BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780196|ref|YP_003064609.1| hypothetical protein CLIBASIA_00405 [Candidatus Liberibacter asiaticus str. psy62] (125 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780196|ref|YP_003064609.1| hypothetical protein CLIBASIA_00405 [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Score = 245 bits (626), Expect = 2e-67, Method: Compositional matrix adjust. Identities = 125/125 (100%), Positives = 125/125 (100%) Query: 1 MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60 MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT Sbjct: 1 MQIFLMVVHLIVVVGLVCVILIQSSDSSAFGSSSNFTSVRSTAHSLGRFTAILAFFFFAT 60 Query: 61 SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120 SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS Sbjct: 61 SIALGMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120 Query: 121 SSRTK 125 SSRTK Sbjct: 121 SSRTK 125 >gi|254780285|ref|YP_003064698.1| arginyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 586 Score = 23.5 bits (49), Expect = 1.2, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 25/53 (47%) Query: 65 GMISRYTSTRYKDNMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAG 117 G I+ Y S Y + S+V S + G + G G+ ++ VSA + + G Sbjct: 87 GFINLYLSPSYLRKILSSIVVSGIEYGRNLIGKGTKVNIEFVSANPTGPMHVG 139 >gi|254780289|ref|YP_003064702.1| RNA polymerase sigma factor RpoD [Candidatus Liberibacter asiaticus str. psy62] Length = 682 Score = 23.5 bits (49), Expect = 1.3, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 15/26 (57%) Query: 97 DGSSPKLDSVSAKSSSSVVAGKRSSS 122 +GS LD S+ S+SSV KR S Sbjct: 87 EGSEDSLDLASSASNSSVFLQKRKDS 112 >gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Score = 22.7 bits (47), Expect = 2.3, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 83 LVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVV 115 L+D I G+D GD S+ L+ + +SS V Sbjct: 438 LLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFV 470 >gi|254780536|ref|YP_003064949.1| acyl-carrier-protein S-malonyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 314 Score = 21.6 bits (44), Expect = 4.4, Method: Compositional matrix adjust. Identities = 9/18 (50%), Positives = 12/18 (66%) Query: 44 HSLGRFTAILAFFFFATS 61 HSLG +TA+ A F+ S Sbjct: 93 HSLGEYTALCAAKAFSLS 110 >gi|254780143|ref|YP_003064556.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 1386 Score = 21.2 bits (43), Expect = 5.8, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 5/43 (11%) Query: 78 NMHRSLVDSIKDQGNDNFGDGSSPKLDSVSAKSSSSVVAGKRS 120 NM R V +K + G G ++SV AKSS + + KR+ Sbjct: 695 NMQRQAVPLLKAEA-PFVGTG----MESVVAKSSGAAIVAKRA 732 >gi|254780284|ref|YP_003064697.1| hypothetical protein CLIBASIA_00845 [Candidatus Liberibacter asiaticus str. psy62] Length = 623 Score = 21.2 bits (43), Expect = 7.4, Method: Composition-based stats. Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 10/91 (10%) Query: 38 SVRSTAHSLGRFTAILAF------FFFATS---IALGMISRYTSTRYKDNMHRSLVDSIK 88 S+ HSL + A L+F + F ++ IA G IS D++HR + S Sbjct: 351 SLEKVNHSLEQDIATLSFEEGGKKYLFNSNTEGIARG-ISINRDCSLGDDVHRENMFSAP 409 Query: 89 DQGNDNFGDGSSPKLDSVSAKSSSSVVAGKR 119 + D F +GSS ++ + S V ++ Sbjct: 410 EISVDGFHEGSSLVSPALKSNSKRDVAQNRK 440 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.129 0.347 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,708 Number of Sequences: 1233 Number of extensions: 2344 Number of successful extensions: 16 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 12 length of query: 125 length of database: 328,796 effective HSP length: 64 effective length of query: 61 effective length of database: 249,884 effective search space: 15242924 effective search space used: 15242924 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 33 (17.3 bits)