RPSBLAST alignment for GI: 254780196 and conserved domain: PRK06870

>gnl|CDD|180737 PRK06870, secG, preprotein translocase subunit SecG; Reviewed. Length = 76
 Score = 56.8 bits (138), Expect = 2e-09
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 6/76 (7%)

Query: 1  MQIFLMVVHLIVVVGLVCVILIQS------SDSSAFGSSSNFTSVRSTAHSLGRFTAILA 54
          M   L+V+ LIV + L+ ++L+QS        S   G+SS     R   + L R TA+LA
Sbjct: 1  MYTLLLVLLLIVALLLIILVLLQSGKGAGLGGSFGGGASSTLFGARGAENFLSRLTAVLA 60

Query: 55 FFFFATSIALGMISRY 70
            FF  S+ALG +S  
Sbjct: 61 VLFFVLSLALGYLSSK 76