BLAST/PSIBLAST alignment of GI: 254780199 and GI: 116253811 at iteration 1
>gi|116253811|ref|YP_769649.1| hypothetical protein RL4074 [Rhizobium leguminosarum bv. viciae 3841] Length = 122
>gi|115258459|emb|CAK09563.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae 3841] Length = 122
 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (57%), Gaps = 2/90 (2%)

Query: 38  PEPMDITGYWEDDNGILSYFQKDGKFKTISTDGSSSVLATGSYHVKINQDVEIKLTSLIR 97
           P    + G W D NGI+S FQ  G F T +TD S+ +LA+G+Y       VEI +TSL+R
Sbjct: 33  PAATGVEGNWSDPNGIVSTFQ-GGSFTTRTTD-SNQLLASGTYINTSPTLVEINMTSLVR 90

Query: 98  NTSGKIQCQFLDSNKLNCLAKDQKQFYLRR 127
            T  K+ C  ++ ++LNC +    QF L R
Sbjct: 91  KTQSKVNCALVNPSQLNCTSDSGAQFTLSR 120