MHTLLMTLLVIVSLALIVVVLLQSGKSAGLSGAISGGAEQLFGKQKARGLDLVLHRVTIV 60

Query: 53 LAFFFFATSIALG 65
          LA  FF  +IA+ 
Sbjct: 61 LAALFFILAIAVT 73


>gi|291549471|emb|CBL25733.1| protein translocase, SecG subunit [Ruminococcus torques L2-14]
          Length = 80

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 31/71 (43%), Gaps = 7/71 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF-------TSVRSTAHSLGRFTAIL 53
          ++I L ++ +I  + L  +IL+Q   S+  G+              RS   +L + T  L
Sbjct: 4  LKIVLYIIFVIDCIALSAIILLQEGKSAGLGTIGGMADTYWGQNKGRSMEGALVKSTKFL 63

Query: 54 AFFFFATSIAL 64
          A  F   ++ L
Sbjct: 64 AILFLVLAVVL 74


>gi|303228918|ref|ZP_07315728.1| preprotein translocase, SecG subunit [Veillonella atypica
          ACS-134-V-Col7a]
 gi|303231493|ref|ZP_07318223.1| preprotein translocase, SecG subunit [Veillonella atypica
          ACS-049-V-Sch6]
 gi|302513836|gb|EFL55848.1| preprotein translocase, SecG subunit [Veillonella atypica
          ACS-049-V-Sch6]
 gi|302516332|gb|EFL58264.1| preprotein translocase, SecG subunit [Veillonella atypica
          ACS-134-V-Col7a]
          Length = 78

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 7/77 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSV--RSTAHSLGRFTAIL 53
          M  FLMV+ +IV + L+ V++ Q+S       +  G++ +      R     L R T IL
Sbjct: 1  MTNFLMVLEIIVSILLIVVVIAQTSKSSGMGGAVSGAADSTFGGKERGLDGFLSRCTIIL 60

Query: 54 AFFFFATSIALGMISRY 70
             F   S+ LG +   
Sbjct: 61 GIIFAVLSLVLGAMINQ 77


>gi|330996808|ref|ZP_08320680.1| preprotein translocase, SecG subunit [Paraprevotella xylaniphila
          YIT 11841]
 gi|329572530|gb|EGG54181.1| preprotein translocase, SecG subunit [Paraprevotella xylaniphila
          YIT 11841]
          Length = 123

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 37/98 (37%), Gaps = 4/98 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          M   L+V+ +I+ + +  V+LIQ S       +F +S+    VR T   + + T  LA  
Sbjct: 1  MYTVLVVLIVILAILMCLVVLIQESKGGGLASSFSASNQIMGVRKTTDVIEKLTWGLAAA 60

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN 94
              S+         +T     M  +      +  N  
Sbjct: 61 MVVLSVVSVFFIPKVATEESAMMKAATEQKAVNSNNLP 98


>gi|311031861|ref|ZP_07709951.1| hypothetical protein Bm3-1_15232 [Bacillus sp. m3-13]
          Length = 76

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 37/76 (48%), Gaps = 8/76 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M +FL ++ +IV + L+ V+L+QS  S+    + +  +         R     L R T +
Sbjct: 1  MTLFLTILLIIVAISLITVVLLQSGKSAGLSGAISGGAESLFGKQKARGLDLVLHRATVV 60

Query: 53 LAFFFFATSIALGMIS 68
          L+  FF  ++++   +
Sbjct: 61 LSVLFFVLTLSIAYFA 76


>gi|153955986|ref|YP_001396751.1| hypothetical protein CKL_3377 [Clostridium kluyveri DSM 555]
 gi|146348844|gb|EDK35380.1| Hypothetical protein CKL_3377 [Clostridium kluyveri DSM 555]
          Length = 77

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 9/76 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD---------SSAFGSSSNFTSVRSTAHSLGRFTA 51
          M IFL++  L++ V L+CVIL+Q                 S  +    R++   L R T 
Sbjct: 1  MHIFLIIAQLVIGVMLICVILMQPGKTNGLSGFISGGPSESFYSKNKSRTSEAMLSRITV 60

Query: 52 ILAFFFFATSIALGMI 67
          +LA  F A  I   MI
Sbjct: 61 VLAILFAAICIVQTMI 76


>gi|224372140|ref|YP_002606512.1| protein-export membrane protein SecG [Nautilia profundicola AmH]
 gi|223588803|gb|ACM92539.1| protein-export membrane protein SecG [Nautilia profundicola AmH]
          Length = 107

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 9/84 (10%), Positives = 20/84 (23%), Gaps = 6/84 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLV 84
              +   S+      +   + L + T IL   F   ++ L  +    +      +    V
Sbjct: 29  GLGAYSSSNDTVFGAKGPMNFLTKATMILGLLFVLNTLTLVYLYNKQAN--TSALDEVKV 86

Query: 85  DSIKDQGNDNFGDGSSPKLDSVSA 108
                           P +     
Sbjct: 87  QKTTPTPKTPA----VPSVPQAPT 106


>gi|218900252|ref|YP_002448663.1| preprotein translocase, SecG subunit [Bacillus cereus G9842]
 gi|228903604|ref|ZP_04067725.1| protein-export membrane protein secG [Bacillus thuringiensis IBL
          4222]
 gi|228942264|ref|ZP_04104803.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar berliner ATCC 10792]
 gi|228968211|ref|ZP_04129210.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar sotto str. T04001]
 gi|228975194|ref|ZP_04135752.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar thuringiensis str. T01001]
 gi|228981832|ref|ZP_04142127.1| protein-export membrane protein secG [Bacillus thuringiensis
          Bt407]
 gi|218544650|gb|ACK97044.1| preprotein translocase, SecG subunit [Bacillus cereus G9842]
 gi|228777944|gb|EEM26216.1| protein-export membrane protein secG [Bacillus thuringiensis
          Bt407]
 gi|228784473|gb|EEM32494.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar thuringiensis str. T01001]
 gi|228791474|gb|EEM39077.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar sotto str. T04001]
 gi|228817308|gb|EEM63394.1| protein-export membrane protein secG [Bacillus thuringiensis
          serovar berliner ATCC 10792]
 gi|228856033|gb|EEN00572.1| protein-export membrane protein secG [Bacillus thuringiensis IBL
          4222]
 gi|326942919|gb|AEA18815.1| preprotein translocase subunit SecG [Bacillus thuringiensis
          serovar chinensis CT-43]
          Length = 77

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L V+ + V + ++ ++L+QSS+SS    + +  +         R     L R T +
Sbjct: 1  MHTLLSVLLITVSILMIVMVLMQSSNSSGLSGAISGGAEQLFGKQKARGIEAVLNRITIV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +IA+  +
Sbjct: 61 LAVLFFVLTIAVTYL 75


>gi|325263483|ref|ZP_08130217.1| preprotein translocase, SecG subunit [Clostridium sp. D5]
 gi|324031192|gb|EGB92473.1| preprotein translocase, SecG subunit [Clostridium sp. D5]
          Length = 80

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 7/71 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-------NFTSVRSTAHSLGRFTAIL 53
          ++I L ++ +I  + L  +IL+Q   S+  G+ S            RS   +L + T  L
Sbjct: 4  LKIILTIIFVIDCIALSAIILLQEGKSAGLGTISGAADSYWGQNKGRSMEGALVKSTKFL 63

Query: 54 AFFFFATSIAL 64
          A  F   ++ L
Sbjct: 64 AILFMVLALVL 74


>gi|288573192|ref|ZP_06391549.1| preprotein translocase, SecG subunit [Dethiosulfovibrio
          peptidovorans DSM 11002]
 gi|288568933|gb|EFC90490.1| preprotein translocase, SecG subunit [Dethiosulfovibrio
          peptidovorans DSM 11002]
          Length = 74

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 33/74 (44%), Gaps = 7/74 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA-------HSLGRFTAIL 53
          M+  L +VH+++ + L+ V+L+Q      FG      S              L + T ++
Sbjct: 1  MKTTLAIVHILLCLVLMAVVLMQHRKQGGFGGIFGGGSQADMGSNQWQRFTGLTKITVVV 60

Query: 54 AFFFFATSIALGMI 67
             F  TS+AL ++
Sbjct: 61 TTLFMVTSVALVVL 74


>gi|150006863|ref|YP_001301606.1| preprotein translocase subunit SecG [Parabacteroides distasonis
           ATCC 8503]
 gi|255016106|ref|ZP_05288232.1| preprotein translocase subunit SecG [Bacteroides sp. 2_1_7]
 gi|256842526|ref|ZP_05548028.1| preprotein translocase subunit SecG [Parabacteroides sp. D13]
 gi|298377288|ref|ZP_06987241.1| preprotein translocase, SecG subunit [Bacteroides sp. 3_1_19]
 gi|149935287|gb|ABR41984.1| putative protein-export membrane protein [Parabacteroides
           distasonis ATCC 8503]
 gi|256735882|gb|EEU49214.1| preprotein translocase subunit SecG [Parabacteroides sp. D13]
 gi|298265702|gb|EFI07362.1| preprotein translocase, SecG subunit [Bacteroides sp. 3_1_19]
          Length = 127

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 38/105 (36%), Gaps = 4/105 (3%)

Query: 23  QSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDN 78
           Q+S        F SS+    VR T   L + T  LA      SI +           +  
Sbjct: 23  QNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWSLAGTVIVLSILITAFIPRAEHAAQSE 82

Query: 79  MHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSSR 123
           + + + D+I    N    D  + +  +V A+ + +       S+R
Sbjct: 83  IKQQVNDAISIDPNTIAPDFGTAQQPAVPAEETPATTTPAEESNR 127


>gi|208435149|ref|YP_002266815.1| protein translocation protein [Helicobacter pylori G27]
 gi|208433078|gb|ACI27949.1| protein translocation protein [Helicobacter pylori G27]
          Length = 197

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 11/111 (9%), Positives = 29/111 (26%), Gaps = 10/111 (9%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY----------TSTR 74
              +  GS+ +    +  A  + + T  L   F   +IALG                + +
Sbjct: 29  GLGAYSGSNDSLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSILDETKTNK 88

Query: 75  YKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSSRTK 125
               +  +                 +P    +  ++   +      +   +
Sbjct: 89  DLSPLVPATGTLNPTLNPTLNPLEQAPTNPLMPKQTPDELPKEPAKAPSVE 139


>gi|291336815|gb|ADD96349.1| hypothetical protein [uncultured organism MedDCM-OCT-S08-C727]
          Length = 103

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 51/99 (51%), Gaps = 6/99 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
          MQ  ++ +H+I+ V L+ ++L+Q    +        G+SS     R +A  + + T ++A
Sbjct: 1  MQTAILTIHIILAVILIILVLVQQGKGADAGAAFGSGASSTVFGARGSATFMNKVTTVIA 60

Query: 55 FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
            FF TS++L  IS   S+  K  ++ ++ +   D+  +
Sbjct: 61 LCFFVTSLSLAYISSNKSSGSKSLINDTVQEGNIDKQEE 99


>gi|219856327|ref|YP_002473449.1| hypothetical protein CKR_2984 [Clostridium kluyveri NBRC 12016]
 gi|219570051|dbj|BAH08035.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 80

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 9/76 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD---------SSAFGSSSNFTSVRSTAHSLGRFTA 51
          M IFL++  L++ V L+CVIL+Q                 S  +    R++   L R T 
Sbjct: 4  MHIFLIIAQLVIGVMLICVILMQPGKTNGLSGFISGGPSESFYSKNKSRTSEAMLSRITV 63

Query: 52 ILAFFFFATSIALGMI 67
          +LA  F A  I   MI
Sbjct: 64 VLAILFAAICIVQTMI 79


>gi|149072002|ref|YP_001293568.1| preprotein translocase SecG subunit [Rhodomonas salina]
 gi|134302953|gb|ABO70757.1| preprotein translocase SecG subunit [Rhodomonas salina]
          Length = 69

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 27/61 (44%), Gaps = 1/61 (1%)

Query: 10 LIVVVGLVCVILIQSSDS-SAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMIS 68
          ++  + L+  I+I +  S    G +      RS   +L + T  L   FF  +I L  +S
Sbjct: 7  ILCSIFLILSIMIHNPKSQGMGGQNQIMNGTRSAEETLNKVTWTLITIFFVLTIYLATLS 66

Query: 69 R 69
          +
Sbjct: 67 K 67


>gi|315453413|ref|YP_004073683.1| Preprotein translocase subunit SecG [Helicobacter felis ATCC 49179]
 gi|315132465|emb|CBY83093.1| Preprotein translocase subunit SecG [Helicobacter felis ATCC 49179]
          Length = 123

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/102 (21%), Positives = 41/102 (40%), Gaps = 6/102 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   L+V+ +I+ + +V V+L+Q S      +  GS+ +    +  A  L + T  L F 
Sbjct: 1   MSSVLLVLQIILSLLIVVVVLLQKSASIGLGAYSGSNESLFGAKGPASFLTKLTMFLGFL 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
           F A +I LG             +  + V  +     +   + 
Sbjct: 61  FLANTITLGYFYNKEYN--TSILDSAKVAPLIPSVPNAPKNP 100


>gi|297544975|ref|YP_003677277.1| preprotein translocase, SecG subunit [Thermoanaerobacter
          mathranii subsp. mathranii str. A3]
 gi|296842750|gb|ADH61266.1| preprotein translocase, SecG subunit [Thermoanaerobacter
          mathranii subsp. mathranii str. A3]
          Length = 79

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 32/75 (42%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS--------SSNFTSVRSTAHSLGRFTAI 52
          ++  LM + ++V + L+ VIL+Q   S+                   R+   +L + T I
Sbjct: 2  LKTVLMGIQILVSIFLIVVILLQKGRSAGISGVIAGGAETFFGKNKARTMEGTLEKLTTI 61

Query: 53 LAFFFFATSIALGMI 67
           A  F   S+ L ++
Sbjct: 62 AAVLFIILSMVLTVM 76


>gi|300857053|ref|YP_003782037.1| hypothetical protein CLJU_c39100 [Clostridium ljungdahlii DSM
          13528]
 gi|300437168|gb|ADK16935.1| hypothetical protein CLJU_c39100 [Clostridium ljungdahlii DSM
          13528]
          Length = 77

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 9/76 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD---------SSAFGSSSNFTSVRSTAHSLGRFTA 51
          M IFL+++ LI+   L+ VIL+Q              A  S  +    R++   L R T 
Sbjct: 1  MHIFLVILQLIIGAVLIAVILVQPGKTNGLSGLISGGAGESFYSRNKSRTSEAMLVRTTV 60

Query: 52 ILAFFFFATSIALGMI 67
          ILA  F    +    I
Sbjct: 61 ILAILFAIICVVQNFI 76


>gi|317182504|dbj|BAJ60288.1| preprotein translocase subunit SecG [Helicobacter pylori F57]
          Length = 200

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/103 (12%), Positives = 27/103 (26%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG              +   K
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVVNTIALGYFYNKEYGKSILDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +           +   +   + +   L+ V             
Sbjct: 89  ELSPLVPATGTLNPTLNPTLNPTLNPLEQVPTNPLIPKQTPNE 131


>gi|108563624|ref|YP_627940.1| preprotein translocase subunit SecG [Helicobacter pylori HPAG1]
 gi|107837397|gb|ABF85266.1| protein translocation protein [Helicobacter pylori HPAG1]
          Length = 196

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 11/101 (10%), Positives = 25/101 (24%), Gaps = 6/101 (5%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRY------KDN 78
              +  GS+ +    +  A  + + T  L   F   +IALG        +        + 
Sbjct: 31  GLGAYSGSNDSLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSILDETKTNL 90

Query: 79  MHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
                     +   +   + +   L+               
Sbjct: 91  SPLVPTTGTLNPTLNPTLNPTLNPLEQAPTNPLMPKQTPNE 131


>gi|241889386|ref|ZP_04776687.1| preprotein translocase, SecG subunit [Gemella haemolysans ATCC
          10379]
 gi|241863929|gb|EER68310.1| preprotein translocase, SecG subunit [Gemella haemolysans ATCC
          10379]
          Length = 76

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 30/74 (40%), Gaps = 7/74 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-------SSAFGSSSNFTSVRSTAHSLGRFTAIL 53
          M  FLM + ++  + L+ V+L+Q S        +           VR     L R T +L
Sbjct: 1  MHTFLMTMAIVSSILLIVVVLLQESKSGGLSGLTGGAEELFGKQKVRGAELVLQRITVVL 60

Query: 54 AFFFFATSIALGMI 67
             FF + + L  +
Sbjct: 61 GLIFFISLVCLTWL 74


>gi|15618974|ref|NP_225260.1| preprotein translocase subunit SecG [Chlamydophila pneumoniae
           CWL029]
 gi|15836597|ref|NP_301121.1| preprotein translocase subunit SecG [Chlamydophila pneumoniae J138]
 gi|16753050|ref|NP_445323.1| preprotein translocase subunit SecG [Chlamydophila pneumoniae AR39]
 gi|33242439|ref|NP_877380.1| preprotein translocase subunit SecG [Chlamydophila pneumoniae
           TW-183]
 gi|4377402|gb|AAD19203.1| hypothetical protein CPn_1066 [Chlamydophila pneumoniae CWL029]
 gi|7189699|gb|AAF38583.1| hypothetical protein CP_0784 [Chlamydophila pneumoniae AR39]
 gi|8979439|dbj|BAA99273.1| hypothetical protein [Chlamydophila pneumoniae J138]
 gi|33236950|gb|AAP99037.1| hypothetical protein CpB1109 [Chlamydophila pneumoniae TW-183]
          Length = 118

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/104 (19%), Positives = 33/104 (31%), Gaps = 5/104 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS-----TAHSLGRFTAILAF 55
           +    + + L + V L  +IL+Q S S   GSS    S  S     T   L + T+  A 
Sbjct: 12  LFYAFLFIFLFLCVILCGLILVQESKSMGLGSSFGVDSGDSVFGVSTPDILKKVTSWCAV 71

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
            F    + L   +     +              D    +    +
Sbjct: 72  AFCIGCLLLSFSTNLLGKKLDAKEFLLPAAEESDTQASSESVEA 115


>gi|256004754|ref|ZP_05429730.1| preprotein translocase, SecG subunit [Clostridium thermocellum
          DSM 2360]
 gi|281416857|ref|ZP_06247877.1| preprotein translocase, SecG subunit [Clostridium thermocellum
          JW20]
 gi|255991347|gb|EEU01453.1| preprotein translocase, SecG subunit [Clostridium thermocellum
          DSM 2360]
 gi|281408259|gb|EFB38517.1| preprotein translocase, SecG subunit [Clostridium thermocellum
          JW20]
 gi|316941096|gb|ADU75130.1| preprotein translocase, SecG subunit [Clostridium thermocellum
          DSM 1313]
          Length = 79

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 8/79 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          MQI + ++HLI  + L+ ++L+QS        S  G +  F      R+    LG++TA+
Sbjct: 1  MQIAVTILHLIFSISLIVIVLLQSGRRAGLSGSIAGGAETFFGKNKGRTIDAILGKYTAV 60

Query: 53 LAFFFFATSIALGMISRYT 71
           A  F  TS+ L +I    
Sbjct: 61 AAIGFLITSVVLQLIINSK 79


>gi|215794648|pdb|3DL8|E Chain E, Structure Of The Complex Of Aquifex Aeolicus Secyeg And
          Bacillus Subtilis Seca
 gi|215794649|pdb|3DL8|F Chain F, Structure Of The Complex Of Aquifex Aeolicus Secyeg And
          Bacillus Subtilis Seca
          Length = 107

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/103 (14%), Positives = 30/103 (29%), Gaps = 9/103 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV-----RSTAHSLGRFTAILAF 55
          M   L+ + +I+ V L+   L+Q        +                  L + T  L  
Sbjct: 1  MYYALLTLFVIIAVVLIISTLLQKGRGDVGAAFGGGMGQSIFGVGGVETILTKATYWLGA 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
           F   ++ L +I           + +S+     +        G
Sbjct: 61 LFLVLALLLSVI----PKEKGSVVEKSVQTEQSEGKGTTQESG 99


>gi|46446436|ref|YP_007801.1| preprotein translocase subunit SecG [Candidatus Protochlamydia
          amoebophila UWE25]
 gi|46400077|emb|CAF23526.1| putative integral membrane component of the sec
          protein-translocation machinery, secG [Candidatus
          Protochlamydia amoebophila UWE25]
          Length = 97

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 38/94 (40%), Gaps = 9/94 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSN-FTSVRSTAHSLGRFTAILAF 55
          +  F + + LI+   L  VIL+Q S      ++FG  S+      STA  L + TA LA 
Sbjct: 4  LYFFTITLFLIICALLCAVILMQESKSSGLGASFGGDSSESLFGTSTADVLKKVTAWLAV 63

Query: 56 FFFATSIALGM----ISRYTSTRYKDNMHRSLVD 85
           F    I L +    + R  +      M R    
Sbjct: 64 IFLTACILLSLWTTALGRSQNNAPAFTMERIESQ 97


>gi|291531320|emb|CBK96905.1| protein translocase, SecG subunit [Eubacterium siraeum 70/3]
          Length = 152

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 35/85 (41%), Gaps = 8/85 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF--------TSVRSTAHSLGRFTAI 52
          ++I   +V ++  V +V V+L+Q +      + +           S RS    L R T I
Sbjct: 4  LEIISAIVLIVACVFIVLVVLMQDTKQGMSQTITGGSADNYYQRNSGRSNEAKLNRLTKI 63

Query: 53 LAFFFFATSIALGMISRYTSTRYKD 77
           A  FF  ++ +  I  Y+    K 
Sbjct: 64 AAVIFFVVALVVNFIVMYSGNFNKS 88


>gi|150396289|ref|YP_001326756.1| preprotein translocase subunit SecG [Sinorhizobium medicae
          WSM419]
 gi|150027804|gb|ABR59921.1| preprotein translocase, SecG subunit [Sinorhizobium medicae
          WSM419]
          Length = 156

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 3/90 (3%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN--FTSVRSTAHSLGRFTAILAFFFF 58
          MQ  L+V++L+VVV L+ V+LIQ S+    G      F S R TA++L R TA+LAF FF
Sbjct: 1  MQTILLVIYLMVVVALIGVVLIQRSEGGGLGIGGGSGFMSARGTANALTRTTAVLAFLFF 60

Query: 59 ATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
          A ++A+G++SRY   +  D + R    S  
Sbjct: 61 ALALAMGILSRYEP-QATDILDRIPGTSSS 89


>gi|15605688|ref|NP_213064.1| protein export membrane protein SecG [Aquifex aeolicus VF5]
 gi|6226125|sp|O66505|SECG_AQUAE RecName: Full=Protein-export membrane protein secG
 gi|2982840|gb|AAC06462.1| protein export membrane protein SecG [Aquifex aeolicus VF5]
          Length = 100

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/103 (14%), Positives = 30/103 (29%), Gaps = 9/103 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV-----RSTAHSLGRFTAILAF 55
          M   L+ + +I+ V L+   L+Q        +                  L + T  L  
Sbjct: 1  MYYALLTLFVIIAVVLIISTLLQKGRGDVGAAFGGGMGQSIFGVGGVETILTKATYWLGA 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
           F   ++ L +I           + +S+     +        G
Sbjct: 61 LFLVLALLLSVI----PKEKGSVVEKSVQTEQSEGKGTTQESG 99


>gi|160892731|ref|ZP_02073521.1| hypothetical protein CLOL250_00262 [Clostridium sp. L2-50]
 gi|156865772|gb|EDO59203.1| hypothetical protein CLOL250_00262 [Clostridium sp. L2-50]
          Length = 80

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 30/73 (41%), Gaps = 10/73 (13%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF----------TSVRSTAHSLGRFTA 51
          +  +MVV++I+ + L  ++L Q   S++  SS                 S    L + T 
Sbjct: 3  KTIIMVVYVIICIALTIIVLSQEGKSASLTSSITGGNYDNSYWGKNKGSSKDAVLRKITT 62

Query: 52 ILAFFFFATSIAL 64
          +L   F   ++ L
Sbjct: 63 VLGVLFIVIALLL 75


>gi|327438848|dbj|BAK15213.1| preprotein translocase subunit SecG [Solibacillus silvestris
          StLB046]
          Length = 75

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 33/73 (45%), Gaps = 8/73 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M     V+ +IV + L+ V+L+QS  S+    + +  +         R     L R T +
Sbjct: 1  MHTLFTVLLIIVAIALIVVVLLQSGKSAGLSGAISGGAEQLFGKQKARGMDLVLHRTTIV 60

Query: 53 LAFFFFATSIALG 65
          L+  FF  ++A+ 
Sbjct: 61 LSVAFFVLALAIT 73


>gi|302390380|ref|YP_003826201.1| protein translocase subunit secG [Thermosediminibacter oceani DSM
          16646]
 gi|302201008|gb|ADL08578.1| protein translocase subunit secG [Thermosediminibacter oceani DSM
          16646]
          Length = 78

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 6/73 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          + I L VV+++V +GL+  +L+QS  S+      A G+ + F   +     L + T I A
Sbjct: 4  LHIVLTVVYILVCIGLIATVLLQSGKSAGLSGTIAGGAETFFGKKKGIDDKLAKITEIFA 63

Query: 55 FFFFATSIALGMI 67
            F A SI + ++
Sbjct: 64 VAFLALSILMMIV 76


>gi|84688023|ref|ZP_01015885.1| Preprotein translocase SecG subunit [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84663963|gb|EAQ10465.1| Preprotein translocase SecG subunit [Rhodobacterales bacterium
           HTCC2654]
          Length = 128

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 38/112 (33%), Gaps = 5/112 (4%)

Query: 18  CVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTST 73
            V+L+Q S+    G          S RS A +L + T IL   F A S+ L +IS   S 
Sbjct: 18  GVVLLQRSEGGGLGMGGGGGGGVMSSRSAATALSKLTWILGIAFLAASLGLTIISARNSA 77

Query: 74  RYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSSRTK 125
                    +  S                 D + +++S        +  R +
Sbjct: 78  D-SSVTDLIVAPSSDAGDATPDAPALPDVTDMMPSQNSDQSSDAPVAPPRAE 128


>gi|288554072|ref|YP_003426007.1| preprotein translocase subunit SecG [Bacillus pseudofirmus OF4]
 gi|288545232|gb|ADC49115.1| preprotein translocase subunit SecG [Bacillus pseudofirmus OF4]
          Length = 76

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          MQ    V+ +IV + L+ V+L+QS  S+    + +  +         R     L R T +
Sbjct: 1  MQTVAFVMLIIVSIALIAVVLLQSGRSAGLSGAISGGAEQLVGKQKARGIDAVLSRATVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +IA+   
Sbjct: 61 LAVLFFVLTIAVAYF 75


>gi|259502759|ref|ZP_05745661.1| protein-export protein SecG [Lactobacillus antri DSM 16041]
 gi|259169262|gb|EEW53757.1| protein-export protein SecG [Lactobacillus antri DSM 16041]
          Length = 74

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 32/74 (43%), Gaps = 9/74 (12%)

Query: 6  MVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHS---LGRFTAILAFF 56
          M + LIV V L+  +++Q +       S+  G + +  S R        +   T I    
Sbjct: 1  MTIFLIVCVILIACVMMQPAKNDNDAMSALTGGAGDLFSRRKARGFEAVMQIVTTICGAL 60

Query: 57 FFATSIALGMISRY 70
          FF  ++AL  +S +
Sbjct: 61 FFILALALVYVSSH 74


>gi|301308685|ref|ZP_07214637.1| preprotein translocase, SecG subunit [Bacteroides sp. 20_3]
 gi|300833209|gb|EFK63827.1| preprotein translocase, SecG subunit [Bacteroides sp. 20_3]
          Length = 126

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 38/102 (37%), Gaps = 4/102 (3%)

Query: 23  QSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDN 78
           Q+S        F SS+    VR T   L + T  LA      SI +      T    +  
Sbjct: 23  QNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWSLAGAVIVLSIVITAFIPRTEHAAQSE 82

Query: 79  MHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120
           + + + D++    N    D  + +  +V A+ + +    + S
Sbjct: 83  IKQQVNDAVSIDPNTIAPDFGTAQQPAVPAEETPATTPAEES 124


>gi|188586624|ref|YP_001918169.1| protein translocase subunit secG [Natranaerobius thermophilus
          JW/NM-WN-LF]
 gi|179351311|gb|ACB85581.1| protein translocase subunit secG [Natranaerobius thermophilus
          JW/NM-WN-LF]
          Length = 77

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 33/75 (44%), Gaps = 6/75 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          +   L+ +H+I+ + L+  +L+QS  S+    + +      F   +     L + T + A
Sbjct: 2  LYSVLVGLHVIITLVLIATVLLQSGKSAGLSGAISGGAETVFGKKKGIDALLSKVTTVTA 61

Query: 55 FFFFATSIALGMISR 69
            F   SI L  +S 
Sbjct: 62 ILFIVNSILLAALSG 76


>gi|88705682|ref|ZP_01103392.1| Preprotein translocase SecG subunit [Congregibacter litoralis KT71]
 gi|88700195|gb|EAQ97304.1| Preprotein translocase SecG subunit [Congregibacter litoralis KT71]
          Length = 148

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 53/137 (38%), Gaps = 14/137 (10%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILAF 55
           +  ++V HL++ + ++ +I+IQ    +  G+S              + + L R TA +  
Sbjct: 7   EQLVLVTHLLLSLAIIGLIIIQQGKGADAGASFGAGASQTVFGSTGSGNVLTRATAWMVT 66

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN--------FGDGSSPKLDSVS 107
            FF TS  L +I++  +    +       +S     + +          +G  P +D   
Sbjct: 67  LFFITSFGLAVIAKNKTAAVDEFAIPLPTNSAPATLDSDMQAVDDMRPAEGDLPVVDDSM 126

Query: 108 AKSSSSVVAGKRSSSRT 124
              S+  +     S++ 
Sbjct: 127 PSMSADGMDDTVDSAQE 143


>gi|258543912|ref|ZP_05704146.1| protein-export membrane protein SecG [Cardiobacterium hominis ATCC
           15826]
 gi|258520851|gb|EEV89710.1| protein-export membrane protein SecG [Cardiobacterium hominis ATCC
           15826]
          Length = 126

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 34  SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
           S     R     L + T  LA  FF  ++ LG +    +  + ++        ++ Q  +
Sbjct: 41  STVFGARGAGSFLYKTTRFLAGIFFVGALLLGYLQNKDAANHGNSSI-LSNTQLETQKQE 99

Query: 94  NFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +  D     +D+     ++ V A  +
Sbjct: 100 SALDIPPVSVDNARPAENTDVPAPAQ 125


>gi|150020086|ref|YP_001305440.1| preprotein translocase, SecG subunit [Thermosipho melanesiensis
          BI429]
 gi|149792607|gb|ABR30055.1| preprotein translocase, SecG subunit [Thermosipho melanesiensis
          BI429]
          Length = 76

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/76 (19%), Positives = 28/76 (36%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRSTA-HSLGRFTAILA 54
          M   ++V+H ++   L+ + L Q         +    + N    R     + G+ T I+ 
Sbjct: 1  MSKVMLVIHGLISALLIYLSLKQMGKFAELGGAFGSGAMNTVFGREKGLDTEGKITVIVG 60

Query: 55 FFFFATSIALGMISRY 70
            FF +SI        
Sbjct: 61 VLFFVSSILTAFFISR 76


>gi|282898325|ref|ZP_06306316.1| Preprotein translocase SecG subunit [Raphidiopsis brookii D9]
 gi|281196856|gb|EFA71761.1| Preprotein translocase SecG subunit [Raphidiopsis brookii D9]
          Length = 77

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 4/67 (5%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFFFF 58
            L V+     +GL+ ++L+ S      G+       F+S +S  ++L R T  LA  F 
Sbjct: 5  NILQVIWAFSALGLIVLVLLHSPKGDGIGAIGGQAQLFSSTKSAENTLNRVTWGLAVIFL 64

Query: 59 ATSIALG 65
            ++ L 
Sbjct: 65 GLTVVLS 71


>gi|254294055|ref|YP_003060078.1| preprotein translocase, SecG subunit [Hirschia baltica ATCC 49814]
 gi|254042586|gb|ACT59381.1| preprotein translocase, SecG subunit [Hirschia baltica ATCC 49814]
          Length = 156

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/129 (21%), Positives = 48/129 (37%), Gaps = 4/129 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS----TAHSLGRFTAILAFF 56
           M+  L+ + L+  + L+  +L+Q S+  A G               A +L R T ILA  
Sbjct: 1   MENALLALSLLSCIALIVTVLLQRSEGGALGMGGGGGGGLVSGRGAADTLVRATMILAAI 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           FF TS+AL  I+   S    D              +      S+    +      S  ++
Sbjct: 61  FFITSLALTRINYEHSKDNSDVTRTLEETGGSLLDDVLGETSSTEGTTTNPTDLISEALS 120

Query: 117 GKRSSSRTK 125
            +  +  T+
Sbjct: 121 EESDTVPTE 129


>gi|167747906|ref|ZP_02420033.1| hypothetical protein ANACAC_02636 [Anaerostipes caccae DSM 14662]
 gi|167652637|gb|EDR96766.1| hypothetical protein ANACAC_02636 [Anaerostipes caccae DSM 14662]
          Length = 78

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 33/73 (45%), Gaps = 9/73 (12%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS---------VRSTAHSLGRFTA 51
          M+  L ++ LI  V L+ ++L+Q    +  GS +  T+          RS   ++ + T 
Sbjct: 1  MKTALTILFLISCVVLIILVLMQEGKEAGLGSLTGSTTSGTYWSKNKGRSREGNIIKATT 60

Query: 52 ILAFFFFATSIAL 64
          +    FF T+  L
Sbjct: 61 LFTVIFFVTAALL 73


>gi|145219917|ref|YP_001130626.1| preprotein translocase subunit SecG [Prosthecochloris
          vibrioformis DSM 265]
 gi|145206081|gb|ABP37124.1| protein translocase subunit secG [Chlorobium phaeovibrioides DSM
          265]
          Length = 112

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 38/95 (40%), Gaps = 10/95 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-------NFTSVRSTAHSLGRFTAIL 53
          M +F++V+ LI  + L+ VI++QS  S +  +             VR T   LGR TAIL
Sbjct: 1  MHVFIVVLGLIASLLLIGVIMLQSPKSGSGLTGGIASLGTVQTMGVRRTGDFLGRVTAIL 60

Query: 54 AFFFFATSIALGMISRYTS---TRYKDNMHRSLVD 85
          A                 +   T  K  +  + V 
Sbjct: 61 AGVVMLLCFIAVFTLPERAGVKTGQKSILQETPVT 95


>gi|56421581|ref|YP_148899.1| preprotein translocase subunit SecG [Geobacillus kaustophilus
          HTA426]
 gi|56381423|dbj|BAD77331.1| protein translocation subunit [Geobacillus kaustophilus HTA426]
 gi|82791239|gb|ABB90596.1| SecG [Geobacillus thermoleovorans]
          Length = 78

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 32/75 (42%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L+ + +IV + L+ V+L+QS  S+    +    +         R       R T I
Sbjct: 1  MHALLVTLLVIVSIALIAVVLLQSGRSAGLSGAITGGAEQLFGKQKARGLDAVFQRVTVI 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +I +  +
Sbjct: 61 LAILFFVLTILVTYV 75


>gi|283797698|ref|ZP_06346851.1| preprotein translocase, SecG subunit [Clostridium sp. M62/1]
 gi|291074592|gb|EFE11956.1| preprotein translocase, SecG subunit [Clostridium sp. M62/1]
 gi|295092074|emb|CBK78181.1| protein translocase, SecG subunit [Clostridium cf.
          saccharolyticum K10]
 gi|295115124|emb|CBL35971.1| protein translocase, SecG subunit [butyrate-producing bacterium
          SM4/1]
          Length = 78

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/69 (21%), Positives = 26/69 (37%), Gaps = 8/69 (11%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAILAF 55
           L  V + + V L  V+L+Q   S+    + N  +         RS    L + T   A 
Sbjct: 5  ILTFVFVAICVFLTIVVLLQEGKSAGLSGTINGMADSYWGRNKSRSMEGKLEKLTKYGAI 64

Query: 56 FFFATSIAL 64
           +   ++ L
Sbjct: 65 LWLILALVL 73


>gi|323344150|ref|ZP_08084376.1| preprotein translocase subunit SecG [Prevotella oralis ATCC 33269]
 gi|323094879|gb|EFZ37454.1| preprotein translocase subunit SecG [Prevotella oralis ATCC 33269]
          Length = 138

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 49/122 (40%), Gaps = 5/122 (4%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
               +++ ++  + ++ ++LIQ S        F SS+    VR T   + + T  LA   
Sbjct: 3   YTLFVILIVLASLLMIGIVLIQESKGGGLSSNFSSSNAIMGVRKTTDVVEKATWGLAIAM 62

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117
              SIA   +     T     + +S  ++     N   G G+S +  + +A + ++  A 
Sbjct: 63  VVLSIACAHVVPNAVTD-SSVLEQSATETQTTNPNTTPGFGASQQKAAPTAGTQNTTSAT 121

Query: 118 KR 119
             
Sbjct: 122 DN 123


>gi|110638225|ref|YP_678434.1| preprotein translocase subunit SecG [Cytophaga hutchinsonii ATCC
           33406]
 gi|110280906|gb|ABG59092.1| protein translocase subunit secG [Cytophaga hutchinsonii ATCC
           33406]
          Length = 111

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 36/100 (36%), Gaps = 4/100 (4%)

Query: 13  VVGLVCVILIQSSDSSAFGSSSNFT---SVRSTAHSLGRFTAILAFFFFATSIALGMISR 69
            V LV V+L Q+S        S+ T     + T   L   +  LA       +A   +++
Sbjct: 13  AVLLVIVVLAQNSKGGVADGFSSSTQVIGAKRTGDFLSNLSIGLAITILVICLAFNYVAK 72

Query: 70  YTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
            T     D    +   +   +  +      +P  D+V A+
Sbjct: 73  PTVDDADDTDVENTEGTTAPESGEEVETAPAPA-DTVPAQ 111


>gi|297380435|gb|ADI35322.1| preprotein translocase, SecG subunit [Helicobacter pylori v225d]
          Length = 199

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 14/103 (13%), Positives = 28/103 (27%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F A +IALG              +   K
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVANTIALGYFYNKEYGKSILDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +           +   +   + +   L+ V             
Sbjct: 89  ELSPLVPATGTLNPTLNPTLNPTLNPLEQVPTNPLMPKQTPNE 131


>gi|229828808|ref|ZP_04454877.1| hypothetical protein GCWU000342_00891 [Shuttleworthia satelles
          DSM 14600]
 gi|229791971|gb|EEP28085.1| hypothetical protein GCWU000342_00891 [Shuttleworthia satelles
          DSM 14600]
          Length = 84

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 31/76 (40%), Gaps = 10/76 (13%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF----------TSVRSTAHSLGRFT 50
          ++  L V+ +IV + L  VIL Q    +  GS S               RS    L + T
Sbjct: 5  LKTVLTVIFVIVCIVLNIVILSQEGKDAGLGSLSGQASNTDSYWSKNKGRSREGVLIKLT 64

Query: 51 AILAFFFFATSIALGM 66
           IL   +F  S AL M
Sbjct: 65 TILVIVYFVVSAALNM 80


>gi|261420485|ref|YP_003254167.1| preprotein translocase subunit SecG [Geobacillus sp. Y412MC61]
 gi|297528814|ref|YP_003670089.1| preprotein translocase, SecG subunit [Geobacillus sp. C56-T3]
 gi|319768156|ref|YP_004133657.1| preprotein translocase, SecG subunit [Geobacillus sp. Y412MC52]
 gi|261376942|gb|ACX79685.1| preprotein translocase, SecG subunit [Geobacillus sp. Y412MC61]
 gi|297252066|gb|ADI25512.1| preprotein translocase, SecG subunit [Geobacillus sp. C56-T3]
 gi|317113022|gb|ADU95514.1| preprotein translocase, SecG subunit [Geobacillus sp. Y412MC52]
          Length = 78

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 32/75 (42%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L+ + +IV + L+ V+L+QS  S+    +    +         R       R T +
Sbjct: 1  MHALLVTLLVIVSIALIAVVLLQSGRSAGLSGAITGGAEQLFGKQKARGLDAVFQRVTVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +I +  +
Sbjct: 61 LAVLFFVLTILVTYV 75


>gi|295110299|emb|CBL24252.1| protein translocase, SecG subunit [Ruminococcus obeum A2-162]
          Length = 79

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 27/72 (37%), Gaps = 8/72 (11%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF--------TSVRSTAHSLGRFTAILA 54
            L V+  I  + L  V+L+Q       G + +            RS    L R T I+A
Sbjct: 6  TILTVIFAIDCIALTVVVLMQEGKQQGLGGAISGAADSYWGKNKGRSMEGGLVRATTIMA 65

Query: 55 FFFFATSIALGM 66
            FF  +  L M
Sbjct: 66 VLFFVLAAVLNM 77


>gi|217033576|ref|ZP_03439004.1| hypothetical protein HP9810_899g12 [Helicobacter pylori 98-10]
 gi|216943922|gb|EEC23356.1| hypothetical protein HP9810_899g12 [Helicobacter pylori 98-10]
          Length = 199

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 13/103 (12%), Positives = 27/103 (26%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F A +IALG              +   K
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVANTIALGYFYNKEYGKSILDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +           +   +   + +   L+               
Sbjct: 89  ELSPLVPATGTLNPTLNPTLNPTLNPLEQAPTNPLMPKQTPNE 131


>gi|116327979|ref|YP_797699.1| preprotein translocase subunit SecG [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116330859|ref|YP_800577.1| preprotein translocase subunit SecG [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
 gi|116120723|gb|ABJ78766.1| Preprotein translocase, SecG subunit [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116124548|gb|ABJ75819.1| Preprotein translocase, SecG subunit [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
          Length = 115

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/111 (18%), Positives = 43/111 (38%), Gaps = 5/111 (4%)

Query: 4   FLMVVHLIVVVGLVCVILIQ--SSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATS 61
            ++ + + V + LV +++IQ         G SS      STA  L + T + A  F   S
Sbjct: 5   VILTLFVFVSLFLVLLVMIQTGKGGGLLGGGSSQSVFGSSTADVLTKATRVTAILFIILS 64

Query: 62  IALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
           + L  +      R    M  ++   I     +   + ++P   +  + + +
Sbjct: 65  LFLSFLFAKKEDR---LMPETVPALITTPPEETKSETNTPTAPAAPSSTPT 112


>gi|315587146|gb|ADU41527.1| preprotein translocase subunit SecG [Helicobacter pylori 35A]
          Length = 200

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 14/103 (13%), Positives = 28/103 (27%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F A +IALG              +   K
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVANTIALGYFYNKEYGKSILDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +           +   +   + +   L+ V             
Sbjct: 89  ELSPLVPATGTLNPTLNPTLNPTLNPLEQVPTNPLMPKQTPNE 131


>gi|167761605|ref|ZP_02433732.1| hypothetical protein CLOSCI_04016 [Clostridium scindens ATCC
          35704]
 gi|167660748|gb|EDS04878.1| hypothetical protein CLOSCI_04016 [Clostridium scindens ATCC
          35704]
          Length = 80

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 29/70 (41%), Gaps = 7/70 (10%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF-------TSVRSTAHSLGRFTAILA 54
          +  LM++  I  + L  ++L+Q   S+  G+ S            RS   +L + T  LA
Sbjct: 5  KTILMIIFAIDCIALTAIVLLQEGKSAGLGTISGMADTYWGRNKGRSMEGALVKSTKFLA 64

Query: 55 FFFFATSIAL 64
            F   +  L
Sbjct: 65 ILFIVLAAVL 74


>gi|226325400|ref|ZP_03800918.1| hypothetical protein COPCOM_03202 [Coprococcus comes ATCC 27758]
 gi|225206143|gb|EEG88497.1| hypothetical protein COPCOM_03202 [Coprococcus comes ATCC 27758]
          Length = 80

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 30/71 (42%), Gaps = 7/71 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF-------TSVRSTAHSLGRFTAIL 53
          ++  L+++  I  + L  ++L+Q   S+  G+ +            RS   +L + T  L
Sbjct: 4  LKTVLLILFAIDCIALTVIVLMQEGKSAGLGTIAGMADSYWGQNKGRSMEGALVKSTKFL 63

Query: 54 AFFFFATSIAL 64
          A  F   +  L
Sbjct: 64 AILFIVLAAVL 74


>gi|226951826|ref|ZP_03822290.1| preprotein translocase subunit SecG [Acinetobacter sp. ATCC 27244]
 gi|294649080|ref|ZP_06726523.1| preprotein translocase subunit SecG [Acinetobacter haemolyticus
           ATCC 19194]
 gi|226837366|gb|EEH69749.1| preprotein translocase subunit SecG [Acinetobacter sp. ATCC 27244]
 gi|292825026|gb|EFF83786.1| preprotein translocase subunit SecG [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 109

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 46/105 (43%), Gaps = 6/105 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M  F++VVH+I+ + ++ ++L+Q    +  G+S                + L R TAI  
Sbjct: 1   MYSFILVVHIILAILIIALVLVQQGKGAEAGASFGGGGAATVFGASGAGNFLTRLTAIFT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
             FF TS++L ++++ ++T            S+     +   +  
Sbjct: 61  AIFFVTSLSLAVMAKKSTTDAYSLKTVQSSSSVPAASTETSSNAP 105


>gi|310657957|ref|YP_003935678.1| preprotein translocase subunit [Clostridium sticklandii DSM 519]
 gi|308824735|emb|CBH20773.1| preprotein translocase subunit [Clostridium sticklandii]
          Length = 75

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 7/74 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-------FTSVRSTAHSLGRFTAIL 53
          M+ FLMVV +IV +GL+  +L+QS  S+ F  +             R       + TA  
Sbjct: 1  MKTFLMVVEIIVSLGLIASVLLQSGRSAGFSGAITGGAEQLMGNKARGMDVIFRKITAAC 60

Query: 54 AFFFFATSIALGMI 67
          A  F   +I L  +
Sbjct: 61 AVLFIVLAIVLVAL 74


>gi|262374024|ref|ZP_06067301.1| preprotein translocase, SecG subunit [Acinetobacter junii SH205]
 gi|262311035|gb|EEY92122.1| preprotein translocase, SecG subunit [Acinetobacter junii SH205]
          Length = 109

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 43/105 (40%), Gaps = 6/105 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILA 54
           M  F++VVH+I+ + ++ ++L+Q    +  G+S                + L R TAI  
Sbjct: 1   MYSFILVVHIILAILIIALVLVQQGKGAEAGASFGGGGAATVFGASGAGNFLTRLTAIFT 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
             FF TS+ L + ++  +T            +     ++   +  
Sbjct: 61  ALFFVTSLTLAVFAKKQTTDAYTLKSVQTTTTAPASSSETSSNAP 105


>gi|330719321|ref|ZP_08313921.1| preprotein translocase subunit SecG [Leuconostoc fallax KCTC
          3537]
          Length = 78

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 32/78 (41%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV--------RSTAHSLGRFTAI 52
          M+  L +  ++V V L+  +++Q S      S+ +  +         R     + R TA+
Sbjct: 1  MENILTIALIVVGVMLIITVMMQPSKQQDALSALSGGAGDLFAERKSRGFEAVMRRTTAV 60

Query: 53 LAFFFFATSIALGMISRY 70
          L   +F     L  +S +
Sbjct: 61 LGTIWFIIGFVLMYLSAH 78


>gi|126729231|ref|ZP_01745045.1| preprotein translocase, SecG subunit [Sagittula stellata E-37]
 gi|126710221|gb|EBA09273.1| preprotein translocase, SecG subunit [Sagittula stellata E-37]
          Length = 126

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 3/114 (2%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--VRSTAHSLGRFTAILAFFFF 58
           MQ  ++++HL++ +GL+ V+L+Q ++    G          R+    L + T +LA  F 
Sbjct: 1   MQNVILIIHLLLALGLIGVVLLQRNEGGGLGMGGGGGPAGTRAPTTPLAKVTWVLAIAFI 60

Query: 59  ATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
            TSI L +I+   S      + R        Q       G+    D + A  SS
Sbjct: 61  VTSITLTIIAAQNSA-GTSILDRLAPAGRATQEEPATAPGADINTDDLLAPPSS 113


>gi|317177997|dbj|BAJ55786.1| preprotein translocase subunit SecG [Helicobacter pylori F16]
          Length = 205

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 13/103 (12%), Positives = 27/103 (26%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG              +   K
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSILDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +           +   +   + +   L+ V             
Sbjct: 89  ELSPLVPATGTLNPTLNPTLNPTLNPLEQVPTNPLMPKQTPNE 131


>gi|269468872|gb|EEZ80467.1| protein translocase subunit SecG [uncultured SUP05 cluster
           bacterium]
          Length = 114

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 20/112 (17%), Positives = 43/112 (38%), Gaps = 6/112 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS------NFTSVRSTAHSLGRFTAILAF 55
              +++VH+++ +GLV +IL+Q    +  G++       +    R  +  + + TA +A 
Sbjct: 3   FQVILIVHVLLALGLVALILMQHGKGADAGAAFGAGSAGSVFGARGASSFIYKLTAGVAT 62

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
            FF TS+ L  ++    +   +                +      P  D   
Sbjct: 63  GFFLTSLTLAYLATNEPSASNNTQSVMDQVIATPAIPSDVPMIDVPLSDIPD 114


>gi|269302866|gb|ACZ32966.1| preprotein translocase, SecG subunit [Chlamydophila pneumoniae
           LPCoLN]
          Length = 110

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 20/104 (19%), Positives = 33/104 (31%), Gaps = 5/104 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS-----TAHSLGRFTAILAF 55
           +    + + L + V L  +IL+Q S S   GSS    S  S     T   L + T+  A 
Sbjct: 4   LFYAFLFIFLFLCVILCGLILVQESKSMGLGSSFGVDSGDSVFGVSTPDILKKVTSWCAV 63

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGS 99
            F    + L   +     +              D    +    +
Sbjct: 64  AFCIGCLLLSFSTNLLGKKLDAKEFLLPAAEESDIQASSESVEA 107


>gi|196249338|ref|ZP_03148036.1| preprotein translocase, SecG subunit [Geobacillus sp. G11MC16]
 gi|196211095|gb|EDY05856.1| preprotein translocase, SecG subunit [Geobacillus sp. G11MC16]
          Length = 78

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 32/75 (42%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L+ + +IV + L+ ++L+QS  S+    +    +         R       R T +
Sbjct: 1  MHALLVTLLVIVSIALIAIVLLQSGRSAGLSGAITGGAEQLFGKQKARGLDAVFQRVTVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  FF  +I +  +
Sbjct: 61 LAILFFVLTILVAYV 75


>gi|294676308|ref|YP_003576923.1| preprotein translocase subunit SecG [Rhodobacter capsulatus SB
           1003]
 gi|294475128|gb|ADE84516.1| preprotein translocase, SecG subunit [Rhodobacter capsulatus SB
           1003]
          Length = 147

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 34/100 (34%), Gaps = 12/100 (12%)

Query: 17  VCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTS 72
           + V+L+Q S+    G          + R  A++L + T I A  F ATSI L + S    
Sbjct: 20  IGVVLLQRSEGGGLGMGGGGGGGVMTGRQAANALTKLTWIFAIGFLATSITLTVFSARAG 79

Query: 73  TRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
                                    GS+     +SA   S
Sbjct: 80  KEASVVD--------TTPAEAPAAPGSTGTSPLISAPPPS 111


>gi|312143209|ref|YP_003994655.1| preprotein translocase, SecG subunit [Halanaerobium sp.
          'sapolanicus']
 gi|311903860|gb|ADQ14301.1| preprotein translocase, SecG subunit [Halanaerobium sp.
          'sapolanicus']
          Length = 73

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 14/71 (19%), Positives = 30/71 (42%), Gaps = 7/71 (9%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRS--TAHSLGRFTAILAFF 56
           L V+H I+ + ++  +L+QS        +  G ++ F           + + T + A  
Sbjct: 3  VLKVIHFIIAIAVIVGVLLQSGKSAGLSGAIDGGATTFFGSSGRKMEDKISKATTVAAIL 62

Query: 57 FFATSIALGMI 67
          F   S+ L ++
Sbjct: 63 FMLNSLLLAIL 73


>gi|83589140|ref|YP_429149.1| preprotein translocase subunit SecG [Moorella thermoacetica ATCC
          39073]
 gi|83572054|gb|ABC18606.1| protein translocase subunit secG [Moorella thermoacetica ATCC
          39073]
          Length = 74

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 34/73 (46%), Gaps = 6/73 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRSTAHSLGRFTAILA 54
          +   ++++ ++V +GL+  +L+QS  S+           + F   +     L R ++IL 
Sbjct: 2  LHTIILILDILVALGLIATVLLQSGRSAGMSGAIAGGAETIFGKKKGLDDFLNRVSSILG 61

Query: 55 FFFFATSIALGMI 67
            F   ++ L +I
Sbjct: 62 GIFIVFTLLLSVI 74


>gi|262277258|ref|ZP_06055051.1| preprotein translocase SecG subunit [alpha proteobacterium
          HIMB114]
 gi|262224361|gb|EEY74820.1| preprotein translocase SecG subunit [alpha proteobacterium
          HIMB114]
          Length = 78

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 31/77 (40%), Gaps = 4/77 (5%)

Query: 22 IQSSDSSAFG----SSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKD 77
          +Q S+  A G     S +F S RS    L +FT+++A  F  TSI L  + R  +     
Sbjct: 1  MQKSEGGALGIGSSGSDSFMSSRSAGSFLTKFTSVVAIMFIITSITLTAMHRNDAKNNSV 60

Query: 78 NMHRSLVDSIKDQGNDN 94
                 +    +   +
Sbjct: 61 IDKIEKKEDNSPKIPKS 77


>gi|116873815|ref|YP_850596.1| preprotein translocase subunit SecG [Listeria welshimeri serovar
          6b str. SLCC5334]
 gi|289435711|ref|YP_003465583.1| preprotein translocase, SecG subunit [Listeria seeligeri serovar
          1/2b str. SLCC3954]
 gi|116742693|emb|CAK21817.1| preprotein translocase SecG subunit [Listeria welshimeri serovar
          6b str. SLCC5334]
 gi|289171955|emb|CBH28501.1| preprotein translocase, SecG subunit [Listeria seeligeri serovar
          1/2b str. SLCC3954]
 gi|313636426|gb|EFS02186.1| preprotein translocase, SecG subunit [Listeria seeligeri FSL
          S4-171]
          Length = 77

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 32/75 (42%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L V+ +IV V L+ VI++Q   S+    + +  +         R     L R T +
Sbjct: 1  MSTVLTVLLIIVSVLLITVIILQPGKSAGLSGAISGGAEQLFGKQKARGLELILHRTTIV 60

Query: 53 LAFFFFATSIALGMI 67
          L+  FF   IAL   
Sbjct: 61 LSVVFFVILIALAYF 75


>gi|270290683|ref|ZP_06196907.1| preprotein translocase, SecG subunit [Pediococcus acidilactici
          7_4]
 gi|304386207|ref|ZP_07368540.1| preprotein translocase subunit SecG [Pediococcus acidilactici DSM
          20284]
 gi|270280743|gb|EFA26577.1| preprotein translocase, SecG subunit [Pediococcus acidilactici
          7_4]
 gi|304327564|gb|EFL94791.1| preprotein translocase subunit SecG [Pediococcus acidilactici DSM
          20284]
          Length = 78

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV--------RSTAHSLGRFTAI 52
          M   LM + LI+ V ++  +++Q + +    SS    +         R     + R TA+
Sbjct: 1  MYSLLMTILLILSVVIIIAVMMQPAKTDNAMSSLTGGAGDLFSKQKSRGFEAFMQRVTAV 60

Query: 53 LAFFFFATSIALGMISRY 70
          L F FFA +IA+  +S +
Sbjct: 61 LLFLFFAITIAMVYVSAH 78


>gi|317180981|dbj|BAJ58767.1| preprotein translocase subunit SecG [Helicobacter pylori F32]
          Length = 199

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 14/103 (13%), Positives = 28/103 (27%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F A +IALG              +   K
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVANTIALGYFYNKEYGKSILDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +           +   +   + +   L+ V             
Sbjct: 89  ELSPLVPATGTLNPMLNPTLNPTLNPLEQVPTNPLMPKQTPNE 131


>gi|295696722|ref|YP_003589960.1| preprotein translocase, SecG subunit [Bacillus tusciae DSM 2912]
 gi|295412324|gb|ADG06816.1| preprotein translocase, SecG subunit [Bacillus tusciae DSM 2912]
          Length = 80

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 32/76 (42%), Gaps = 7/76 (9%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS-------VRSTAHSLGRFTAILAFF 56
           L ++ +IV + L+ V+L+QS  S+    +    +        R     L + T +L   
Sbjct: 5  ILKILLVIVSLALIGVVLMQSGRSAGLSGAIAGGAEQLVGRKARGIDAVLVKATTMLGTV 64

Query: 57 FFATSIALGMISRYTS 72
          FF  ++ +  +    S
Sbjct: 65 FFILALVVAWLIARGS 80


>gi|207091620|ref|ZP_03239407.1| preprotein translocase subunit SecG [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 196

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 13/103 (12%), Positives = 26/103 (25%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG              +   K
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSILDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           D           +   +   + +   L+               
Sbjct: 89  DLSPLVPATGTLNPTLNPTLNPTLNPLEQAPTNLLMPKQTPDE 131


>gi|309388873|gb|ADO76753.1| protein translocase subunit secG [Halanaerobium praevalens DSM
          2228]
          Length = 73

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 13/71 (18%), Positives = 30/71 (42%), Gaps = 7/71 (9%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRS--TAHSLGRFTAILAFF 56
           L ++H I+ + ++  +L+QS        +  G ++ F          ++ + T + A  
Sbjct: 3  ILKILHFIIAIAVIVGVLLQSGKSAGLSGAIDGGATTFFGKSGKRMEDTISKATTVAAVL 62

Query: 57 FFATSIALGMI 67
          F   S+ L + 
Sbjct: 63 FMINSLILAIF 73


>gi|32490977|ref|NP_871231.1| hypothetical protein WGLp228 [Wigglesworthia glossinidia
          endosymbiont of Glossina brevipalpis]
 gi|25166183|dbj|BAC24374.1| secG [Wigglesworthia glossinidia endosymbiont of Glossina
          brevipalpis]
          Length = 113

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 5/70 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRSTAHSLGRFTAILAF 55
          M    +++ L++  GL+ +++IQ        SS    S +     ++     + T+I A 
Sbjct: 1  MYFIFLIIFLLISCGLIFLVIIQDEKVYELYSSYNPFSGSIFGQSTSNSFSKKLTSIFAV 60

Query: 56 FFFATSIALG 65
           FF  S+ LG
Sbjct: 61 LFFVFSLILG 70


>gi|20808177|ref|NP_623348.1| preprotein translocase subunit SecG [Thermoanaerobacter
          tengcongensis MB4]
 gi|20516769|gb|AAM24952.1| hypothetical protein TTE1758 [Thermoanaerobacter tengcongensis
          MB4]
          Length = 79

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 32/78 (41%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS-----AFGSSSNFTSVRSTAHS---LGRFTAI 52
          +   LMV+ ++V + L+ ++L+Q   S+       G +  F            L R T I
Sbjct: 2  LTTVLMVMQVLVSIFLIVIVLLQKGKSAGISGVIAGGAETFFGKHKAKTLEGTLERLTVI 61

Query: 53 LAFFFFATSIALGMISRY 70
           A  F   SI L ++   
Sbjct: 62 GATLFIVLSIILTILMAR 79


>gi|298372189|ref|ZP_06982179.1| preprotein translocase, SecG subunit [Bacteroidetes oral taxon 274
           str. F0058]
 gi|298275093|gb|EFI16644.1| preprotein translocase, SecG subunit [Bacteroidetes oral taxon 274
           str. F0058]
          Length = 108

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 27/108 (25%), Positives = 39/108 (36%), Gaps = 5/108 (4%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M  FL ++ +I  V L  V+LIQ+S        F S++    V+ T   + + T IL   
Sbjct: 1   MIQFLTILIVITAVILTFVVLIQNSKGGGLAAGFSSANQVFGVKKTTDRIEKLTWILIAI 60

Query: 57  FFATSIALG-MISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKL 103
               SI    MIS   S      +    V   +  G         P  
Sbjct: 61  IVVLSIFSARMISHRQSAGTVSAVDTEQVQQQEAAGQQEQPQPVIPAE 108


>gi|239947008|ref|ZP_04698761.1| preprotein translocase, SecG subunit [Rickettsia endosymbiont of
          Ixodes scapularis]
 gi|239921284|gb|EER21308.1| preprotein translocase, SecG subunit [Rickettsia endosymbiont of
          Ixodes scapularis]
          Length = 100

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 41/97 (42%), Gaps = 5/97 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+ VH+ + + L+ VIL+Q S S         ++    S ++  + L + T IL  
Sbjct: 1  MIDILLFVHITIAILLIIVILMQRSGSDGISSISGGNNMGVVSAKTVGNFLTKSTIILTT 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
           F   +I L  +S    +    N++    +  ++   
Sbjct: 61 LFLINAIVLANLSSKKKSDLVSNINEIEENQAENSLP 97


>gi|150026023|ref|YP_001296849.1| preprotein translocase SecG subunit [Flavobacterium psychrophilum
           JIP02/86]
 gi|149772564|emb|CAL44047.1| Preprotein translocase SecG subunit [Flavobacterium psychrophilum
           JIP02/86]
          Length = 124

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 16/111 (14%), Positives = 33/111 (29%), Gaps = 4/111 (3%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS----SNFTSVRSTAHSLGRFTAILAFFF 57
               +V+  IV   L+ VI++Q+       SS    +    V+ T   L + T  L    
Sbjct: 4   FTIFLVLITIVCFLLIVVIMVQNPKGGGLSSSISGSTQMGGVQKTTDFLDKSTWYLGAIL 63

Query: 58  FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSA 108
               +   +     ++     +      +            ++ K     A
Sbjct: 64  IVLILMSSLSFNGNNSDTGSKVIDESALAAPAIPTAPQATPAATKTTETPA 114


>gi|317011455|gb|ADU85202.1| preprotein translocase subunit SecG [Helicobacter pylori
           SouthAfrica7]
          Length = 193

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 13/101 (12%), Positives = 26/101 (25%), Gaps = 6/101 (5%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRY------KDN 78
              +  GS+ +    +  A  + + T  L   F   +IALG        +          
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVTNTIALGYFYNKEYGKSILDETKTKL 88

Query: 79  MHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
                     +   +   + +   L+           A K 
Sbjct: 89  SPLVPAAGTLNPTLNPTLNPTLNPLEQAPTNPLMPKEAPKE 129


>gi|220932413|ref|YP_002509321.1| preprotein translocase, SecG subunit [Halothermothrix orenii H
          168]
 gi|219993723|gb|ACL70326.1| preprotein translocase, SecG subunit [Halothermothrix orenii H
          168]
          Length = 73

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 31/70 (44%), Gaps = 6/70 (8%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILAFFF 57
           L + H I+ + ++  +L+QS  S+        G++  F   +     L  FT+I A  F
Sbjct: 3  ILKIAHFIIALAVIAGVLLQSGRSAGLSGAIDGGATKIFGKKKGIDEKLSFFTSIAAVLF 62

Query: 58 FATSIALGMI 67
            TS+ L   
Sbjct: 63 MITSLLLAFF 72


>gi|303326770|ref|ZP_07357212.1| preprotein translocase, SecG subunit [Desulfovibrio sp. 3_1_syn3]
 gi|302862758|gb|EFL85690.1| preprotein translocase, SecG subunit [Desulfovibrio sp. 3_1_syn3]
          Length = 144

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 39/88 (44%), Gaps = 4/88 (4%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAF----GSSSNFTSVRSTAHSLGRFTAILAFFF 57
          Q  ++ +H+IV V LV ++L+QS          G +++          L + T ++A  F
Sbjct: 10 QTLILTLHIIVCVLLVILVLLQSGKEGMGVIFGGGNTSVFGSGGAGGILAKLTTLMAIIF 69

Query: 58 FATSIALGMISRYTSTRYKDNMHRSLVD 85
            TS++   ++    +     ++  + +
Sbjct: 70 MITSLSYTYVTSSRPSSESTILNVKIEE 97


>gi|261838578|gb|ACX98344.1| protein translocation protein [Helicobacter pylori 51]
          Length = 205

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 14/98 (14%), Positives = 30/98 (30%), Gaps = 3/98 (3%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLV 84
              +  GS+ +    +  A  + + T  L   F   +IALG    Y     K  +  +  
Sbjct: 31  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVINTIALGYF--YNKEYGKSILDETKT 88

Query: 85  DSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSS 122
           +              +P L+     + +  +     + 
Sbjct: 89  NKEL-SPLVPATGTLNPTLNPTLNPTLNPTLNPLEQAP 125


>gi|191637914|ref|YP_001987080.1| preprotein translocase subunit SecG [Lactobacillus casei BL23]
 gi|227535552|ref|ZP_03965601.1| preprotein translocase, SecG subunit [Lactobacillus paracasei
          subsp. paracasei ATCC 25302]
 gi|239631230|ref|ZP_04674261.1| preprotein translocase subunit SecG [Lactobacillus paracasei
          subsp. paracasei 8700:2]
 gi|301065990|ref|YP_003788013.1| preprotein translocase subunit SecG [Lactobacillus casei str.
          Zhang]
 gi|190712216|emb|CAQ66222.1| Preprotein translocase, SecG subunit [Lactobacillus casei BL23]
 gi|227186799|gb|EEI66866.1| preprotein translocase, SecG subunit [Lactobacillus paracasei
          subsp. paracasei ATCC 25302]
 gi|239525695|gb|EEQ64696.1| preprotein translocase subunit SecG [Lactobacillus paracasei
          subsp. paracasei 8700:2]
 gi|300438397|gb|ADK18163.1| Preprotein translocase subunit SecG [Lactobacillus casei str.
          Zhang]
 gi|327381982|gb|AEA53458.1| Preprotein translocase subunit SecG [Lactobacillus casei LC2W]
 gi|327385141|gb|AEA56615.1| Preprotein translocase subunit SecG [Lactobacillus casei BD-II]
          Length = 78

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 28/78 (35%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD--------SSAFGSSSNFTSVRSTAHSLGRFTAI 52
          MQ  L    +I  + +V   L+Q S         S         T  R     + + T +
Sbjct: 1  MQSLLTTFLVIDSILIVIATLMQPSKQQDALSALSGGATDLFGKTKSRGFEAFMEKVTVV 60

Query: 53 LAFFFFATSIALGMISRY 70
          L   FF  +IAL  +  +
Sbjct: 61 LGVIFFGLAIALVYLEAH 78


>gi|154498412|ref|ZP_02036790.1| hypothetical protein BACCAP_02401 [Bacteroides capillosus ATCC
          29799]
 gi|150272480|gb|EDM99665.1| hypothetical protein BACCAP_02401 [Bacteroides capillosus ATCC
          29799]
          Length = 82

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%), Gaps = 8/72 (11%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRSTAHS---LGRFTAILAF 55
           + V+ L+  + L+ V+L+QS        +  G    F +          L ++T  +A 
Sbjct: 10 VVTVIQLLSGLFLIAVVLLQSGKSAGLSGAIAGGMDTFMAKNKAKTWDAKLAKWTKWVAI 69

Query: 56 FFFATSIALGMI 67
           F   ++ L ++
Sbjct: 70 LFIVLTLVLSLM 81


>gi|166032820|ref|ZP_02235649.1| hypothetical protein DORFOR_02536 [Dorea formicigenerans ATCC
          27755]
 gi|166027177|gb|EDR45934.1| hypothetical protein DORFOR_02536 [Dorea formicigenerans ATCC
          27755]
          Length = 89

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 31/71 (43%), Gaps = 7/71 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-------NFTSVRSTAHSLGRFTAIL 53
          ++I LM++  I  + L  ++L+Q   S+  G+ S            RS   +L + T  L
Sbjct: 13 LKIVLMILFAIDCIALTAIVLMQEGKSAGLGAISGIADTYWGQNKGRSMEGALVKSTKFL 72

Query: 54 AFFFFATSIAL 64
          A  F   +  L
Sbjct: 73 AILFVVLAAVL 83


>gi|226314810|ref|YP_002774706.1| preprotein translocase subunit [Brevibacillus brevis NBRC 100599]
 gi|226097760|dbj|BAH46202.1| preprotein translocase subunit [Brevibacillus brevis NBRC 100599]
          Length = 80

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 33/80 (41%), Gaps = 8/80 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M +   ++ +I  +GL+ V+L+QS        +  G +         R     LG+ T +
Sbjct: 1  MALAAKILLVIASIGLIIVVLLQSGKSAGLSGAIGGGAEQLMGKQKARGIDALLGKLTVV 60

Query: 53 LAFFFFATSIALGMISRYTS 72
           A  F   +I LG   +  +
Sbjct: 61 FAVGFMIFAILLGYFLKSGA 80


>gi|308062539|gb|ADO04427.1| preprotein translocase subunit SecG [Helicobacter pylori Cuz20]
          Length = 195

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 27/92 (29%), Gaps = 6/92 (6%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLV 84
              +  GS+ +    +  A  + + T  L   F   +IALG    Y     K  +  +  
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVTNTIALGYF--YNKEYGKSILDETKT 86

Query: 85  D----SIKDQGNDNFGDGSSPKLDSVSAKSSS 112
           +     +           +        A ++ 
Sbjct: 87  NKELSPLVPATGTLNPTLNPTLNPLEQAPTNP 118


>gi|199597279|ref|ZP_03210710.1| preprotein translocase subunit SecG [Lactobacillus rhamnosus
          HN001]
 gi|258507935|ref|YP_003170686.1| preprotein translocase subunit SecG [Lactobacillus rhamnosus GG]
 gi|258539184|ref|YP_003173683.1| preprotein translocase subunit SecG [Lactobacillus rhamnosus Lc
          705]
 gi|199591795|gb|EDY99870.1| preprotein translocase subunit SecG [Lactobacillus rhamnosus
          HN001]
 gi|257147862|emb|CAR86835.1| Preprotein translocase, SecG subunit [Lactobacillus rhamnosus GG]
 gi|257150860|emb|CAR89832.1| Preprotein translocase, SecG subunit [Lactobacillus rhamnosus Lc
          705]
 gi|259649262|dbj|BAI41424.1| preprotein translocase subunit SecG [Lactobacillus rhamnosus GG]
          Length = 78

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 29/78 (37%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD--------SSAFGSSSNFTSVRSTAHSLGRFTAI 52
          MQ  L  + +I  V +V   L+Q S         S         T  R     + + T +
Sbjct: 1  MQSLLTTLLVIDSVLIVIATLMQPSKQQDALSALSGGATDLFGKTKSRGFEAFMEKVTVV 60

Query: 53 LAFFFFATSIALGMISRY 70
          L   FF  +IAL  +  +
Sbjct: 61 LGVIFFGLAIALVYLEAH 78


>gi|319943346|ref|ZP_08017628.1| preprotein translocase subunit SecG [Lautropia mirabilis ATCC
           51599]
 gi|319743161|gb|EFV95566.1| preprotein translocase subunit SecG [Lautropia mirabilis ATCC
           51599]
          Length = 150

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 48/135 (35%), Gaps = 12/135 (8%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRST------AHSLGRFTAILAF 55
               +V+ ++  +G+V ++L+Q    +  G++    S  S       A+ L R T I A 
Sbjct: 6   HTIALVLLIVSALGVVLLVLLQHGKGADMGAAFGSGSSGSLFGASGSANFLSRMTGICAT 65

Query: 56  FFFATSIALGMIS------RYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAK 109
            FFA+++AL  ++        +++     M    V +                  +    
Sbjct: 66  VFFASTLALAFLAHPGGQHARSTSGGSSVMEGVDVPAPASSSVPTLPGEQPAAAPAQQGN 125

Query: 110 SSSSVVAGKRSSSRT 124
           +     AG    S  
Sbjct: 126 AVPEGPAGVAEKSAE 140


>gi|261404138|ref|YP_003240379.1| preprotein translocase subunit SecG [Paenibacillus sp. Y412MC10]
 gi|329927580|ref|ZP_08281743.1| preprotein translocase, SecG subunit [Paenibacillus sp. HGF5]
 gi|261280601|gb|ACX62572.1| preprotein translocase, SecG subunit [Paenibacillus sp. Y412MC10]
 gi|328938369|gb|EGG34759.1| preprotein translocase, SecG subunit [Paenibacillus sp. HGF5]
          Length = 76

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 33/75 (44%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF--------TSVRSTAHSLGRFTAI 52
          M +F  V+ +I  +GL+ V+L+Q   S+    + +         T  R     L R T  
Sbjct: 1  MVVFFEVLLVIFSIGLITVVLLQKGKSAGLAGAISGGAEHLFGKTKARGMDLVLQRTTVG 60

Query: 53 LAFFFFATSIALGMI 67
          LA  F   +I + M+
Sbjct: 61 LAAGFMILAIVVAML 75


>gi|65317080|ref|ZP_00390039.1| COG1314: Preprotein translocase subunit SecG [Bacillus anthracis
          str. A2012]
          Length = 77

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 33/75 (44%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAF--------GSSSNFTSVRSTAHSLGRFTAI 52
          M   L V+ +IV + ++ ++L+QSS+SS                   R     L R T +
Sbjct: 1  MHTLLSVLLIIVSILMIVMVLMQSSNSSGLSGAXSGGAEQLFGKQKARGIEAVLNRITIV 60

Query: 53 LAFFFFATSIALGMI 67
          L   FFA +I +  +
Sbjct: 61 LXVLFFALTIGVTYL 75


>gi|315644596|ref|ZP_07897728.1| preprotein translocase, SecG subunit [Paenibacillus vortex V453]
 gi|315280103|gb|EFU43400.1| preprotein translocase, SecG subunit [Paenibacillus vortex V453]
          Length = 76

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF--------TSVRSTAHSLGRFTAI 52
          M IF  V+ +I  +GL+ V+L+Q   S+    + +         T  R     L R T  
Sbjct: 1  MVIFFEVLLVIFSIGLITVVLLQKGKSAGLAGAISGGAEHLFGKTKARGMDLVLQRTTVG 60

Query: 53 LAFFFFATSIALGMI 67
          LA  F   +I + M+
Sbjct: 61 LAAGFMILAIVVAML 75


>gi|116492265|ref|YP_804000.1| preprotein translocase subunit SecG [Pediococcus pentosaceus ATCC
          25745]
 gi|116102415|gb|ABJ67558.1| Preprotein translocase subunit SecG [Pediococcus pentosaceus ATCC
          25745]
          Length = 78

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV--------RSTAHSLGRFTAI 52
          M   LM + LI+ V ++  +++Q + + +  SS    +         R     + + TA+
Sbjct: 1  MYSLLMTILLILSVFIIIAVMMQPAKTDSAMSSLTGGAGDLFAKQKPRGFEAFMQKVTAV 60

Query: 53 LAFFFFATSIALGMISRY 70
          L F FFA +IA+  +S Y
Sbjct: 61 LLFLFFAVTIAMVYVSAY 78


>gi|15892032|ref|NP_359746.1| preprotein translocase subunit SecG [Rickettsia conorii str.
          Malish 7]
 gi|34580933|ref|ZP_00142413.1| protein-export membrane protein secG [Rickettsia sibirica 246]
 gi|157827985|ref|YP_001494227.1| preprotein translocase subunit SecG [Rickettsia rickettsii str.
          'Sheila Smith']
 gi|157964145|ref|YP_001498969.1| preprotein translocase subunit SecG [Rickettsia massiliae MTU5]
 gi|165932677|ref|YP_001649466.1| preprotein translocase subunit SecG [Rickettsia rickettsii str.
          Iowa]
 gi|238650544|ref|YP_002916396.1| preprotein translocase subunit SecG [Rickettsia peacockii str.
          Rustic]
 gi|81528547|sp|Q92JF8|SECG_RICCN RecName: Full=Protein-export membrane protein secG
 gi|15619150|gb|AAL02647.1| protein-export membrane protein secG [Rickettsia conorii str.
          Malish 7]
 gi|28262318|gb|EAA25822.1| protein-export membrane protein secG [Rickettsia sibirica 246]
 gi|157800466|gb|ABV75719.1| preprotein translocase subunit SecG [Rickettsia rickettsii str.
          'Sheila Smith']
 gi|157843921|gb|ABV84422.1| Protein-export membrane protein secG [Rickettsia massiliae MTU5]
 gi|165907764|gb|ABY72060.1| protein translocase subunit [Rickettsia rickettsii str. Iowa]
 gi|238624642|gb|ACR47348.1| preprotein translocase subunit SecG [Rickettsia peacockii str.
          Rustic]
          Length = 100

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 40/97 (41%), Gaps = 5/97 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+ VH+ + + L+ VIL+Q S S         ++    S ++  + L + T IL  
Sbjct: 1  MIDILLFVHITIAILLIIVILMQRSGSDGISSISGGNNMGVVSAKTVGNFLTKSTIILTT 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
           F   +I L  +S    +     ++    +  ++   
Sbjct: 61 LFLINAIVLANLSSKKKSDLVSKINEIEENQAENSLP 97


>gi|154503019|ref|ZP_02040079.1| hypothetical protein RUMGNA_00841 [Ruminococcus gnavus ATCC
          29149]
 gi|153796373|gb|EDN78793.1| hypothetical protein RUMGNA_00841 [Ruminococcus gnavus ATCC
          29149]
          Length = 80

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 7/71 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-------NFTSVRSTAHSLGRFTAIL 53
          ++I LM++ +I  + L  +IL+Q   S+  G+ S            RS   +L + T  L
Sbjct: 4  LKIVLMIIFVIDCIALSAIILLQEGKSAGLGTISGAADSYWGQNKGRSMEGALVKSTKFL 63

Query: 54 AFFFFATSIAL 64
          A  F   +  L
Sbjct: 64 AILFLVLAAVL 74


>gi|329769896|ref|ZP_08261295.1| preprotein translocase [Gemella sanguinis M325]
 gi|328837950|gb|EGF87574.1| preprotein translocase [Gemella sanguinis M325]
          Length = 76

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 29/74 (39%), Gaps = 7/74 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-------SSAFGSSSNFTSVRSTAHSLGRFTAIL 53
          M  FLM   ++  + L+ V+L+Q S        +           VR     L R T +L
Sbjct: 1  MHTFLMATAIMSSILLIIVVLLQDSKSGGLSGLTGGAEELFGKQKVRGAELVLQRITIVL 60

Query: 54 AFFFFATSIALGMI 67
             FF + + L  +
Sbjct: 61 GLIFFISLVCLTWL 74


>gi|157825240|ref|YP_001492960.1| preprotein translocase subunit SecG [Rickettsia akari str.
          Hartford]
 gi|157799198|gb|ABV74452.1| protein-export membrane protein [Rickettsia akari str. Hartford]
          Length = 100

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 42/97 (43%), Gaps = 5/97 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS-----SDSSAFGSSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+ VH+ + + L+ VIL+Q        S + G++    S ++ ++ L + T IL  
Sbjct: 1  MINILLFVHITIAILLIIVILMQRSGSDGISSISGGNNMGVVSAKTVSNFLTKSTIILTT 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
           F   +I L  +S    +     ++    +  ++   
Sbjct: 61 LFLINAIVLANLSSKKKSDLVSKINEIEENQAENSLP 97


>gi|301168072|emb|CBW27658.1| protein-export membrane protein [Bacteriovorax marinus SJ]
          Length = 121

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/117 (17%), Positives = 43/117 (36%), Gaps = 7/117 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSA-----FGSSSNFTSVRSTAHSLGRFTAILAF 55
           M   LM+ H+++ V L+ ++L+Q    +       G+  +  +     + LG+ T ILA 
Sbjct: 1   MFHSLMIFHIVISVLLIVLVLLQFGKGAEAGLLSGGAGDSTFTGTQQGNILGKITTILAV 60

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSS 112
            F   SI L  I   ++      +      +     +         K    +  + +
Sbjct: 61  LFLGNSILLAKI--QSTKSSSSILDGEAPIAAPLNNDAMMPKAQETKTPETATPAET 115


>gi|210618049|ref|ZP_03291884.1| hypothetical protein CLONEX_04117 [Clostridium nexile DSM 1787]
 gi|210149042|gb|EEA80051.1| hypothetical protein CLONEX_04117 [Clostridium nexile DSM 1787]
          Length = 89

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 16/71 (22%), Positives = 29/71 (40%), Gaps = 7/71 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-------NFTSVRSTAHSLGRFTAIL 53
          ++  LM++  I  + L  ++L+Q   S+  G+ S            RS   +L + T   
Sbjct: 13 LKTVLMILFAIDCIVLTAIVLLQEGKSAGLGTISGAAESYWGQNKGRSMEGALVKSTKFA 72

Query: 54 AFFFFATSIAL 64
          A  F   +  L
Sbjct: 73 AVLFIVLAAVL 83


>gi|262384389|ref|ZP_06077524.1| preprotein translocase subunit SecG [Bacteroides sp. 2_1_33B]
 gi|262294092|gb|EEY82025.1| preprotein translocase subunit SecG [Bacteroides sp. 2_1_33B]
          Length = 127

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 38/105 (36%), Gaps = 4/105 (3%)

Query: 23  QSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDN 78
           Q+S        F SS+    VR T   L + T  LA      SI +           +  
Sbjct: 23  QNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWSLAGTVIVLSILITAFIPRAEHAAQSE 82

Query: 79  MHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSSR 123
           + + + D+I    N    D  + +  +V A+ + +       S+R
Sbjct: 83  IKQQVNDAISIDPNTIAPDFGTAQQSAVPAEETPATTTPAEESNR 127


>gi|256828687|ref|YP_003157415.1| preprotein translocase, SecG subunit [Desulfomicrobium baculatum
           DSM 4028]
 gi|256577863|gb|ACU88999.1| preprotein translocase, SecG subunit [Desulfomicrobium baculatum
           DSM 4028]
          Length = 114

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 23/110 (20%), Positives = 43/110 (39%), Gaps = 6/110 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
           M   ++ +H+I  V LV ++L+QS          G   +        + L + TA  A  
Sbjct: 1   MNSLMITIHVIACVTLVVLVLLQSGKEGMGIIFGGGGGSVFGSTGAGNLLSKLTAGAATV 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSV 106
           FF TS+    +S    T  K+++   +   +        G  ++P  +  
Sbjct: 61  FFLTSMIFTYVSTQKHTSPKESI--VIDMPVTQTPAAPAGVTTAPAEEPA 108


>gi|229586321|ref|YP_002844822.1| preprotein translocase subunit SecG [Rickettsia africae ESF-5]
 gi|228021371|gb|ACP53079.1| Protein-export membrane protein secG [Rickettsia africae ESF-5]
          Length = 100

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 40/97 (41%), Gaps = 5/97 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+ VH+ + + L+ VIL+Q S S         ++    S ++  + L + T IL  
Sbjct: 1  MIDILLFVHITIAILLIIVILMQHSGSDGISSISGGNNMGVVSAKTVGNFLTKSTIILTT 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
           F   +I L  +S    +     ++    +  ++   
Sbjct: 61 LFLINAIVLANLSSKKKSDLVSKINEIEENQAENSLP 97


>gi|148378234|ref|YP_001252775.1| preprotein translocase, SecG subunit [Clostridium botulinum A
          str. ATCC 3502]
 gi|148287718|emb|CAL81783.1| probable protein-export membrane protein [Clostridium botulinum A
          str. ATCC 3502]
          Length = 77

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 33/77 (42%), Gaps = 8/77 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD--------SSAFGSSSNFTSVRSTAHSLGRFTAI 52
          M  F +V+  IV + L+ V+L+Q S              +  +    R++   L R T +
Sbjct: 1  MHTFSIVLLTIVSITLIVVVLMQPSKTNGLSGFMGGGSETFYSKNRTRTSESVLSRITVV 60

Query: 53 LAFFFFATSIALGMISR 69
           +  F    +A  ++S+
Sbjct: 61 CSILFAIIVLAQNLLSK 77


>gi|16804489|ref|NP_465974.1| preprotein translocase subunit SecG [Listeria monocytogenes
          EGD-e]
 gi|46908624|ref|YP_015013.1| preprotein translocase subunit SecG [Listeria monocytogenes str.
          4b F2365]
 gi|217963447|ref|YP_002349125.1| preprotein translocase, SecG subunit [Listeria monocytogenes
          HCC23]
 gi|224500107|ref|ZP_03668456.1| preprotein translocase subunit SecG [Listeria monocytogenes
          Finland 1988]
 gi|224503403|ref|ZP_03671710.1| preprotein translocase subunit SecG [Listeria monocytogenes FSL
          R2-561]
 gi|226224999|ref|YP_002759106.1| preprotein translocase subunit SecG [Listeria monocytogenes
          Clip81459]
 gi|254825427|ref|ZP_05230428.1| predicted protein [Listeria monocytogenes FSL J1-194]
 gi|254828026|ref|ZP_05232713.1| predicted protein [Listeria monocytogenes FSL N3-165]
 gi|254831126|ref|ZP_05235781.1| preprotein translocase subunit SecG [Listeria monocytogenes
          10403S]
 gi|254853546|ref|ZP_05242894.1| predicted protein [Listeria monocytogenes FSL R2-503]
 gi|254900411|ref|ZP_05260335.1| preprotein translocase subunit SecG [Listeria monocytogenes
          J0161]
 gi|254913350|ref|ZP_05263362.1| predicted protein [Listeria monocytogenes J2818]
 gi|254932308|ref|ZP_05265667.1| predicted protein [Listeria monocytogenes HPB2262]
 gi|254937731|ref|ZP_05269428.1| predicted protein [Listeria monocytogenes F6900]
 gi|254993182|ref|ZP_05275372.1| preprotein translocase subunit SecG [Listeria monocytogenes FSL
          J2-064]
 gi|255017737|ref|ZP_05289863.1| preprotein translocase subunit SecG [Listeria monocytogenes FSL
          F2-515]
 gi|255026186|ref|ZP_05298172.1| preprotein translocase subunit SecG [Listeria monocytogenes FSL
          J2-003]
 gi|255028113|ref|ZP_05300064.1| preprotein translocase subunit SecG [Listeria monocytogenes LO28]
 gi|255521458|ref|ZP_05388695.1| preprotein translocase subunit SecG [Listeria monocytogenes FSL
          J1-175]
 gi|284802890|ref|YP_003414755.1| preprotein translocase subunit SecG [Listeria monocytogenes
          08-5578]
 gi|284996031|ref|YP_003417799.1| preprotein translocase subunit SecG [Listeria monocytogenes
          08-5923]
 gi|290893671|ref|ZP_06556652.1| predicted protein [Listeria monocytogenes FSL J2-071]
 gi|300765220|ref|ZP_07075205.1| preprotein translocase, SecG subunit [Listeria monocytogenes FSL
          N1-017]
 gi|315283563|ref|ZP_07871721.1| preprotein translocase, SecG subunit [Listeria marthii FSL
          S4-120]
 gi|16411939|emb|CAD00529.1| lmo2451 [Listeria monocytogenes EGD-e]
 gi|46881896|gb|AAT05190.1| preprotein translocase, SecG subunit [Listeria monocytogenes
          serotype 4b str. F2365]
 gi|217332717|gb|ACK38511.1| preprotein translocase, SecG subunit [Listeria monocytogenes
          HCC23]
 gi|225877461|emb|CAS06175.1| Putative preprotein translocase subunit SecG [Listeria
          monocytogenes serotype 4b str. CLIP 80459]
 gi|258600410|gb|EEW13735.1| predicted protein [Listeria monocytogenes FSL N3-165]
 gi|258606919|gb|EEW19527.1| predicted protein [Listeria monocytogenes FSL R2-503]
 gi|258610334|gb|EEW22942.1| predicted protein [Listeria monocytogenes F6900]
 gi|284058452|gb|ADB69393.1| preprotein translocase subunit SecG [Listeria monocytogenes
          08-5578]
 gi|284061498|gb|ADB72437.1| preprotein translocase subunit SecG [Listeria monocytogenes
          08-5923]
 gi|290556744|gb|EFD90277.1| predicted protein [Listeria monocytogenes FSL J2-071]
 gi|293583865|gb|EFF95897.1| predicted protein [Listeria monocytogenes HPB2262]
 gi|293591356|gb|EFF99690.1| predicted protein [Listeria monocytogenes J2818]
 gi|293594670|gb|EFG02431.1| predicted protein [Listeria monocytogenes FSL J1-194]
 gi|300514041|gb|EFK41103.1| preprotein translocase, SecG subunit [Listeria monocytogenes FSL
          N1-017]
 gi|307571979|emb|CAR85158.1| preprotein translocase, SecG subunit [Listeria monocytogenes L99]
 gi|313606963|gb|EFR83538.1| preprotein translocase, SecG subunit [Listeria monocytogenes FSL
          F2-208]
 gi|313612793|gb|EFR86777.1| preprotein translocase, SecG subunit [Listeria marthii FSL
          S4-120]
 gi|328465316|gb|EGF36573.1| preprotein translocase subunit SecG [Listeria monocytogenes 1816]
 gi|328471263|gb|EGF42163.1| preprotein translocase subunit SecG [Listeria monocytogenes 220]
          Length = 77

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L V+ +IV V L+ VI++Q   S+    + +  +         R     L R T +
Sbjct: 1  MSTVLTVLLIIVSVLLITVIILQPGKSAGLSGAISGGAEQLFGKQKARGLELILHRTTIV 60

Query: 53 LAFFFFATSIALGMI 67
          L+  FFA  IAL   
Sbjct: 61 LSVVFFAILIALAYF 75


>gi|222150776|ref|YP_002559929.1| preprotein translocase SecG subunit [Macrococcus caseolyticus
          JCSC5402]
 gi|222119898|dbj|BAH17233.1| preprotein translocase SecG subunit [Macrococcus caseolyticus
          JCSC5402]
          Length = 77

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 28/75 (37%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M   L V+ +I    L+ V+L+Q         +  G +         R     L R T +
Sbjct: 1  MNTLLTVLLIIDCFVLITVVLLQEGKSSGLSGAISGGAETLFGKQKQRGVELILNRITIV 60

Query: 53 LAFFFFATSIALGMI 67
           +   F  +IA+G  
Sbjct: 61 ASVLLFLITIAIGYF 75


>gi|78044803|ref|YP_359157.1| preprotein translocase subunit SecG [Carboxydothermus
          hydrogenoformans Z-2901]
 gi|77996918|gb|ABB15817.1| preprotein translocase, SecG subunit [Carboxydothermus
          hydrogenoformans Z-2901]
          Length = 77

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 13/73 (17%), Positives = 31/73 (42%), Gaps = 6/73 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          ++  L+ +H++  +G++  +L+QS  S+    S        F   +       + T +  
Sbjct: 4  LKGILVFLHILAALGVIAAVLLQSGKSAGLSGSIAGGAEILFGKKKGLDELFEKMTVVAV 63

Query: 55 FFFFATSIALGMI 67
            F   S+ L ++
Sbjct: 64 ILFMILSLVLALL 76


>gi|323141820|ref|ZP_08076686.1| preprotein translocase, SecG subunit [Phascolarctobacterium sp.
          YIT 12067]
 gi|322413712|gb|EFY04565.1| preprotein translocase, SecG subunit [Phascolarctobacterium sp.
          YIT 12067]
          Length = 86

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 19/74 (25%), Positives = 32/74 (43%), Gaps = 6/74 (8%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRST--AHSLGRFTAILAF 55
          +  LMV+ +IV + L+  +L+QS       S FG S      +       + + T  L  
Sbjct: 13 ETVLMVLEVIVCIALIGAVLLQSGKGGGMGSTFGGSDGAFFGKGNDLDTLMAKATIYLGV 72

Query: 56 FFFATSIALGMISR 69
           F   ++AL  I+ 
Sbjct: 73 AFAVITLALAKINA 86


>gi|147679052|ref|YP_001213267.1| preprotein translocase subunit SecG [Pelotomaculum
          thermopropionicum SI]
 gi|146275149|dbj|BAF60898.1| hypothetical membrane protein [Pelotomaculum thermopropionicum
          SI]
          Length = 75

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 16/72 (22%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSS------AFGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  + V H++  + L+  +++QS  S+        G+ + F   +     LG+ T +LA
Sbjct: 2  LKTIITVFHVLFSILLIAAVVLQSGRSAGLSGAITGGAETLFGKKKGLDELLGKVTIVLA 61

Query: 55 FFFFATSIALGM 66
            F A+++ L +
Sbjct: 62 VLFAASALVLVV 73


>gi|68161013|gb|AAY86938.1| lr1135 [Lactobacillus reuteri]
          Length = 79

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 15/72 (20%), Positives = 30/72 (41%), Gaps = 9/72 (12%)

Query: 8  VHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHS---LGRFTAILAFFFF 58
          + LI  V L+  +++Q +       S+  G + +  S R        +   T I    FF
Sbjct: 8  LFLIDCVVLIACVMMQPAKNDNDAMSALTGGAGDLFSRRKARGFEAVMQIVTTICGALFF 67

Query: 59 ATSIALGMISRY 70
            ++A+  +S +
Sbjct: 68 ILALAMIYVSSH 79


>gi|258517026|ref|YP_003193248.1| preprotein translocase subunit SecG [Desulfotomaculum acetoxidans
          DSM 771]
 gi|257780731|gb|ACV64625.1| preprotein translocase, SecG subunit [Desulfotomaculum
          acetoxidans DSM 771]
          Length = 75

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 15/72 (20%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILA 54
          ++  +  +H+++ +G++  +L+QS  S+        G+ + F   +     LG+ T +L+
Sbjct: 2  LKGIVTALHVLLALGIIASVLLQSGRSAGLSGAIAGGAETLFGKKKGLDELLGKVTVLLS 61

Query: 55 FFFFATSIALGM 66
            F   S+ L +
Sbjct: 62 VLFVVISLVLTV 73


>gi|189347123|ref|YP_001943652.1| preprotein translocase subunit SecG [Chlorobium limicola DSM 245]
 gi|189341270|gb|ACD90673.1| preprotein translocase, SecG subunit [Chlorobium limicola DSM 245]
          Length = 119

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 33/105 (31%), Gaps = 7/105 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-------NFTSVRSTAHSLGRFTAIL 53
           M +FL++V ++  + L+  +L+QS  S +  +             VR T   L + TAIL
Sbjct: 1   MHVFLVIVGILASIMLIGSVLLQSPKSGSGLTGGIASLGTVQTLGVRRTGDFLSKVTAIL 60

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDG 98
           A                   + K +                    
Sbjct: 61  AAVVMVFCFLAQFTLPAREAKLKQSNSVLQQSVPVAPSRTLPSSP 105


>gi|16801607|ref|NP_471875.1| preprotein translocase subunit SecG [Listeria innocua Clip11262]
 gi|16415067|emb|CAC97772.1| lin2545 [Listeria innocua Clip11262]
 gi|313617309|gb|EFR89748.1| preprotein translocase, SecG subunit [Listeria innocua FSL
          S4-378]
 gi|313622479|gb|EFR92913.1| preprotein translocase, SecG subunit [Listeria innocua FSL
          J1-023]
          Length = 77

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L V+ +IV V L+ VI++Q   S+    + +  +         R     L R T +
Sbjct: 1  MSTVLTVLLIIVSVLLITVIILQPGKSAGLSGAISGGAEQLFGKQKARGLELILHRTTIV 60

Query: 53 LAFFFFATSIALGMI 67
          L+  FFA  IAL   
Sbjct: 61 LSIVFFAILIALAYF 75


>gi|88801436|ref|ZP_01116964.1| co-chaperonin GroES [Polaribacter irgensii 23-P]
 gi|88782094|gb|EAR13271.1| co-chaperonin GroES [Polaribacter irgensii 23-P]
          Length = 111

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 35/99 (35%), Gaps = 6/99 (6%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS-----SNFTSVRSTAHSLGRFTAILAFF 56
               + V L+V V L+ ++++Q+       SS      +   V++T + L R T  LA  
Sbjct: 3   YNLFLGVILLVAVILILIVMVQNPKGGGLSSSFGGGAQSLGGVQNTNNFLDRTTWTLAIA 62

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNF 95
            FA  I L   +          +  +L            
Sbjct: 63  MFAL-ILLSNFAIDRGGANDFKLDNTLEGIETTVLTAPE 100


>gi|153932135|ref|YP_001382635.1| preprotein translocase, SecG subunit [Clostridium botulinum A
          str. ATCC 19397]
 gi|153937200|ref|YP_001386187.1| preprotein translocase, SecG subunit [Clostridium botulinum A
          str. Hall]
 gi|168177564|ref|ZP_02612228.1| preprotein translocase, SecG subunit [Clostridium botulinum NCTC
          2916]
 gi|226947452|ref|YP_002802543.1| preprotein translocase, SecG subunit [Clostridium botulinum A2
          str. Kyoto]
 gi|152928179|gb|ABS33679.1| preprotein translocase, SecG subunit [Clostridium botulinum A
          str. ATCC 19397]
 gi|152933114|gb|ABS38613.1| preprotein translocase, SecG subunit [Clostridium botulinum A
          str. Hall]
 gi|182670890|gb|EDT82864.1| preprotein translocase, SecG subunit [Clostridium botulinum NCTC
          2916]
 gi|226844499|gb|ACO87165.1| preprotein translocase, SecG subunit [Clostridium botulinum A2
          str. Kyoto]
          Length = 77

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 16/77 (20%), Positives = 33/77 (42%), Gaps = 8/77 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD--------SSAFGSSSNFTSVRSTAHSLGRFTAI 52
          M  F +++  IV + L+ V+L+Q S              +  +    R++   L R T +
Sbjct: 1  MHTFSIILLTIVSITLIVVVLMQPSKTNGLSGFMGGGSETFYSKNRTRTSESVLSRITVV 60

Query: 53 LAFFFFATSIALGMISR 69
           +  F    +A  ++S+
Sbjct: 61 CSILFAIIVLAQNLLSK 77


>gi|154491030|ref|ZP_02030971.1| hypothetical protein PARMER_00947 [Parabacteroides merdae ATCC
           43184]
 gi|154088778|gb|EDN87822.1| hypothetical protein PARMER_00947 [Parabacteroides merdae ATCC
           43184]
          Length = 123

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 34/101 (33%), Gaps = 4/101 (3%)

Query: 23  QSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDN 78
           Q+S        F SS+    VR T   L + T  LA      SI +           +  
Sbjct: 23  QNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWTLAGTVVVLSIVITAFIPRAQHANQSE 82

Query: 79  MHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +   + +++    N    D  + +  + +  SSS   A   
Sbjct: 83  IKEQINNAVTIDPNTVAPDFGTAQQPATAPVSSSEEEAPAN 123


>gi|138896637|ref|YP_001127090.1| preprotein translocase subunit SecG [Geobacillus
          thermodenitrificans NG80-2]
 gi|134268150|gb|ABO68345.1| Preprotein translocase subunit [Geobacillus thermodenitrificans
          NG80-2]
          Length = 78

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 32/75 (42%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L+ + +IV + L+ ++L+QS  S+    +    +         R       R T +
Sbjct: 1  MHALLVTLLVIVSIALIAIVLLQSGRSAGLSGAITGGAEQLFGKQKARGLDAVFQRVTVV 60

Query: 53 LAFFFFATSIALGMI 67
          LA  +F  +I +  +
Sbjct: 61 LAILYFVLTILVAYV 75


>gi|187777181|ref|ZP_02993654.1| hypothetical protein CLOSPO_00727 [Clostridium sporogenes ATCC
          15579]
 gi|187774109|gb|EDU37911.1| hypothetical protein CLOSPO_00727 [Clostridium sporogenes ATCC
          15579]
          Length = 77

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 15/77 (19%), Positives = 33/77 (42%), Gaps = 8/77 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD--------SSAFGSSSNFTSVRSTAHSLGRFTAI 52
          M  F +++  IV + L+ V+L+Q S              +  +    R++   L R T +
Sbjct: 1  MHTFSIILLTIVSITLIVVVLMQPSKTNGLSGFMGGGSETFYSKNRTRTSESVLSRITVV 60

Query: 53 LAFFFFATSIALGMISR 69
           +  F    +A  ++++
Sbjct: 61 CSILFAIIVLAQNLLAK 77


>gi|241894755|ref|ZP_04782051.1| Sec family type I general secretory protein SecG [Weissella
          paramesenteroides ATCC 33313]
 gi|241871967|gb|EER75718.1| Sec family type I general secretory protein SecG [Weissella
          paramesenteroides ATCC 33313]
          Length = 79

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/79 (21%), Positives = 32/79 (40%), Gaps = 9/79 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS---------VRSTAHSLGRFTA 51
          M   L+   +IV   ++  +++Q S      S+ +             R     + R TA
Sbjct: 1  MYNILLTAMIIVGALIIIAVMMQPSKQQDALSALSGGGGGDLFATQKARGFVAVMQRVTA 60

Query: 52 ILAFFFFATSIALGMISRY 70
          +LA  +F   +AL  +S +
Sbjct: 61 VLAAIWFILGLALVYLSSH 79


>gi|167627202|ref|YP_001677702.1| preprotein translocase subunit SecG [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|241667765|ref|ZP_04755343.1| preprotein translocase subunit SecG [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254876309|ref|ZP_05249019.1| preprotein translocase subunit secG [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|167597203|gb|ABZ87201.1| preprotein translocase, subunit G, membrane protein [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
 gi|254842330|gb|EET20744.1| preprotein translocase subunit secG [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
          Length = 112

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 28/88 (31%), Gaps = 8/88 (9%)

Query: 23  QSSDSSAFG------SSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMI--SRYTSTR 74
           Q    +  G      +S+     +  A  L + T      FF   + LG +  S+ T+  
Sbjct: 23  QQGKGANMGVSFGAGASNTVFGSKGAASFLFKMTVFFTAVFFVCCLTLGYLGKSQNTTAS 82

Query: 75  YKDNMHRSLVDSIKDQGNDNFGDGSSPK 102
                  + + S  DQ        S+  
Sbjct: 83  VSSVSTDNSIASQYDQYQKEIDQSSTST 110


>gi|308064034|gb|ADO05921.1| preprotein translocase subunit SecG [Helicobacter pylori Sat464]
          Length = 202

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/103 (11%), Positives = 26/103 (25%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG              +   K
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVTNTIALGYFYNKEYGKSILDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +           +   +   + +   L+               
Sbjct: 89  ELSPLVPATGTLNPTLNPTLNPTLNPLEQAPTNPLMPKQTPNE 131


>gi|257452140|ref|ZP_05617439.1| protein translocase subunit secG [Fusobacterium sp. 3_1_5R]
 gi|257466066|ref|ZP_05630377.1| protein translocase subunit secG [Fusobacterium gonidiaformans
          ATCC 25563]
 gi|315917222|ref|ZP_07913462.1| predicted protein [Fusobacterium gonidiaformans ATCC 25563]
 gi|317058685|ref|ZP_07923170.1| predicted protein [Fusobacterium sp. 3_1_5R]
 gi|313684361|gb|EFS21196.1| predicted protein [Fusobacterium sp. 3_1_5R]
 gi|313691097|gb|EFS27932.1| predicted protein [Fusobacterium gonidiaformans ATCC 25563]
          Length = 74

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 33/73 (45%), Gaps = 6/73 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS------SDSSAFGSSSNFTSVRSTAHSLGRFTAILA 54
          M+  L V   I+ + L+ ++LIQ       S S   GSS+    +      L + T ++A
Sbjct: 1  METLLTVFLFILAIALIILVLIQPDQSHGMSASMGMGSSNTVFGISKDGGPLAKATKVVA 60

Query: 55 FFFFATSIALGMI 67
            F   ++ L +I
Sbjct: 61 ALFIIDALLLYLI 73


>gi|91206161|ref|YP_538516.1| preprotein translocase subunit SecG [Rickettsia bellii RML369-C]
 gi|157826537|ref|YP_001495601.1| preprotein translocase subunit SecG [Rickettsia bellii OSU
          85-389]
 gi|122425165|sp|Q1RGT7|SECG_RICBR RecName: Full=Protein-export membrane protein secG
 gi|91069705|gb|ABE05427.1| Protein-export membrane protein secG [Rickettsia bellii RML369-C]
 gi|157801841|gb|ABV78564.1| preprotein translocase subunit SecG [Rickettsia bellii OSU
          85-389]
          Length = 100

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 40/97 (41%), Gaps = 5/97 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS-----SSNFTSVRSTAHSLGRFTAILAF 55
          M   L+ VH+ + + L+ VIL+Q S S    S     +    S ++  + L + T ILA 
Sbjct: 1  MLDILLFVHITIAILLIIVILMQRSGSDGISSISGGGNMGVISAKTANNFLTKSTVILAS 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
           F   +I L  +S          ++    + + +   
Sbjct: 61 LFLINAIILANLSSQKKPDLVSKINEIEENQVDNSLP 97


>gi|304438601|ref|ZP_07398540.1| preprotein translocase subunit SecG [Selenomonas sp. oral taxon
          149 str. 67H29BP]
 gi|304368439|gb|EFM22125.1| preprotein translocase subunit SecG [Selenomonas sp. oral taxon
          149 str. 67H29BP]
          Length = 83

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 28/73 (38%), Gaps = 6/73 (8%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILAFF 56
            LMV+  IV + L+  +L Q + S+  G              R     L R T + A  
Sbjct: 11 TLLMVLDAIVAIILIASVLGQEAKSAGMGGLDGGEDTVFSGKARGMDALLARVTVVFAIL 70

Query: 57 FFATSIALGMISR 69
          F   +I +  +S 
Sbjct: 71 FGVITIIIARLSS 83


>gi|157803265|ref|YP_001491814.1| preprotein translocase subunit SecG [Rickettsia canadensis str.
          McKiel]
 gi|157784528|gb|ABV73029.1| protein-export membrane protein [Rickettsia canadensis str.
          McKiel]
          Length = 100

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 41/97 (42%), Gaps = 5/97 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+ VH+ + + L+ VIL+Q S S         ++    S ++ ++ L + T IL  
Sbjct: 1  MIDILLFVHITIAILLIIVILMQRSGSDGISSISGGNNMGVVSAKTVSNFLTKSTVILMI 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
           F   +I L  +S    +     ++    +  ++   
Sbjct: 61 LFLINAIVLANLSSKKKSDLVSKINEIEENQTENSLP 97


>gi|312864568|ref|ZP_07724799.1| preprotein translocase, SecG subunit [Streptococcus downei F0415]
 gi|311099695|gb|EFQ57908.1| preprotein translocase, SecG subunit [Streptococcus downei F0415]
          Length = 78

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 31/78 (39%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   L+   L++ V L+  I +Q   + +     +  S         R     + RFT +
Sbjct: 1  MYNILLTALLVMSVILIIAIFMQPQKNPSSNVFDSSGSEALFERTKARGFEAFMERFTGV 60

Query: 53 LAFFFFATSIALGMISRY 70
          L F +   ++ L ++S  
Sbjct: 61 LTFLWLLDALVLAILSSK 78


>gi|188528044|ref|YP_001910731.1| preprotein translocase subunit SecG [Helicobacter pylori Shi470]
 gi|188144284|gb|ACD48701.1| preprotein translocase subunit SecG [Helicobacter pylori Shi470]
          Length = 199

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 14/101 (13%), Positives = 29/101 (28%), Gaps = 3/101 (2%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLV 84
              +  GS+ +    +  A  + + T  L   F A +IALG    Y     K  +  +  
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVANTIALGYF--YNKEYGKSILDETKT 86

Query: 85  DSIKDQGNDNFGDGSSPKLDSV-SAKSSSSVVAGKRSSSRT 124
           +          G  +     ++    +            + 
Sbjct: 87  NKELSPLVPATGTLNPTLNPTLNPTLNPLEQALTNPLMPKQ 127


>gi|207109219|ref|ZP_03243381.1| preprotein translocase subunit SecG [Helicobacter pylori
           HPKX_438_CA4C1]
          Length = 176

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/103 (12%), Positives = 26/103 (25%), Gaps = 8/103 (7%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRY--------TSTRYK 76
              +  GS+ +    +  A  + + T  L   F   +IALG              +   K
Sbjct: 29  GLGAYSGSNESLFGAKGPASFMAKLTMFLGLLFVINTIALGYFYNKEYGKSILDETKTNK 88

Query: 77  DNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           D           +   +   + +   L+               
Sbjct: 89  DLSPLVPATGTLNPTLNPTLNPTLNPLEQAPTNLLMPKQTPDE 131


>gi|116618816|ref|YP_819187.1| preprotein translocase subunit SecG [Leuconostoc mesenteroides
          subsp. mesenteroides ATCC 8293]
 gi|227431095|ref|ZP_03913153.1| Sec family type I general secretory protein SecG [Leuconostoc
          mesenteroides subsp. cremoris ATCC 19254]
 gi|116097663|gb|ABJ62814.1| Preprotein translocase subunit SecG [Leuconostoc mesenteroides
          subsp. mesenteroides ATCC 8293]
 gi|227353135|gb|EEJ43303.1| Sec family type I general secretory protein SecG [Leuconostoc
          mesenteroides subsp. cremoris ATCC 19254]
          Length = 78

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV--------RSTAHSLGRFTAI 52
          M+  L +  ++V   L+  +++Q S      S+ +  +         R     + R TA+
Sbjct: 1  MEKLLTIALIVVGFLLIMTVMMQPSKQQDALSALSGGAGDLFAERKSRGFEAVMRRTTAV 60

Query: 53 LAFFFFATSIALGMISRY 70
          L   +F    AL  IS +
Sbjct: 61 LGALWFVIGFALMYISAH 78


>gi|302670655|ref|YP_003830615.1| preprotein translocase subunit SecG [Butyrivibrio proteoclasticus
          B316]
 gi|302395128|gb|ADL34033.1| preprotein translocase subunit SecG [Butyrivibrio proteoclasticus
          B316]
          Length = 80

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 28/71 (39%), Gaps = 8/71 (11%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF--------TSVRSTAHSLGRFTAILAF 55
           + V+ +++   LV ++L Q   S   G+               RS    L + T IL+ 
Sbjct: 7  IVGVIFMLICAALVVLVLAQEGKSQGLGAIQGTVENTYWGKNKGRSREGVLKKVTIILSV 66

Query: 56 FFFATSIALGM 66
           F   +I L M
Sbjct: 67 LFVVIAIVLNM 77


>gi|153940855|ref|YP_001389594.1| preprotein translocase, SecG subunit [Clostridium botulinum F
          str. Langeland]
 gi|152936751|gb|ABS42249.1| preprotein translocase, SecG subunit [Clostridium botulinum F
          str. Langeland]
 gi|295317690|gb|ADF98067.1| preprotein translocase, SecG subunit [Clostridium botulinum F
          str. 230613]
          Length = 77

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 34/77 (44%), Gaps = 8/77 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD--------SSAFGSSSNFTSVRSTAHSLGRFTAI 52
          M IF +++  IV + L+ V+L+Q S              +  +    R++   L R T I
Sbjct: 1  MYIFSIILLTIVSITLIVVVLMQPSKTNGLSGFMGGGSETFYSKNRTRTSESVLSRITVI 60

Query: 53 LAFFFFATSIALGMISR 69
           +  F    +A  ++++
Sbjct: 61 CSILFAIIVLAQNLLAK 77


>gi|237740332|ref|ZP_04570813.1| translocase subunit secG [Fusobacterium sp. 2_1_31]
 gi|262068277|ref|ZP_06027889.1| preprotein translocase, SecG subunit [Fusobacterium periodonticum
          ATCC 33693]
 gi|294782574|ref|ZP_06747900.1| preprotein translocase, SecG subunit [Fusobacterium sp.
          1_1_41FAA]
 gi|229422349|gb|EEO37396.1| translocase subunit secG [Fusobacterium sp. 2_1_31]
 gi|291378015|gb|EFE85533.1| preprotein translocase, SecG subunit [Fusobacterium periodonticum
          ATCC 33693]
 gi|294481215|gb|EFG28990.1| preprotein translocase, SecG subunit [Fusobacterium sp.
          1_1_41FAA]
          Length = 74

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/70 (22%), Positives = 28/70 (40%), Gaps = 6/70 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L V+  +    L+ ++LIQ         S   G+S+    +      L + T ++A
Sbjct: 1  MSTLLNVLLFLSAFILIVLVLIQPDRSHGMTASMGMGASNTIFGINKDGGPLAKATEVVA 60

Query: 55 FFFFATSIAL 64
            F   S+ L
Sbjct: 61 TLFIVCSLLL 70


>gi|289522120|ref|ZP_06438974.1| preprotein translocase, SecG subunit [Anaerobaculum
          hydrogeniformans ATCC BAA-1850]
 gi|289504650|gb|EFD25814.1| preprotein translocase, SecG subunit [Anaerobaculum
          hydrogeniformans ATCC BAA-1850]
          Length = 77

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/77 (20%), Positives = 34/77 (44%), Gaps = 7/77 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA-------HSLGRFTAIL 53
          M +F+ ++ +++ V L+ ++++Q    S F       +    +         L + T +L
Sbjct: 1  MFLFVSLLQILIAVALIGIVMLQRRKQSGFAGVFGGGTQADMSGGQWQRLSGLSKVTVLL 60

Query: 54 AFFFFATSIALGMISRY 70
             F  TS+ L M+S  
Sbjct: 61 LASFMVTSLILVMMSAR 77


>gi|308183365|ref|YP_003927492.1| preprotein translocase subunit SecG [Helicobacter pylori PeCan4]
 gi|308065550|gb|ADO07442.1| preprotein translocase subunit SecG [Helicobacter pylori PeCan4]
          Length = 208

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 14/84 (16%), Positives = 28/84 (33%), Gaps = 2/84 (2%)

Query: 25  SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLV 84
              +  GS+ +    +  A  + + T  L   F A +IALG    Y     K  +  +  
Sbjct: 29  GLGAYSGSNDSLFGAKGPASFMAKLTMFLGLLFVANTIALGYF--YNKEYGKSILDETKT 86

Query: 85  DSIKDQGNDNFGDGSSPKLDSVSA 108
           +          G  +     +++ 
Sbjct: 87  NKELSPLVPATGTLNPTLNPTLNP 110


>gi|150391307|ref|YP_001321356.1| preprotein translocase, SecG subunit [Alkaliphilus
          metalliredigens QYMF]
 gi|149951169|gb|ABR49697.1| preprotein translocase, SecG subunit [Alkaliphilus
          metalliredigens QYMF]
          Length = 77

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 32/76 (42%), Gaps = 9/76 (11%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS---------VRSTAHSLGRFTA 51
          M++FLM++ +I  + L+  IL+QS   +    + +             +     L + T 
Sbjct: 1  MRMFLMILQVIASLVLIGSILMQSGKGAGLSGAISGGGGAEQMWGKKGKGYEGMLSKVTK 60

Query: 52 ILAFFFFATSIALGMI 67
          + A  F   ++ L  I
Sbjct: 61 VGAVMFIVVAVLLVTI 76


>gi|168334578|ref|ZP_02692734.1| hypothetical protein Epulo_06268 [Epulopiscium sp. 'N.t.
          morphotype B']
          Length = 78

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 34/73 (46%), Gaps = 8/73 (10%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSD----SSAFGSSSNFTSVRSTAHSL----GRFTAILA 54
            L ++ +I    ++ ++L+Q       S   G S N    ++  +SL     RFT + A
Sbjct: 6  TILTIIFVIASFAIIIIVLMQEGKSTGLSGMTGESENTFWAQNKKNSLEGKIERFTKVTA 65

Query: 55 FFFFATSIALGMI 67
            F  +++ LG+I
Sbjct: 66 AIFMISALILGII 78


>gi|325663559|ref|ZP_08151969.1| preprotein translocase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|331087076|ref|ZP_08336150.1| preprotein translocase [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|325470458|gb|EGC73689.1| preprotein translocase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|330409356|gb|EGG88803.1| preprotein translocase [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 80

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 7/71 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-------NFTSVRSTAHSLGRFTAIL 53
          ++I L ++ +I  + L  ++L+Q   S+  GS +            RS   +L + T  L
Sbjct: 4  LKIVLTILFVIDGIALTIIVLLQEGKSAGLGSIAGGAETYWGQNKGRSMEGALVKSTKFL 63

Query: 54 AFFFFATSIAL 64
          A  F   + AL
Sbjct: 64 ACLFMILAAAL 74


>gi|282899984|ref|ZP_06307945.1| Preprotein translocase SecG subunit [Cylindrospermopsis
          raciborskii CS-505]
 gi|281195254|gb|EFA70190.1| Preprotein translocase SecG subunit [Cylindrospermopsis
          raciborskii CS-505]
          Length = 77

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 29/67 (43%), Gaps = 4/67 (5%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFFFF 58
            L  +     +GL+ ++L+ S      G+       F+S +S  ++L R T  LA  F 
Sbjct: 5  NILQGIWAFSALGLIVLVLLHSPKGDGIGAIGGQAQLFSSTKSAENTLNRVTWALAVIFL 64

Query: 59 ATSIALG 65
            ++ L 
Sbjct: 65 GLTVVLS 71


>gi|188994122|ref|YP_001928374.1| preprotein translocase subunit SecG [Porphyromonas gingivalis ATCC
           33277]
 gi|188593802|dbj|BAG32777.1| hypothetical protein PGN_0258 [Porphyromonas gingivalis ATCC 33277]
          Length = 128

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/110 (16%), Positives = 41/110 (37%), Gaps = 5/110 (4%)

Query: 19  VILIQSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALG-MISRYTST 73
           V+++Q+S        F SS+    VR T   L + T   A      +I     +      
Sbjct: 19  VVVVQNSKGGGLAAGFASSNQIMGVRKTTDFLEKATWWSAGIIAVLAIVSTHFLHTGKVD 78

Query: 74  RYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSSR 123
             ++ +  +L   +K++ N    +       + SA+ ++     +   ++
Sbjct: 79  ESQNVLKETLDKKVKEEKNSAVINFGGDAAATESARPATGEATPEEGQAQ 128


>gi|325283559|ref|YP_004256100.1| preprotein translocase, SecG subunit [Deinococcus proteolyticus
          MRP]
 gi|324315368|gb|ADY26483.1| preprotein translocase, SecG subunit [Deinococcus proteolyticus
          MRP]
          Length = 75

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/70 (22%), Positives = 31/70 (44%), Gaps = 4/70 (5%)

Query: 3  IFLMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
             ++++ +V VG V  +L+Q    +  S +  S  +    +     L R TAIL   F 
Sbjct: 6  TIFLILYALVAVGTVFFVLLQTPKQAGMSPSMASGGDLFGGQGVEGGLVRTTAILGGLFM 65

Query: 59 ATSIALGMIS 68
            ++ +  +S
Sbjct: 66 LLALLINYVS 75


>gi|306819795|ref|ZP_07453450.1| preprotein translocase subunit SecG [Eubacterium yurii subsp.
          margaretiae ATCC 43715]
 gi|304552164|gb|EFM40100.1| preprotein translocase subunit SecG [Eubacterium yurii subsp.
          margaretiae ATCC 43715]
          Length = 81

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 33/74 (44%), Gaps = 7/74 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT-------SVRSTAHSLGRFTAIL 53
          ++  L+++ +IV + L+  I++QS   + F  + +           +       + T++ 
Sbjct: 7  LKTGLIILEMIVSIALIFSIMLQSGRDAGFSGAVSGMNDNLSGNKAKGLDEFYKKITSVT 66

Query: 54 AFFFFATSIALGMI 67
          A  F   SIAL  I
Sbjct: 67 AILFILLSIALVAI 80


>gi|51473265|ref|YP_067022.1| preprotein translocase subunit SecG [Rickettsia typhi str.
          Wilmington]
 gi|81390289|sp|Q68XV2|SECG_RICTY RecName: Full=Protein-export membrane protein secG
 gi|51459577|gb|AAU03540.1| protein-export membrane protein SecG [Rickettsia typhi str.
          Wilmington]
          Length = 100

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 39/97 (40%), Gaps = 5/97 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+ VH+ + + L+ VIL+Q S S         ++    S ++  + L + T IL  
Sbjct: 1  MLDILLFVHITISILLIIVILMQRSGSGGISGISGDNNMGVVSAKTVGNFLSKSTIILTT 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
           F   +I L  +S    +     ++    +   +   
Sbjct: 61 LFLINAIILANLSSKKKSNLVSKINEIEENQTDNSLP 97


>gi|302386592|ref|YP_003822414.1| preprotein translocase, SecG subunit [Clostridium saccharolyticum
          WM1]
 gi|302197220|gb|ADL04791.1| preprotein translocase, SecG subunit [Clostridium saccharolyticum
          WM1]
          Length = 77

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 22/59 (37%), Gaps = 7/59 (11%)

Query: 13 VVGLVCVILIQSSDSSAFGSSSNF-------TSVRSTAHSLGRFTAILAFFFFATSIAL 64
           V L  +IL+Q   S   GS              RS    L +FT   A  FF  ++ L
Sbjct: 14 CVALSAIILLQEGKSQGLGSIGGMADTYWGKNKGRSMEGKLEKFTKYGAVLFFILALVL 72


>gi|307297747|ref|ZP_07577553.1| preprotein translocase, SecG subunit [Thermotogales bacterium
          mesG1.Ag.4.2]
 gi|306917007|gb|EFN47389.1| preprotein translocase, SecG subunit [Thermotogales bacterium
          mesG1.Ag.4.2]
          Length = 83

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 32/74 (43%), Gaps = 6/74 (8%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRSTA-HSLGRFTAILAFFF 57
           L+ +H+ + VGL   +++Q S       +  G +S+    R     ++G+ T  LA  F
Sbjct: 7  VLISLHIAISVGLGIAVMMQMSKSAELGGAFGGGASHTMFGRKKGLDTMGKITLGLAIGF 66

Query: 58 FATSIALGMISRYT 71
             SI +  +    
Sbjct: 67 MVNSILIAFVISRA 80


>gi|312880662|ref|ZP_07740462.1| preprotein translocase, SecG subunit [Aminomonas paucivorans DSM
          12260]
 gi|310783953|gb|EFQ24351.1| preprotein translocase, SecG subunit [Aminomonas paucivorans DSM
          12260]
          Length = 76

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 33/76 (43%), Gaps = 7/76 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA-------HSLGRFTAIL 53
          M+ FL ++ +++ VGL+ VIL+Q   +  F       +            + L + T +L
Sbjct: 1  MKAFLSILQILLSVGLMGVILLQHRKTGGFSGMFGGGTQADAGGGSWQRMNGLNKATVVL 60

Query: 54 AFFFFATSIALGMISR 69
             F   S+ L ++  
Sbjct: 61 TALFMLFSLVLVVLPS 76


>gi|116494480|ref|YP_806214.1| preprotein translocase subunit SecG [Lactobacillus casei ATCC
          334]
 gi|116104630|gb|ABJ69772.1| Preprotein translocase subunit SecG [Lactobacillus casei ATCC
          334]
          Length = 78

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 27/78 (34%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD--------SSAFGSSSNFTSVRSTAHSLGRFTAI 52
          MQ  L    +I  + +V   L+Q S         S         T  R     + + T  
Sbjct: 1  MQSLLTTFLVIDSILIVIATLMQPSKQQDALSALSGGATDLFGKTKSRGFEAFMEKVTVA 60

Query: 53 LAFFFFATSIALGMISRY 70
          L   FF  +IAL  +  +
Sbjct: 61 LGVIFFGLAIALVYLEAH 78


>gi|256026786|ref|ZP_05440620.1| protein translocase subunit secG [Fusobacterium sp. D11]
 gi|260494788|ref|ZP_05814918.1| preprotein translocase, SecG subunit [Fusobacterium sp. 3_1_33]
 gi|289764781|ref|ZP_06524159.1| translocase subunit secG [Fusobacterium sp. D11]
 gi|260197950|gb|EEW95467.1| preprotein translocase, SecG subunit [Fusobacterium sp. 3_1_33]
 gi|289716336|gb|EFD80348.1| translocase subunit secG [Fusobacterium sp. D11]
          Length = 74

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 26/70 (37%), Gaps = 6/70 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
          M   L V+  +    L+ ++LIQ   S    +S           +      L + T ++A
Sbjct: 1  MSTLLNVLLFLSAFVLIVLVLIQPDRSHGMTASMGLGASNTIFGINKDGGPLAKATEVVA 60

Query: 55 FFFFATSIAL 64
            F   S+ L
Sbjct: 61 TLFIICSLLL 70


>gi|323701502|ref|ZP_08113175.1| preprotein translocase, SecG subunit [Desulfotomaculum
          nigrificans DSM 574]
 gi|323533511|gb|EGB23377.1| preprotein translocase, SecG subunit [Desulfotomaculum
          nigrificans DSM 574]
          Length = 76

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 7/73 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS-------VRSTAHSLGRFTAIL 53
          ++  +  VH+++ + L+ V+L+QS  S+    S    +        +     LGR TA +
Sbjct: 2  LKGLVTAVHVLIALSLIAVVLLQSGKSAGLSGSIAGGAEAIFGGKKKGLDEKLGRLTAFI 61

Query: 54 AFFFFATSIALGM 66
          A  F  TS+ L +
Sbjct: 62 AIAFGITSMVLVV 74


>gi|254304132|ref|ZP_04971490.1| protein translocase subunit SecG [Fusobacterium nucleatum subsp.
          polymorphum ATCC 10953]
 gi|148324324|gb|EDK89574.1| protein translocase subunit SecG [Fusobacterium nucleatum subsp.
          polymorphum ATCC 10953]
          Length = 74

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/70 (22%), Positives = 26/70 (37%), Gaps = 6/70 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
          M   L V+  +    L+ ++LIQ   S    +S           +      L R T ++A
Sbjct: 1  MSTLLNVLLFLSAFVLIVLVLIQPDRSHGMTASMGLGASNTIFGINKDGGPLARATEVVA 60

Query: 55 FFFFATSIAL 64
            F   S+ L
Sbjct: 61 TLFIICSLLL 70


>gi|281419748|ref|ZP_06250747.1| preprotein translocase, SecG subunit [Prevotella copri DSM 18205]
 gi|281406277|gb|EFB36957.1| preprotein translocase, SecG subunit [Prevotella copri DSM 18205]
          Length = 131

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/96 (16%), Positives = 34/96 (35%), Gaps = 4/96 (4%)

Query: 16  LVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYT 71
           ++ ++LIQ S        F S+++   VR T   + + T  LA      S+A   ++   
Sbjct: 17  MIFIVLIQESKGGGLASNFSSTNSIMGVRKTTDIVEKLTWGLAAALVVISVACAYVAPQA 76

Query: 72  STRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
           +         +   +          D ++    +V 
Sbjct: 77  AGESSVLEGATQEQTALPAMPGASKDAAAGAQKAVP 112


>gi|237745011|ref|ZP_04575492.1| translocase subunit secG [Fusobacterium sp. 7_1]
 gi|294785820|ref|ZP_06751108.1| preprotein translocase, SecG subunit [Fusobacterium sp. 3_1_27]
 gi|229432240|gb|EEO42452.1| translocase subunit secG [Fusobacterium sp. 7_1]
 gi|294487534|gb|EFG34896.1| preprotein translocase, SecG subunit [Fusobacterium sp. 3_1_27]
          Length = 74

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 26/70 (37%), Gaps = 6/70 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
          M   L V+  +    L+ ++LIQ   S    +S           +      L + T ++A
Sbjct: 1  MSTLLNVLLFLSAFVLIVLVLIQPDRSHGMTASMGLGASNTIFGINKDGGPLAKATEVVA 60

Query: 55 FFFFATSIAL 64
            F   S+ L
Sbjct: 61 ALFIICSLLL 70


>gi|329578098|gb|EGG59510.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX1467]
          Length = 78

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 30/78 (38%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M   ++ + +I+ V +V  +++Q S      S+  G +         R     + R TA+
Sbjct: 1  MYNLILTLVIILSVLIVITVMMQPSKQNSTASAFTGGADKLFGKQKARGFEAVMQRSTAV 60

Query: 53 LAFFFFATSIALGMISRY 70
          L   +      L  +S  
Sbjct: 61 LGAIWMILLFVLAFLSSK 78


>gi|261749503|ref|YP_003257189.1| preprotein translocase subunit [Blattabacterium sp. (Periplaneta
          americana) str. BPLAN]
 gi|261497596|gb|ACX84046.1| preprotein translocase subunit [Blattabacterium sp. (Periplaneta
          americana) str. BPLAN]
          Length = 79

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 13/63 (20%), Positives = 25/63 (39%), Gaps = 7/63 (11%)

Query: 1  MQ-IFLMVVHLIV-VVGLVCVILIQSSDSSA-----FGSSSNFTSVRSTAHSLGRFTAIL 53
          M    L+   +I+  + L+ +ILIQ+             +  F  ++ T   L + T  L
Sbjct: 1  MYSTILLGFFIILTCLFLIGMILIQNPKKGFIYQSFMEKNFRFFGIKRTNIFLEKITWTL 60

Query: 54 AFF 56
          +  
Sbjct: 61 SII 63


>gi|19703873|ref|NP_603435.1| protein translocase subunit secG [Fusobacterium nucleatum subsp.
          nucleatum ATCC 25586]
 gi|296329375|ref|ZP_06871875.1| preprotein translocase subunit SecG [Fusobacterium nucleatum
          subsp. nucleatum ATCC 23726]
 gi|19714033|gb|AAL94734.1| Protein translocase subunit secG [Fusobacterium nucleatum subsp.
          nucleatum ATCC 25586]
 gi|296153495|gb|EFG94313.1| preprotein translocase subunit SecG [Fusobacterium nucleatum
          subsp. nucleatum ATCC 23726]
          Length = 74

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/70 (22%), Positives = 26/70 (37%), Gaps = 6/70 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
          M   L V+  +    L+ ++LIQ   S    +S           +      L R T ++A
Sbjct: 1  MSTLLNVLLFLSAFILIVLVLIQPDRSHGMTASMGLGASNTIFGINKDGGPLARATEVVA 60

Query: 55 FFFFATSIAL 64
            F   S+ L
Sbjct: 61 TLFIICSLLL 70


>gi|170760735|ref|YP_001785562.1| preprotein translocase, SecG subunit [Clostridium botulinum A3
          str. Loch Maree]
 gi|169407724|gb|ACA56135.1| preprotein translocase, SecG subunit [Clostridium botulinum A3
          str. Loch Maree]
          Length = 77

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 34/77 (44%), Gaps = 8/77 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD--------SSAFGSSSNFTSVRSTAHSLGRFTAI 52
          M IF +V+  IV + L+ V+L+Q S              +  +    R++   L R T I
Sbjct: 1  MHIFSIVLLTIVSITLIVVVLMQPSKTNGLSGFMGGGSETFYSKNRTRTSESVLSRITVI 60

Query: 53 LAFFFFATSIALGMISR 69
           +  F    +A  ++++
Sbjct: 61 CSILFAIIVLAQNLLAK 77


>gi|134300818|ref|YP_001114314.1| preprotein translocase subunit SecG [Desulfotomaculum reducens
          MI-1]
 gi|134053518|gb|ABO51489.1| protein translocase subunit secG [Desulfotomaculum reducens MI-1]
          Length = 76

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 33/73 (45%), Gaps = 7/73 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSV--RSTAHSLGRFTAIL 53
          ++  +  +H+++ + L+  +L+QS        +  G +        +     LGR TA +
Sbjct: 2  LKGLVTAIHVLIALSLIATVLLQSGKSAGLSGAIAGGAETLFGGKKKGLDEKLGRLTAFI 61

Query: 54 AFFFFATSIALGM 66
          A  F  TS+ L +
Sbjct: 62 AIAFAITSMVLVV 74


>gi|19110418|gb|AAL82792.1| export membrane protein SecG [Rickettsia typhi]
          Length = 100

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 38/97 (39%), Gaps = 5/97 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
          M    + VH+ + + L+ VIL+Q S S         ++    S ++  + L + T IL  
Sbjct: 1  MIDIFLFVHITISILLIIVILMQRSGSGGISGISGDNNMGVVSAKTVGNFLSKSTIILTT 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
           F   +I L  +S    +     ++    +   +   
Sbjct: 61 LFLINAIILANLSSKKKSNLVSKINEIEENQTDNSLP 97


>gi|29377105|ref|NP_816259.1| preprotein translocase, SecG subunit [Enterococcus faecalis V583]
 gi|227519695|ref|ZP_03949744.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0104]
 gi|227554115|ref|ZP_03984162.1| preprotein translocase, SecG subunit [Enterococcus faecalis HH22]
 gi|229545012|ref|ZP_04433737.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX1322]
 gi|229549256|ref|ZP_04437981.1| preprotein translocase, SecG subunit [Enterococcus faecalis ATCC
          29200]
 gi|255971970|ref|ZP_05422556.1| preprotein translocase SecG subunit [Enterococcus faecalis T1]
 gi|255975027|ref|ZP_05425613.1| preprotein translocase SecG subunit [Enterococcus faecalis T2]
 gi|256616868|ref|ZP_05473714.1| preprotein translocase SecG subunit [Enterococcus faecalis ATCC
          4200]
 gi|256763256|ref|ZP_05503836.1| preprotein translocase SecG subunit [Enterococcus faecalis T3]
 gi|256853929|ref|ZP_05559294.1| preprotein translocase [Enterococcus faecalis T8]
 gi|256957857|ref|ZP_05562028.1| preprotein translocase SecG subunit [Enterococcus faecalis DS5]
 gi|256961144|ref|ZP_05565315.1| preprotein translocase SecG subunit [Enterococcus faecalis
          Merz96]
 gi|256963737|ref|ZP_05567908.1| preprotein translocase SecG subunit [Enterococcus faecalis
          HIP11704]
 gi|257079795|ref|ZP_05574156.1| preprotein translocase SecG subunit [Enterococcus faecalis JH1]
 gi|257081859|ref|ZP_05576220.1| preprotein translocase SecG subunit [Enterococcus faecalis E1Sol]
 gi|257084401|ref|ZP_05578762.1| preprotein translocase SecG subunit [Enterococcus faecalis Fly1]
 gi|257087600|ref|ZP_05581961.1| preprotein translocase SecG subunit [Enterococcus faecalis D6]
 gi|257090759|ref|ZP_05585120.1| preprotein translocase secG [Enterococcus faecalis CH188]
 gi|257416807|ref|ZP_05593801.1| preprotein translocase SecG subunit [Enterococcus faecalis
          AR01/DG]
 gi|257420023|ref|ZP_05597017.1| preprotein translocase subunit secG [Enterococcus faecalis T11]
 gi|257421798|ref|ZP_05598788.1| preprotein translocase subunit secG [Enterococcus faecalis X98]
 gi|293384090|ref|ZP_06629984.1| preprotein translocase, SecG subunit [Enterococcus faecalis R712]
 gi|293386905|ref|ZP_06631474.1| preprotein translocase, SecG subunit [Enterococcus faecalis S613]
 gi|294781382|ref|ZP_06746724.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          PC1.1]
 gi|300860677|ref|ZP_07106764.1| preprotein translocase, SecG subunit [Enterococcus faecalis TUSoD
          Ef11]
 gi|307270666|ref|ZP_07551957.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX4248]
 gi|307271684|ref|ZP_07552955.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0855]
 gi|307276866|ref|ZP_07557977.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX2134]
 gi|307287557|ref|ZP_07567600.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0109]
 gi|307290368|ref|ZP_07570283.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0411]
 gi|312899992|ref|ZP_07759310.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0470]
 gi|312902389|ref|ZP_07761595.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0635]
 gi|312907959|ref|ZP_07766942.1| preprotein translocase, SecG subunit [Enterococcus faecalis DAPTO
          512]
 gi|312953649|ref|ZP_07772486.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0102]
 gi|312978513|ref|ZP_07790251.1| preprotein translocase, SecG subunit [Enterococcus faecalis DAPTO
          516]
 gi|29344571|gb|AAO82329.1| preprotein translocase, SecG subunit [Enterococcus faecalis V583]
 gi|227072783|gb|EEI10746.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0104]
 gi|227176741|gb|EEI57713.1| preprotein translocase, SecG subunit [Enterococcus faecalis HH22]
 gi|229305493|gb|EEN71489.1| preprotein translocase, SecG subunit [Enterococcus faecalis ATCC
          29200]
 gi|229309904|gb|EEN75891.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX1322]
 gi|255962988|gb|EET95464.1| preprotein translocase SecG subunit [Enterococcus faecalis T1]
 gi|255967899|gb|EET98521.1| preprotein translocase SecG subunit [Enterococcus faecalis T2]
 gi|256596395|gb|EEU15571.1| preprotein translocase SecG subunit [Enterococcus faecalis ATCC
          4200]
 gi|256684507|gb|EEU24202.1| preprotein translocase SecG subunit [Enterococcus faecalis T3]
 gi|256710872|gb|EEU25915.1| preprotein translocase [Enterococcus faecalis T8]
 gi|256948353|gb|EEU64985.1| preprotein translocase SecG subunit [Enterococcus faecalis DS5]
 gi|256951640|gb|EEU68272.1| preprotein translocase SecG subunit [Enterococcus faecalis
          Merz96]
 gi|256954233|gb|EEU70865.1| preprotein translocase SecG subunit [Enterococcus faecalis
          HIP11704]
 gi|256987825|gb|EEU75127.1| preprotein translocase SecG subunit [Enterococcus faecalis JH1]
 gi|256989889|gb|EEU77191.1| preprotein translocase SecG subunit [Enterococcus faecalis E1Sol]
 gi|256992431|gb|EEU79733.1| preprotein translocase SecG subunit [Enterococcus faecalis Fly1]
 gi|256995630|gb|EEU82932.1| preprotein translocase SecG subunit [Enterococcus faecalis D6]
 gi|256999571|gb|EEU86091.1| preprotein translocase secG [Enterococcus faecalis CH188]
 gi|257158635|gb|EEU88595.1| preprotein translocase SecG subunit [Enterococcus faecalis
          ARO1/DG]
 gi|257161851|gb|EEU91811.1| preprotein translocase subunit secG [Enterococcus faecalis T11]
 gi|257163622|gb|EEU93582.1| preprotein translocase subunit secG [Enterococcus faecalis X98]
 gi|291078570|gb|EFE15934.1| preprotein translocase, SecG subunit [Enterococcus faecalis R712]
 gi|291083575|gb|EFE20538.1| preprotein translocase, SecG subunit [Enterococcus faecalis S613]
 gi|294451509|gb|EFG19969.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          PC1.1]
 gi|295113595|emb|CBL32232.1| protein translocase, SecG subunit [Enterococcus sp. 7L76]
 gi|300849716|gb|EFK77466.1| preprotein translocase, SecG subunit [Enterococcus faecalis TUSoD
          Ef11]
 gi|306498561|gb|EFM68063.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0411]
 gi|306501295|gb|EFM70598.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0109]
 gi|306506503|gb|EFM75662.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX2134]
 gi|306511562|gb|EFM80561.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0855]
 gi|306512976|gb|EFM81617.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX4248]
 gi|310626050|gb|EFQ09333.1| preprotein translocase, SecG subunit [Enterococcus faecalis DAPTO
          512]
 gi|310628487|gb|EFQ11770.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0102]
 gi|310634059|gb|EFQ17342.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0635]
 gi|311288662|gb|EFQ67218.1| preprotein translocase, SecG subunit [Enterococcus faecalis DAPTO
          516]
 gi|311292988|gb|EFQ71544.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0470]
 gi|315025242|gb|EFT37174.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX2137]
 gi|315030325|gb|EFT42257.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX4000]
 gi|315032751|gb|EFT44683.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0017]
 gi|315035791|gb|EFT47723.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0027]
 gi|315143750|gb|EFT87766.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX2141]
 gi|315148593|gb|EFT92609.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX4244]
 gi|315149998|gb|EFT94014.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0012]
 gi|315151916|gb|EFT95932.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0031]
 gi|315155500|gb|EFT99516.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0043]
 gi|315159203|gb|EFU03220.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0312]
 gi|315162858|gb|EFU06875.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0645]
 gi|315164954|gb|EFU08971.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX1302]
 gi|315168609|gb|EFU12626.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX1341]
 gi|315170132|gb|EFU14149.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX1342]
 gi|315173369|gb|EFU17386.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX1346]
 gi|315576222|gb|EFU88413.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0309B]
 gi|315579200|gb|EFU91391.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0630]
 gi|315582938|gb|EFU95129.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0309A]
 gi|323481554|gb|ADX80993.1| preprotein translocase, SecG subunit [Enterococcus faecalis 62]
 gi|327535849|gb|AEA94683.1| preprotein translocase subunit SecG [Enterococcus faecalis OG1RF]
          Length = 78

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 30/78 (38%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M   ++ + +I+ V +V  +++Q S      S+  G +         R     + R TA+
Sbjct: 1  MYNLILTLVIILSVLIVITVMMQPSKQNSAASAFTGGADKLFGKQKARGFEAVMQRSTAV 60

Query: 53 LAFFFFATSIALGMISRY 70
          L   +      L  +S  
Sbjct: 61 LGAIWMILLFVLAFLSSK 78


>gi|237741562|ref|ZP_04572043.1| translocase subunit secG [Fusobacterium sp. 4_1_13]
 gi|256844897|ref|ZP_05550355.1| preprotein translocase, SecG subunit [Fusobacterium sp. 3_1_36A2]
 gi|229429210|gb|EEO39422.1| translocase subunit secG [Fusobacterium sp. 4_1_13]
 gi|256718456|gb|EEU32011.1| preprotein translocase, SecG subunit [Fusobacterium sp. 3_1_36A2]
          Length = 74

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 26/70 (37%), Gaps = 6/70 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF------TSVRSTAHSLGRFTAILA 54
          M   L ++  +    L+ ++LIQ   S    +S           +      L + T ++A
Sbjct: 1  MSTLLNILLFLSAFVLIVLVLIQPDRSHGMTASMGLGASNTIFGINKDGGPLAKATEVVA 60

Query: 55 FFFFATSIAL 64
            F   S+ L
Sbjct: 61 ALFIICSLLL 70


>gi|289450809|ref|YP_003474407.1| preprotein translocase subunit SecG [Clostridiales genomosp.
          BVAB3 str. UPII9-5]
 gi|289185356|gb|ADC91781.1| preprotein translocase, SecG subunit [Clostridiales genomosp.
          BVAB3 str. UPII9-5]
          Length = 80

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 32/74 (43%), Gaps = 7/74 (9%)

Query: 4  FLMVVHLIVVVGLVCVILIQ----SSDSSAFGSSSNFTS---VRSTAHSLGRFTAILAFF 56
           L V+ +I+ + L+ +++ Q        S  G +  F      RS  + L + T  LA  
Sbjct: 7  VLGVIDVIICIALIGLVISQEGNAQGLGSIAGGADTFFGSHKGRSVDNLLKKLTTTLAII 66

Query: 57 FFATSIALGMISRY 70
          F   ++ L +++  
Sbjct: 67 FAVLTVVLFLLTSK 80


>gi|227529574|ref|ZP_03959623.1| Sec family type I general secretory protein SecG [Lactobacillus
          vaginalis ATCC 49540]
 gi|227350533|gb|EEJ40824.1| Sec family type I general secretory protein SecG [Lactobacillus
          vaginalis ATCC 49540]
          Length = 74

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 31/74 (41%), Gaps = 9/74 (12%)

Query: 6  MVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHS---LGRFTAILAFF 56
          M + LI  V L+  +++Q +       S+  G + +  S R        +   T I    
Sbjct: 1  MTLFLIDCVVLIACVMMQPAKNDNDAMSALTGGAGDLFSRRKARGFEAVMQVVTTICGAI 60

Query: 57 FFATSIALGMISRY 70
          FF  ++AL  +S +
Sbjct: 61 FFILALALVFVSSH 74


>gi|325291294|ref|YP_004267475.1| protein translocase subunit secG [Syntrophobotulus glycolicus DSM
          8271]
 gi|324966695|gb|ADY57474.1| protein translocase subunit secG [Syntrophobotulus glycolicus DSM
          8271]
          Length = 76

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 32/73 (43%), Gaps = 7/73 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS-------VRSTAHSLGRFTAIL 53
          M IF++V+ LI  +GL+  +L+QS  S+    S             +     L + +   
Sbjct: 1  MTIFIIVILLISSLGLIATVLLQSGKSAGLSGSITGAGEQFFGKSAKGMEGFLAKLSIAF 60

Query: 54 AFFFFATSIALGM 66
          A  F  +S+ L +
Sbjct: 61 AVLFLVSSLGLTI 73


>gi|322804499|emb|CBZ02049.1| preprotein translocase subunit SecG (TC 3.A.5.1.1) [Clostridium
          botulinum H04402 065]
          Length = 77

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 34/77 (44%), Gaps = 8/77 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD--------SSAFGSSSNFTSVRSTAHSLGRFTAI 52
          M IF +++  IV + L+ V+L+Q S              +  +    R++   L R T +
Sbjct: 1  MHIFSIILLTIVSITLIVVVLMQPSKTNGLSGFMGGGSETFYSKNRTRTSESVLSRITVV 60

Query: 53 LAFFFFATSIALGMISR 69
           +  F    +A  ++S+
Sbjct: 61 CSVLFAIIVLAQNLLSK 77


>gi|189485148|ref|YP_001956089.1| protein translocase subunit SecG [uncultured Termite group 1
          bacterium phylotype Rs-D17]
 gi|170287107|dbj|BAG13628.1| protein translocase subunit SecG [uncultured Termite group 1
          bacterium phylotype Rs-D17]
          Length = 93

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 6/69 (8%)

Query: 7  VVHLIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60
           +H  +  GLV VIL+Q++ S         G S    +  S    + + T ++A  F  T
Sbjct: 16 FIHYTICAGLVLVILLQTAKSGDMAGIFSGGGSDQIFNAPSRMAFIKKVTILMACIFLFT 75

Query: 61 SIALGMISR 69
          S+ L  +S 
Sbjct: 76 SLMLTKLSP 84


>gi|119952857|ref|YP_945066.1| preprotein translocase subunit SecG [Borrelia turicatae 91E135]
 gi|119861628|gb|AAX17396.1| protein translocase subunit SecG [Borrelia turicatae 91E135]
          Length = 120

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 27/76 (35%), Gaps = 4/76 (5%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDS----SAFGSSSNFTSVRSTAHSLGRFTAILAFFFFA 59
           + V  +I    +V ++L Q          FG  S+      +++   R TA     FF 
Sbjct: 7  LIFVFFIITSFMIVLLVLFQDEQGDSIGGVFGGGSSSIFGAKSSNIAIRITAFFITLFFI 66

Query: 60 TSIALGMISRYTSTRY 75
            IAL  I+       
Sbjct: 67 FVIALSFINTRRVDNS 82


>gi|328948487|ref|YP_004365824.1| preprotein translocase, SecG subunit [Treponema succinifaciens
          DSM 2489]
 gi|328448811|gb|AEB14527.1| preprotein translocase, SecG subunit [Treponema succinifaciens
          DSM 2489]
          Length = 113

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 44/96 (45%), Gaps = 4/96 (4%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS----SDSSAFGSSSNFTSVRSTAHSLGRFTAILAFF 56
          ++  L++  +I+ V LV ++L+Q+       SAFG   +      +A  L + T +LA  
Sbjct: 4  LKTILLIAFVIICVLLVLLVLVQNEENNGMGSAFGGGQSTAFGARSASVLTKTTGVLAAL 63

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
          FF T+  + ++++  +     +  + +        +
Sbjct: 64 FFVTAFGISLLNKAPAKEDLSSTVKEIQGEQTSSED 99


>gi|11467705|ref|NP_050757.1| hypothetical chloroplast RF47 [Guillardia theta]
 gi|6136623|sp|O78500|SECG_GUITH RecName: Full=Probable protein-export membrane protein secG
 gi|3603030|gb|AAC35691.1| hypothetical chloroplast RF47 [Guillardia theta]
          Length = 68

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDS-SAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSI 62
           L ++ LI  + L+  I+I +  S      +  F S RS   +L + T  L   FF  ++
Sbjct: 1  MLNIIWLITGILLLFAIMIHNPKSQGFGTQNQIFGSTRSAEQTLNKATWFLILLFFILTV 60

Query: 63 ALGM 66
           L +
Sbjct: 61 VLSI 64


>gi|228472900|ref|ZP_04057657.1| putative membrane protein [Capnocytophaga gingivalis ATCC 33624]
 gi|228275482|gb|EEK14259.1| putative membrane protein [Capnocytophaga gingivalis ATCC 33624]
          Length = 114

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/110 (14%), Positives = 31/110 (28%), Gaps = 6/110 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT-----SVRSTAHSLGRFTAILAFF 56
              ++ + L+V   L+ V+++Q   S    SS          V+ T   L   T  L   
Sbjct: 4   FNIVLGLILLVSFLLILVVMVQQPKSGGLSSSFGGNAQIVGGVKKTGDFLNTSTWTLGVS 63

Query: 57  FFATSIALG-MISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDS 105
               S+    +++     R    +       +  Q               
Sbjct: 64  LIVLSLISNLILTNAHPERGGSVLDGVSTPPVSTQQPVQTPPTQQQSNPQ 113


>gi|307285536|ref|ZP_07565675.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0860]
 gi|306502760|gb|EFM72025.1| preprotein translocase, SecG subunit [Enterococcus faecalis
          TX0860]
          Length = 78

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 30/78 (38%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M   ++ + +I+ V +V  +++Q S      S+  G +         R     + R TA+
Sbjct: 1  MYNLILTLVIILSVLIVITVMMQPSKQNSAASAFTGGADKLFGEQKARGFEAVMQRSTAV 60

Query: 53 LAFFFFATSIALGMISRY 70
          L   +      L  +S  
Sbjct: 61 LGAIWMILLFVLAFLSSK 78


>gi|307694121|ref|ZP_07636358.1| preprotein translocase subunit SecG [Ruminococcaceae bacterium
          D16]
          Length = 77

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/71 (22%), Positives = 30/71 (42%), Gaps = 8/71 (11%)

Query: 5  LMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSVRSTAHS---LGRFTAILAFF 56
          L V+ ++  + L+ V+++QS        +  G    F S          L + T  +A  
Sbjct: 7  LTVIQVLCALVLIAVVMLQSGKSAGLSGAIAGGVDTFLSKNKAKTWDSKLAKMTKWVAIV 66

Query: 57 FFATSIALGMI 67
          F   ++AL +I
Sbjct: 67 FVILTLALSLI 77


>gi|167946329|ref|ZP_02533403.1| hypothetical protein Epers_07182 [Endoriftia persephone
          'Hot96_1+Hot96_2']
          Length = 101

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 29/74 (39%)

Query: 24 SSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSL 83
             +   G+S+     + +A  L R TA+LA  FF TSIAL + +               
Sbjct: 7  RGAAFGSGASATVFGAQGSASFLSRATALLAALFFITSIALAVFASQKREPEGLMDAVGD 66

Query: 84 VDSIKDQGNDNFGD 97
            +   +  ++  D
Sbjct: 67 APAAVIEQQESASD 80


>gi|303235855|ref|ZP_07322458.1| preprotein translocase, SecG subunit [Prevotella disiens
          FB035-09AN]
 gi|302483728|gb|EFL46720.1| preprotein translocase, SecG subunit [Prevotella disiens
          FB035-09AN]
          Length = 110

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 30/83 (36%), Gaps = 4/83 (4%)

Query: 16 LVCVILIQSSDSS----AFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYT 71
          ++ V+LIQ S        F SS+    VR T   + + T   A F    S+    ++   
Sbjct: 1  MIGVVLIQESKGGGLSSNFSSSNAIMGVRKTTDFIEKVTWGCAIFMVVVSVISTRLAPQA 60

Query: 72 STRYKDNMHRSLVDSIKDQGNDN 94
          +T        +   S  +  N  
Sbjct: 61 ATSQSVIEKAATEGSATNPNNLP 83


>gi|167945797|ref|ZP_02532871.1| hypothetical protein Epers_04355 [Endoriftia persephone
          'Hot96_1+Hot96_2']
          Length = 74

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 6/55 (10%)

Query: 10 LIVVVGLVCVILIQSSDSSA------FGSSSNFTSVRSTAHSLGRFTAILAFFFF 58
          + + +GL+ ++L+Q    +        G+S+     + +A  L R TA+LA   F
Sbjct: 1  MFLAIGLIGLVLMQHGKGADAGAAFGSGASATVFGAQGSASFLSRATALLARAVF 55


>gi|290968524|ref|ZP_06560063.1| preprotein translocase, SecG subunit [Megasphaera genomosp.
          type_1 str. 28L]
 gi|290781520|gb|EFD94109.1| preprotein translocase, SecG subunit [Megasphaera genomosp.
          type_1 str. 28L]
          Length = 78

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 30/72 (41%), Gaps = 7/72 (9%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-------FTSVRSTAHSLGRFTAIL 53
          M   L V+  I+ + L+ V++ Q S S   G+           +  R     L + T IL
Sbjct: 1  MITVLEVLVFILALCLIGVVVAQKSKSQGMGAGFGGGAEDLFGSRARGMDALLSKLTIIL 60

Query: 54 AFFFFATSIALG 65
          +  F   ++ LG
Sbjct: 61 SIIFAVLTLVLG 72


>gi|260061720|ref|YP_003194800.1| hypothetical protein RB2501_08965 [Robiginitalea biformata
           HTCC2501]
 gi|88785852|gb|EAR17021.1| hypothetical protein RB2501_08965 [Robiginitalea biformata
           HTCC2501]
          Length = 120

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 15/112 (13%), Positives = 35/112 (31%), Gaps = 6/112 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV------RSTAHSLGRFTAILAF 55
               +V+ +IV + L+ VI++Q+       SS            + T   L + T  LA 
Sbjct: 4   FSIFLVLIIIVCLLLMLVIMVQNPKGGGLSSSFGGGGNQVVGGVKKTGDFLDKSTWTLAT 63

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS 107
                 +   +  +      +  + +        +G+      +     +  
Sbjct: 64  VLIVLILLSNVTLKTNFQEAESRLLQEDGIEAVPEGDLESIPEAPAGEPASP 115


>gi|83596011|gb|ABC25370.1| putative protein-export membrane protein [uncultured marine
           bacterium Ant29B7]
          Length = 114

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 44/108 (40%), Gaps = 9/108 (8%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV-------RSTAHSLGRFTAIL 53
           M    +++  IV + L+ VIL+QS   SA GS+    +        + T+  L + T +L
Sbjct: 1   MSTLFIILITIVSILLILVILVQSPKGSALGSAFGGGAAAGMLGGVKRTSDFLEKATWVL 60

Query: 54  AFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
               F   + + ++        +     SL++   D     F   +SP
Sbjct: 61  VSVLFGLVLLMNVMVG--GGTAQSLDQESLLNQELDNSAPVFQTPASP 106


>gi|69247785|ref|ZP_00604490.1| Preprotein translocase SecG subunit [Enterococcus faecium DO]
 gi|257879704|ref|ZP_05659357.1| preprotein translocase SecG subunit [Enterococcus faecium
          1,230,933]
 gi|257884011|ref|ZP_05663664.1| preprotein translocase SecG subunit [Enterococcus faecium
          1,231,501]
 gi|257890368|ref|ZP_05670021.1| preprotein translocase SecG subunit [Enterococcus faecium
          1,231,410]
 gi|257892976|ref|ZP_05672629.1| preprotein translocase SecG subunit [Enterococcus faecium
          1,231,408]
 gi|258616686|ref|ZP_05714456.1| preprotein translocase, SecG subunit [Enterococcus faecium DO]
 gi|260559637|ref|ZP_05831817.1| preprotein translocase SecG subunit [Enterococcus faecium C68]
 gi|261208702|ref|ZP_05923139.1| preprotein translocase SecG subunit [Enterococcus faecium TC 6]
 gi|289566041|ref|ZP_06446478.1| preprotein translocase, SecG subunit [Enterococcus faecium
          D344SRF]
 gi|293556426|ref|ZP_06675007.1| preprotein translocase, SecG subunit [Enterococcus faecium E1039]
 gi|293560038|ref|ZP_06676542.1| preprotein translocase, SecG subunit [Enterococcus faecium E1162]
 gi|293568735|ref|ZP_06680050.1| preprotein translocase, SecG subunit [Enterococcus faecium E1071]
 gi|294616239|ref|ZP_06696032.1| preprotein translocase, SecG subunit [Enterococcus faecium E1636]
 gi|314939622|ref|ZP_07846849.1| preprotein translocase, SecG subunit [Enterococcus faecium
          TX0133a04]
 gi|314941248|ref|ZP_07848144.1| preprotein translocase, SecG subunit [Enterococcus faecium
          TX0133C]
 gi|314949819|ref|ZP_07853129.1| preprotein translocase, SecG subunit [Enterococcus faecium
          TX0082]
 gi|314953389|ref|ZP_07856314.1| preprotein translocase, SecG subunit [Enterococcus faecium
          TX0133A]
 gi|314993466|ref|ZP_07858831.1| preprotein translocase, SecG subunit [Enterococcus faecium
          TX0133B]
 gi|314997311|ref|ZP_07862276.1| preprotein translocase, SecG subunit [Enterococcus faecium
          TX0133a01]
 gi|68194714|gb|EAN09196.1| Preprotein translocase SecG subunit [Enterococcus faecium DO]
 gi|257813932|gb|EEV42690.1| preprotein translocase SecG subunit [Enterococcus faecium
          1,230,933]
 gi|257819849|gb|EEV46997.1| preprotein translocase SecG subunit [Enterococcus faecium
          1,231,501]
 gi|257826728|gb|EEV53354.1| preprotein translocase SecG subunit [Enterococcus faecium
          1,231,410]
 gi|257829355|gb|EEV55962.1| preprotein translocase SecG subunit [Enterococcus faecium
          1,231,408]
 gi|260074305|gb|EEW62627.1| preprotein translocase SecG subunit [Enterococcus faecium C68]
 gi|260077204|gb|EEW64924.1| preprotein translocase SecG subunit [Enterococcus faecium TC 6]
 gi|289162148|gb|EFD10011.1| preprotein translocase, SecG subunit [Enterococcus faecium
          D344SRF]
 gi|291588695|gb|EFF20528.1| preprotein translocase, SecG subunit [Enterococcus faecium E1071]
 gi|291590753|gb|EFF22469.1| preprotein translocase, SecG subunit [Enterococcus faecium E1636]
 gi|291601493|gb|EFF31764.1| preprotein translocase, SecG subunit [Enterococcus faecium E1039]
 gi|291605905|gb|EFF35335.1| preprotein translocase, SecG subunit [Enterococcus faecium E1162]
 gi|313588602|gb|EFR67447.1| preprotein translocase, SecG subunit [Enterococcus faecium
          TX0133a01]
 gi|313592131|gb|EFR70976.1| preprotein translocase, SecG subunit [Enterococcus faecium
          TX0133B]
 gi|313594582|gb|EFR73427.1| preprotein translocase, SecG subunit [Enterococcus faecium
          TX0133A]
 gi|313599972|gb|EFR78815.1| preprotein translocase, SecG subunit [Enterococcus faecium
          TX0133C]
 gi|313641162|gb|EFS05742.1| preprotein translocase, SecG subunit [Enterococcus faecium
          TX0133a04]
 gi|313643892|gb|EFS08472.1| preprotein translocase, SecG subunit [Enterococcus faecium
          TX0082]
          Length = 78

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 13/78 (16%), Positives = 30/78 (38%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M   ++ + +++ + +V  I++Q S      S+  G +         R     + R TA+
Sbjct: 1  MYNLILGIVIVLSIVMVIAIMMQPSKQNSAASAFTGGADQLFGKQKARGFEAVMQRSTAV 60

Query: 53 LAFFFFATSIALGMISRY 70
          +   +      L  +S  
Sbjct: 61 MGAIWMILLFVLAYLSSK 78


>gi|257469471|ref|ZP_05633563.1| protein translocase subunit secG [Fusobacterium ulcerans ATCC
          49185]
 gi|317063715|ref|ZP_07928200.1| protein translocase subunit secg [Fusobacterium ulcerans ATCC
          49185]
 gi|313689391|gb|EFS26226.1| protein translocase subunit secg [Fusobacterium ulcerans ATCC
          49185]
          Length = 74

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 31/70 (44%), Gaps = 6/70 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS------SDSSAFGSSSNFTSVRSTAHSLGRFTAILA 54
          M+    ++  I  + L+ ++LIQ       S S   G+S+    +      L + T ++A
Sbjct: 1  METLFTIMLFIFAIALIILVLIQPDRSHGMSASMGMGASNTVFGISKDGGPLAKATQVVA 60

Query: 55 FFFFATSIAL 64
            F  +++ L
Sbjct: 61 VLFIVSALLL 70


>gi|144898642|emb|CAM75506.1| Preprotein translocase SecG subunit [Magnetospirillum
          gryphiswaldense MSR-1]
          Length = 66

 Score = 45.0 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 21/40 (52%)

Query: 37 TSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYK 76
           S R+  + L + T ILA  FF TS+AL +I+   +    
Sbjct: 1  MSGRAAGNLLTKTTGILAAAFFVTSLALAIIANNRTGGGS 40


>gi|297621380|ref|YP_003709517.1| putative protein-export membrane protein SecG [Waddlia
          chondrophila WSU 86-1044]
 gi|297376681|gb|ADI38511.1| putative protein-export membrane protein SecG [Waddlia
          chondrophila WSU 86-1044]
          Length = 96

 Score = 45.0 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 39/92 (42%), Gaps = 5/92 (5%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF-----TSVRSTAHSLGRFTAILAFF 56
           IF ++  +I+   L  VILIQ S SS  G+S            STA  L RFT  L+  
Sbjct: 5  YIFSLIFFMILSAVLCFVILIQESKSSGLGASFGGDTGDSLFGTSTADVLKRFTGWLSVI 64

Query: 57 FFATSIALGMISRYTSTRYKDNMHRSLVDSIK 88
          F A+ + L + +          +  S ++   
Sbjct: 65 FLASCVLLSLWTSAMGRTPVQEVEPSTIEETV 96


>gi|300173700|ref|YP_003772866.1| preprotein translocase subunit SecG [Leuconostoc gasicomitatum
          LMG 18811]
 gi|299888079|emb|CBL92047.1| Preprotein translocase, SecG subunit [Leuconostoc gasicomitatum
          LMG 18811]
          Length = 78

 Score = 45.0 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 32/78 (41%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV--------RSTAHSLGRFTAI 52
          M+  L V  ++V   L+  +++Q S      S+ +  +         R     + R TAI
Sbjct: 1  MEQTLTVALIVVGFLLIVTVMMQPSKQQDALSALSGGAGDLFAERKSRGFEAVMRRSTAI 60

Query: 53 LAFFFFATSIALGMISRY 70
          L   +F    AL  +S +
Sbjct: 61 LGGLWFIIGFALMYLSAH 78


>gi|227514412|ref|ZP_03944461.1| Sec family type I general secretory protein SecG [Lactobacillus
          fermentum ATCC 14931]
 gi|227087278|gb|EEI22590.1| Sec family type I general secretory protein SecG [Lactobacillus
          fermentum ATCC 14931]
          Length = 74

 Score = 45.0 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 32/74 (43%), Gaps = 9/74 (12%)

Query: 6  MVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHS---LGRFTAILAFF 56
          M + LI  V ++  +++Q +       S+  G S +  S R        +   T I+   
Sbjct: 1  MTLFLIDCVVMIACVMMQPAKNDNDSMSALTGGSGDLFSRRKARGFEAVMQIVTVIVGII 60

Query: 57 FFATSIALGMISRY 70
          FF  ++AL  +S +
Sbjct: 61 FFVLALALVYVSSH 74


>gi|331007338|ref|ZP_08330534.1| Preprotein translocase subunit SecG [gamma proteobacterium
           IMCC1989]
 gi|330418854|gb|EGG93324.1| Preprotein translocase subunit SecG [gamma proteobacterium
           IMCC1989]
          Length = 115

 Score = 45.0 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 42/102 (41%)

Query: 23  QSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRS 82
           ++  S   G+S      +  ++   + TA+ AF FFATS  L +I++  ++    +   +
Sbjct: 8   EAGASFGGGASQTVFGSQGGSNFFAKATAVCAFVFFATSFGLAVIAKENTSINVVDGIPA 67

Query: 83  LVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRSSSRT 124
           ++    ++        S+   D  S +    + +    ++  
Sbjct: 68  IIQPAVEESEIPSAAASTSTADDSSLEVPVVIESAIEDAASE 109


>gi|225390491|ref|ZP_03760215.1| hypothetical protein CLOSTASPAR_04246 [Clostridium asparagiforme
          DSM 15981]
 gi|225043455|gb|EEG53701.1| hypothetical protein CLOSTASPAR_04246 [Clostridium asparagiforme
          DSM 15981]
          Length = 83

 Score = 45.0 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 7/79 (8%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNF-------TSVRSTAHSLGRFTAILA 54
          +I L V+++I+ V +  VIL+Q   S   G+              RS   +L +FT   A
Sbjct: 5  EIILSVIYVILGVAISAVILMQEGKSQGLGALGGIADSYWGKNKGRSMEGALEKFTKYGA 64

Query: 55 FFFFATSIALGMISRYTST 73
            F   +IA+ +I +    
Sbjct: 65 IAFMLITIAMNVILKSQGA 83


>gi|15603957|ref|NP_220472.1| preprotein translocase subunit SecG [Rickettsia prowazekii str.
          Madrid E]
 gi|6226130|sp|Q9ZE68|SECG_RICPR RecName: Full=Protein-export membrane protein secG
 gi|3860648|emb|CAA14549.1| PROTEIN-EXPORT MEMBRANE PROTEIN SECG (secG) [Rickettsia
          prowazekii]
 gi|292571675|gb|ADE29590.1| Protein-export membrane protein secG [Rickettsia prowazekii Rp22]
          Length = 100

 Score = 45.0 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 38/97 (39%), Gaps = 5/97 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFG-----SSSNFTSVRSTAHSLGRFTAILAF 55
          M    + VH+ + + L+ VIL+Q S S         ++    S ++  + L + T IL  
Sbjct: 1  MIDIFLFVHITISILLIIVILMQRSGSGGISGISGDNNMGVVSAKTVGNFLSKSTIILTT 60

Query: 56 FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGN 92
           F   +I L  +S    +     ++    +   +   
Sbjct: 61 LFLINAIVLANLSAKKQSDLVSKINEIEENQADNSLP 97


>gi|291534151|emb|CBL07264.1| protein translocase, SecG subunit [Megamonas hypermegale ART12/1]
          Length = 76

 Score = 45.0 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 31/71 (43%), Gaps = 6/71 (8%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFT------SVRSTAHSLGRFTAILAFF 56
            LM++  +V +GL+  +L+Q   ++  GS S         S R     + RFT   A  
Sbjct: 4  TILMIIDALVAIGLIASVLMQEGKTAGMGSLSGQNETAFSSSARGMDALMARFTVFFAVL 63

Query: 57 FFATSIALGMI 67
          F   ++ +  +
Sbjct: 64 FMIITLIIAKM 74


>gi|268317480|ref|YP_003291199.1| preprotein translocase, SecG subunit [Rhodothermus marinus DSM
           4252]
 gi|262335014|gb|ACY48811.1| preprotein translocase, SecG subunit [Rhodothermus marinus DSM
           4252]
          Length = 117

 Score = 45.0 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 12/79 (15%), Positives = 23/79 (29%), Gaps = 1/79 (1%)

Query: 34  SNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGND 93
                 R     L + T  LA  F    I L   +  T+ R +  + +            
Sbjct: 39  QQVLGARQAPDILEKTTWTLAVIFIVLCI-LTNFTIDTTERRESIIQQRAQQEEVQPTVP 97

Query: 94  NFGDGSSPKLDSVSAKSSS 112
                ++P   S + ++  
Sbjct: 98  PAEQQATPPAPSGNQQNEQ 116


>gi|168182159|ref|ZP_02616823.1| preprotein translocase, SecG subunit [Clostridium botulinum Bf]
 gi|237793550|ref|YP_002861102.1| preprotein translocase subunit SecG [Clostridium botulinum Ba4
          str. 657]
 gi|182674558|gb|EDT86519.1| preprotein translocase, SecG subunit [Clostridium botulinum Bf]
 gi|229260651|gb|ACQ51684.1| preprotein translocase, SecG subunit [Clostridium botulinum Ba4
          str. 657]
          Length = 77

 Score = 45.0 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 15/77 (19%), Positives = 33/77 (42%), Gaps = 8/77 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD--------SSAFGSSSNFTSVRSTAHSLGRFTAI 52
          M I  +++  IV + L+ V+L+Q S              +  +    R++   L R T +
Sbjct: 1  MHILSIILLTIVSITLIVVVLMQPSKTNGLSGFMGGGSETFYSKNRTRTSESVLSRITVV 60

Query: 53 LAFFFFATSIALGMISR 69
           +  F    +A  ++++
Sbjct: 61 CSILFAIIVLAQNLLAK 77


>gi|296111278|ref|YP_003621660.1| SecG [Leuconostoc kimchii IMSNU 11154]
 gi|295832810|gb|ADG40691.1| SecG [Leuconostoc kimchii IMSNU 11154]
          Length = 80

 Score = 45.0 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 33/77 (42%), Gaps = 8/77 (10%)

Query: 2  QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV--------RSTAHSLGRFTAIL 53
          +  L+V  ++V + L+  +++Q S      S+ +  +         R     + R TAIL
Sbjct: 4  EQILIVALIVVGILLIVTVMMQPSKQQDALSALSGGAGDLFAERKSRGFEAVMRRATAIL 63

Query: 54 AFFFFATSIALGMISRY 70
             +F    AL  +S +
Sbjct: 64 GGLWFIIGFALMYLSAH 80


>gi|149184599|ref|ZP_01862917.1| hypothetical protein ED21_27813 [Erythrobacter sp. SD-21]
 gi|148831919|gb|EDL50352.1| hypothetical protein ED21_27813 [Erythrobacter sp. SD-21]
          Length = 120

 Score = 45.0 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN---FTSVRSTAHSLGRFTAILAFFF 57
          M +FL VV  I+   L+ VIL+Q S+    G   +     S R  A  L R T  LA  F
Sbjct: 1  MFLFLTVVQAIIAAALIAVILMQRSEGGGLGIGGSPGGMLSARGAADFLTRSTKWLAVTF 60

Query: 58 FATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFG 96
           A SIAL  ++       +  +  +L  ++    ND  G
Sbjct: 61 VALSIALAAMAVEGVGTGE--IESTLDRTVTPVDNDPLG 97


>gi|170754565|ref|YP_001779862.1| preprotein translocase, SecG subunit [Clostridium botulinum B1
          str. Okra]
 gi|169119777|gb|ACA43613.1| preprotein translocase, SecG subunit [Clostridium botulinum B1
          str. Okra]
          Length = 77

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 16/77 (20%), Positives = 34/77 (44%), Gaps = 8/77 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD--------SSAFGSSSNFTSVRSTAHSLGRFTAI 52
          M IF +++  IV + L+ V+L+Q S              +  +    R++   L R T +
Sbjct: 1  MHIFSIILLTIVSITLIVVVLMQPSKTNGLSGFMGGGSETFYSKNRTRTSESVLSRITIV 60

Query: 53 LAFFFFATSIALGMISR 69
           +  F    +A  ++++
Sbjct: 61 CSILFAIIVLAQNLLAK 77


>gi|228473638|ref|ZP_04058390.1| extracellular ribonuclease [Capnocytophaga gingivalis ATCC 33624]
 gi|228275010|gb|EEK13820.1| extracellular ribonuclease [Capnocytophaga gingivalis ATCC 33624]
          Length = 300

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 6/69 (8%), Positives = 19/69 (27%), Gaps = 1/69 (1%)

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVS-AKSSSSV 114
            F   S+AL +I+    +     + +        +  +      +P+         +   
Sbjct: 4   VFIQLSLALALIACSGESIEDRLIEKPQTPQETPKTPETPKKPETPETPKQPETPETPKQ 63

Query: 115 VAGKRSSSR 123
                +  +
Sbjct: 64  PETPETPKQ 72


>gi|294101307|ref|YP_003553165.1| preprotein translocase, SecG subunit [Aminobacterium colombiense
          DSM 12261]
 gi|293616287|gb|ADE56441.1| preprotein translocase, SecG subunit [Aminobacterium colombiense
          DSM 12261]
          Length = 74

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 32/73 (43%), Gaps = 7/73 (9%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTA-------HSLGRFTAILAFF 56
          F+ VVH+++ + L+ ++L+Q      F       +              L + T +L   
Sbjct: 2  FIGVVHMVLSIALIGIVLLQQRKEGGFSGIFGGGTQADMGGSQWQRLSGLTKITVVLTSL 61

Query: 57 FFATSIALGMISR 69
          F  TS+ L M+S+
Sbjct: 62 FMLTSLVLVMMSK 74


>gi|257867445|ref|ZP_05647098.1| preprotein translocase SecG subunit [Enterococcus casseliflavus
          EC30]
 gi|257873775|ref|ZP_05653428.1| preprotein translocase SecG subunit [Enterococcus casseliflavus
          EC10]
 gi|257877525|ref|ZP_05657178.1| preprotein translocase SecG subunit [Enterococcus casseliflavus
          EC20]
 gi|325568942|ref|ZP_08145235.1| preprotein translocase subunit SecG [Enterococcus casseliflavus
          ATCC 12755]
 gi|257801501|gb|EEV30431.1| preprotein translocase SecG subunit [Enterococcus casseliflavus
          EC30]
 gi|257807939|gb|EEV36761.1| preprotein translocase SecG subunit [Enterococcus casseliflavus
          EC10]
 gi|257811691|gb|EEV40511.1| preprotein translocase SecG subunit [Enterococcus casseliflavus
          EC20]
 gi|325157980|gb|EGC70136.1| preprotein translocase subunit SecG [Enterococcus casseliflavus
          ATCC 12755]
          Length = 78

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 30/78 (38%), Gaps = 8/78 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTS---VRSTAHSLGRFTAI 52
          M   L+   +++ + +V  I++Q S      S+  G +         R     + R TAI
Sbjct: 1  MYNILLTAVIVISILMVITIMMQPSKQNSAASAFTGGADQLFGKQKARGFEAVMQRSTAI 60

Query: 53 LAFFFFATSIALGMISRY 70
          L F +      L  +S  
Sbjct: 61 LGFVWMVLLFILAFLSSN 78


>gi|225850597|ref|YP_002730831.1| preprotein translocase SecG subunit [Persephonella marina EX-H1]
 gi|225645103|gb|ACO03289.1| preprotein translocase SecG subunit [Persephonella marina EX-H1]
          Length = 103

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 18/99 (18%), Positives = 33/99 (33%), Gaps = 5/99 (5%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGS-----SSNFTSVRSTAHSLGRFTAILAF 55
           +   L ++  IV V L+ +IL+Q +  +  G+     ++        ++ L + T  L  
Sbjct: 4   LYTVLSILLFIVAVLLIIIILMQKTKGAEIGAIFGSGAAAAVLGAGASNILTKITYWLGG 63

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDN 94
            F     AL  I   T                     +N
Sbjct: 64  IFLFIVFALSFIHHKTLKAPTVIQDIPAQTEKAPAEQNN 102


>gi|149918258|ref|ZP_01906750.1| hypothetical protein PPSIR1_11635 [Plesiocystis pacifica SIR-1]
 gi|149821018|gb|EDM80425.1| hypothetical protein PPSIR1_11635 [Plesiocystis pacifica SIR-1]
          Length = 226

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 35/80 (43%), Gaps = 6/80 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSS------SNFTSVRSTAHSLGRFTAILA 54
          M  F+ ++++IV + +V  IL+QS      GS+       +       A  +G+ T   A
Sbjct: 1  MTTFVTIIYVIVALVMVLSILLQSGKGGGLGSALGGGASQSVFGGGGGADFMGKLTQGFA 60

Query: 55 FFFFATSIALGMISRYTSTR 74
            F  +++ L   S +  + 
Sbjct: 61 ATFMISAMYLAYASAHAGSS 80


>gi|291166600|gb|EFE28646.1| preprotein translocase, SecG subunit [Filifactor alocis ATCC
          35896]
          Length = 75

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 6/70 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN------FTSVRSTAHSLGRFTAILA 54
          M+  LM++ ++V + L+  +L+QSS+++  G  S          VR     L + T  LA
Sbjct: 1  MKNSLMLLEIVVSITLIVTVLLQSSNNTGLGFMSGATEQLSGNKVRGKETVLRKITVALA 60

Query: 55 FFFFATSIAL 64
            F   +I L
Sbjct: 61 VVFIILAIVL 70


>gi|218261335|ref|ZP_03476197.1| hypothetical protein PRABACTJOHN_01863 [Parabacteroides johnsonii
           DSM 18315]
 gi|218224082|gb|EEC96732.1| hypothetical protein PRABACTJOHN_01863 [Parabacteroides johnsonii
           DSM 18315]
          Length = 122

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 33/101 (32%), Gaps = 5/101 (4%)

Query: 23  QSSDSSA----FGSSSNFTSVRSTAHSLGRFTAILAFFFFATSIALGMISRYTSTRYKDN 78
           Q+S        F SS+    VR T   L + T  LA      SI +           +  
Sbjct: 23  QNSKGGGLASGFSSSNQIMGVRKTTDFLEKATWTLAGTVVVLSIVITAFIPRAQHTNQSE 82

Query: 79  MHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119
           +   + +++    N    D  + +  +  A  SS   A   
Sbjct: 83  IKEQINNAVTIDPNTVAPDFGTAQQPAT-APVSSEEEAPAN 122


>gi|169334475|ref|ZP_02861668.1| hypothetical protein ANASTE_00878 [Anaerofustis stercorihominis
          DSM 17244]
 gi|169259192|gb|EDS73158.1| hypothetical protein ANASTE_00878 [Anaerofustis stercorihominis
          DSM 17244]
          Length = 77

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 15/77 (19%), Positives = 32/77 (41%), Gaps = 8/77 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVR--------STAHSLGRFTAI 52
          M   L+V  +I  + L+  +L+Q   S+  GS+ +  +               L + T +
Sbjct: 1  MTTVLLVFMVISSITLIGSVLLQEGSSAGMGSAISGGAEGLFGKKKAHGMQGLLNKITLV 60

Query: 53 LAFFFFATSIALGMISR 69
           A  FF +     ++++
Sbjct: 61 SAVVFFISIFVFNLLAK 77


>gi|253582255|ref|ZP_04859478.1| translocase subunit secG [Fusobacterium varium ATCC 27725]
 gi|251835794|gb|EES64332.1| translocase subunit secG [Fusobacterium varium ATCC 27725]
          Length = 74

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 31/70 (44%), Gaps = 6/70 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS------SDSSAFGSSSNFTSVRSTAHSLGRFTAILA 54
          M+    ++  I  + L+ ++LIQ       S S   G+S+    +      L + T ++A
Sbjct: 1  METLFTIMLFIFAITLIILVLIQPDRSHGMSASMGMGASNTVFGISKDGGPLAKATQVVA 60

Query: 55 FFFFATSIAL 64
            F  +++ L
Sbjct: 61 VLFIVSALLL 70


>gi|23099885|ref|NP_693351.1| preprotein translocase subunit SecG [Oceanobacillus iheyensis
          HTE831]
 gi|22778116|dbj|BAC14386.1| preprotein translocase subunit [Oceanobacillus iheyensis HTE831]
          Length = 77

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 13/75 (17%), Positives = 30/75 (40%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAI 52
          M   + ++ +I V+ ++ ++L+QS  S+    + +  +         R     L R T +
Sbjct: 1  MITVINILLVIDVIVMITLVLLQSGKSAGLSGAVSGGAEQLFGKQKARGIDLVLHRSTIV 60

Query: 53 LAFFFFATSIALGMI 67
              FF  +     +
Sbjct: 61 TGVLFFVLAFLAAYV 75


>gi|300022973|ref|YP_003755584.1| preprotein translocase subunit SecG [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299524794|gb|ADJ23263.1| preprotein translocase, SecG subunit [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 125

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 7/107 (6%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS------TAHSLGRFTAILA 54
           M   L+V+HL++   LV V+L+Q S+  A G   +            TA+ L R TA LA
Sbjct: 1   MATVLLVIHLMISTALVGVVLLQKSEGGALGIGGSAGGGGGFLTGRGTANLLTRTTAALA 60

Query: 55  FFFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSP 101
             FF TSI+L +++R+ S         +        G    G+ +  
Sbjct: 61  AAFFVTSISLTLLARH-SVNAGSVFDSTHPAGAPVTGPATPGESAPG 106


>gi|323484421|ref|ZP_08089787.1| hypothetical protein HMPREF9474_01538 [Clostridium symbiosum
          WAL-14163]
 gi|323692435|ref|ZP_08106670.1| preprotein translocase [Clostridium symbiosum WAL-14673]
 gi|323402199|gb|EGA94531.1| hypothetical protein HMPREF9474_01538 [Clostridium symbiosum
          WAL-14163]
 gi|323503487|gb|EGB19314.1| preprotein translocase [Clostridium symbiosum WAL-14673]
          Length = 78

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 15/69 (21%), Positives = 26/69 (37%), Gaps = 8/69 (11%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTS--------VRSTAHSLGRFTAILAF 55
           L  + + + + L  VIL+Q   S+    S +  +         RS    L + T   AF
Sbjct: 5  ILTFLFVAICLFLSVVILLQEGKSAGLSGSISGMADSYWGKNKSRSMEGKLEKMTKYGAF 64

Query: 56 FFFATSIAL 64
           +   +  L
Sbjct: 65 LWLVLAFIL 73


>gi|167755319|ref|ZP_02427446.1| hypothetical protein CLORAM_00832 [Clostridium ramosum DSM 1402]
 gi|237734209|ref|ZP_04564690.1| predicted protein [Mollicutes bacterium D7]
 gi|167704258|gb|EDS18837.1| hypothetical protein CLORAM_00832 [Clostridium ramosum DSM 1402]
 gi|229382769|gb|EEO32860.1| predicted protein [Coprobacillus sp. D7]
          Length = 76

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/70 (22%), Positives = 27/70 (38%), Gaps = 8/70 (11%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDS--------SAFGSSSNFTSVRSTAHSLGRFTAILA 54
            L V+ +++ + L+ + L+QS  S            +       R     + R T  LA
Sbjct: 4  TILNVLLVVISIALIILCLLQSGKSDGIVNALTGQSSNLFAQQKERGADLVMTRVTTGLA 63

Query: 55 FFFFATSIAL 64
            FF  +I L
Sbjct: 64 IAFFVIAIIL 73


>gi|299821973|ref|ZP_07053861.1| preprotein translocase subunit SecG [Listeria grayi DSM 20601]
 gi|299817638|gb|EFI84874.1| preprotein translocase subunit SecG [Listeria grayi DSM 20601]
          Length = 76

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 29/75 (38%), Gaps = 8/75 (10%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD-----SSAFGSSSNFTSV---RSTAHSLGRFTAI 52
          M   L V+ +I  V L+ VI++Q         +  G +         R     L R T +
Sbjct: 1  MSTVLTVLLIISAVLLITVIILQPGKSNGLSGAISGGAEQLFGKQKVRGLELILHRTTIV 60

Query: 53 LAFFFFATSIALGMI 67
          L+  FF   IAL   
Sbjct: 61 LSIIFFGLLIALAFF 75


>gi|254495101|ref|ZP_05108025.1| preprotein translocase SecG subunit [Polaribacter sp. MED152]
 gi|85819451|gb|EAQ40608.1| preprotein translocase SecG subunit [Polaribacter sp. MED152]
          Length = 110

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 23/108 (21%), Positives = 42/108 (38%), Gaps = 7/108 (6%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV------RSTAHSLGRFTAILAF 55
               +++ LIV V LV ++++Q+       SS            ++T + L R T  LA 
Sbjct: 3   YTAFIILILIVAVALVLIVMVQNPKGGGLSSSFGGGGAQSLGGVQNTNNFLDRTTWTLAI 62

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKL 103
             FA  I L  ++         N++ +L         +N    S+  +
Sbjct: 63  AMFAL-ILLSNVAIPRGGENDVNLNNTLDGVETTAPVENTLPSSNDSI 109


>gi|328543805|ref|YP_004303914.1| hypothetical protein SL003B_2187 [Polymorphum gilvum SL003B-26A1]
 gi|326413549|gb|ADZ70612.1| hypothetical protein SL003B_2187 [Polymorphum gilvum SL003B-26A1]
          Length = 128

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 53/128 (41%), Gaps = 4/128 (3%)

Query: 1   MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRS----TAHSLGRFTAILAFF 56
           M+  ++V+HL+VV+ LV V+L+Q S+  A G              TA+ L R TA+LA  
Sbjct: 1   METVVIVIHLMVVLALVLVVLLQRSEGGALGMGGGSGGGFMSSRGTANVLTRATAVLAVV 60

Query: 57  FFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVA 116
           FFATSIAL +I++                          G  +      + A    S   
Sbjct: 61  FFATSIALSLIAKTGDRPSSILDAVPTAGESAPAVPAAPGGEAPAGGGILDALRQQSQPT 120

Query: 117 GKRSSSRT 124
           G +  +  
Sbjct: 121 GPQVPAAQ 128


>gi|206901208|ref|YP_002250856.1| preprotein translocase, SecG subunit [Dictyoglomus thermophilum
          H-6-12]
 gi|217967521|ref|YP_002353027.1| preprotein translocase, SecG subunit [Dictyoglomus turgidum DSM
          6724]
 gi|206740311|gb|ACI19369.1| preprotein translocase, SecG subunit [Dictyoglomus thermophilum
          H-6-12]
 gi|217336620|gb|ACK42413.1| preprotein translocase, SecG subunit [Dictyoglomus turgidum DSM
          6724]
          Length = 73

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAF 55
          M I L ++H +V +G++ VIL QS      G         + + R     L + T +LA 
Sbjct: 1  MTIVLYILHFLVSIGMIAVILFQSEVGEGLGFIGGGETTFYKAKRQMEKGLKQATVVLAV 60

Query: 56 FFFATSIALGMI 67
           F  TS+ + +I
Sbjct: 61 LFMITSVLIFVI 72


>gi|254424522|ref|ZP_05038240.1| preprotein translocase, SecG subunit [Synechococcus sp. PCC 7335]
 gi|196192011|gb|EDX86975.1| preprotein translocase, SecG subunit [Synechococcus sp. PCC 7335]
          Length = 79

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 4/67 (5%)

Query: 3  IFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN----FTSVRSTAHSLGRFTAILAFFFF 58
            + V+  I  VG+  ++L+ S      G+       FTS +S   +L R T +L   F 
Sbjct: 4  TVIRVIWAIAAVGVCVLVLLHSPKGDGLGALGGQAQLFTSTKSAEETLNRATWLLTIVFM 63

Query: 59 ATSIALG 65
          A ++ L 
Sbjct: 64 ALTVVLS 70


>gi|225010054|ref|ZP_03700526.1| preprotein translocase, SecG subunit [Flavobacteria bacterium
           MS024-3C]
 gi|225005533|gb|EEG43483.1| preprotein translocase, SecG subunit [Flavobacteria bacterium
           MS024-3C]
          Length = 123

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 40/119 (33%), Gaps = 6/119 (5%)

Query: 2   QIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSV------RSTAHSLGRFTAILAF 55
               +++ LIV V L+ VI++Q+       SS    S       + T   L + T  LA 
Sbjct: 4   FTIFLILILIVSVLLMLVIMVQNPKGGGLSSSLGGGSSQVVGGVKKTGDFLDKSTWTLAT 63

Query: 56  FFFATSIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSV 114
                 +   +  +         +  + +++   +           +   V AKS  + 
Sbjct: 64  LLIVLILLSNVALKGNYAGADSKLLDTEINTAAPEVLLEEAVEVPVETLEVPAKSEDTQ 122


>gi|153855172|ref|ZP_01996356.1| hypothetical protein DORLON_02369 [Dorea longicatena DSM 13814]
 gi|149752341|gb|EDM62272.1| hypothetical protein DORLON_02369 [Dorea longicatena DSM 13814]
          Length = 72

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 16/66 (24%), Positives = 27/66 (40%), Gaps = 7/66 (10%)

Query: 6  MVVHLIVVVGLVCVILIQSSDSSAFGSSS-------NFTSVRSTAHSLGRFTAILAFFFF 58
          M++  I  + L  ++L+Q   S+  G+ S            RS   +L + T  LA  F 
Sbjct: 1  MIIFAIDCIALTVIVLMQEGKSAGLGAISGIADTYWGQNKGRSMEGALVKSTKFLAILFI 60

Query: 59 ATSIAL 64
            +  L
Sbjct: 61 VLAAVL 66


>gi|223936958|ref|ZP_03628866.1| preprotein translocase, SecG subunit [bacterium Ellin514]
 gi|223894239|gb|EEF60692.1| preprotein translocase, SecG subunit [bacterium Ellin514]
          Length = 141

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 35/82 (42%), Gaps = 6/82 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSSD------SSAFGSSSNFTSVRSTAHSLGRFTAILA 54
          + + L ++ +I  + L+ ++L+Q          +  G +++      +  +L + T   A
Sbjct: 4  LSVILSIILVIDCLFLILLVLVQLPKKEAGAGMAFGGGTADALFGAGSGTALTKLTKYAA 63

Query: 55 FFFFATSIALGMISRYTSTRYK 76
            FF  +  L +++ +   +  
Sbjct: 64 GVFFLGAFFLSIVNSHARKQSD 85


>gi|94676463|ref|YP_589058.1| protein-export membrane protein secG [Baumannia cicadellinicola
          str. Hc (Homalodisca coagulata)]
 gi|94219613|gb|ABF13772.1| Protein-export membrane protein secG [Baumannia cicadellinicola
          str. Hc (Homalodisca coagulata)]
          Length = 92

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 5/60 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQSS-----DSSAFGSSSNFTSVRSTAHSLGRFTAILAF 55
          M   L+VV  +V + LV +I++Q       +S   G+S        +++ + R TA +A 
Sbjct: 1  MYHTLLVVFFLVAISLVALIILQQGPDDIDNSFGLGASKTLFGSSGSSNFITRMTAFMAA 60


>gi|291522312|emb|CBK80605.1| protein translocase, SecG subunit [Coprococcus catus GD/7]
          Length = 83

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 16/71 (22%), Positives = 27/71 (38%), Gaps = 10/71 (14%)

Query: 6  MVVHLIVVVGLVCVILIQSSDSSAFGS------SSNFTSVRST----AHSLGRFTAILAF 55
           VV++IV + LV ++       +          +  + +           L R TAILA 
Sbjct: 9  TVVYIIVCLVLVFLVFKGKGQGADLSGGITGRSNDTYFTTHGKKHTEDALLERSTAILAA 68

Query: 56 FFFATSIALGM 66
           F   S+ + M
Sbjct: 69 IFIVLSLVMNM 79


>gi|203287523|ref|YP_002222538.1| preprotein translocase SecG subunit [Borrelia recurrentis A1]
 gi|201084743|gb|ACH94317.1| preprotein translocase SecG subunit [Borrelia recurrentis A1]
          Length = 120

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 14/76 (18%), Positives = 28/76 (36%), Gaps = 6/76 (7%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSSN-----FTSVRSTAHSLGRFTAILAFFFF 58
           + +  +I+   ++ ++L Q       G             RS++ ++ + TA     FF
Sbjct: 9  LVFIFFVIISFMIILLVLFQDEQGDGIGGVFGGGSSSIFGARSSSVAI-KITAFFITLFF 67

Query: 59 ATSIALGMISRYTSTR 74
             IAL  I+      
Sbjct: 68 VFVIALSFINTKRVDS 83


>gi|237736636|ref|ZP_04567117.1| translocase subunit secG [Fusobacterium mortiferum ATCC 9817]
 gi|229420498|gb|EEO35545.1| translocase subunit secG [Fusobacterium mortiferum ATCC 9817]
          Length = 74

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 31/70 (44%), Gaps = 6/70 (8%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS------SDSSAFGSSSNFTSVRSTAHSLGRFTAILA 54
          M+    V+  I  + L+ ++LIQ       S S   G+S+    +      L R T ++A
Sbjct: 1  METLFTVLLFIFAISLIVLVLIQPDRSHGTSASMGLGASNTVFGISKDGGPLARATEVVA 60

Query: 55 FFFFATSIAL 64
            F  +++ L
Sbjct: 61 TLFIVSALLL 70


>gi|331091707|ref|ZP_08340541.1| preprotein translocase [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330403464|gb|EGG83023.1| preprotein translocase [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 80

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 15/68 (22%), Positives = 27/68 (39%), Gaps = 7/68 (10%)

Query: 4  FLMVVHLIVVVGLVCVILIQSSDSSAFGSSS-------NFTSVRSTAHSLGRFTAILAFF 56
           + ++  I  + L  ++L+Q   S+