>cd03416 CbiX_SirB_N Sirohydrochlorin cobalt chelatase (CbiX) and sirohydrochlorin iron chelatase (SirB), N-terminal domain. SirB catalyzes the ferro-chelation of sirohydrochlorin to siroheme, the prosthetic group of sulfite and nitrite reductases. CbiX is a cobaltochelatase, responsible for the chelation of Co2+ into sirohydrochlorin, an important step in the vitamin B12 biosynthetic pathway. CbiX often contains a C-terminal histidine-rich region that may be important for metal delivery and/or storage, and may also contain an iron-sulfur center. Both are found in a wide range of bacteria. This subgroup also contains single domain proteins from archaea and bacteria which may represent the ancestral form of class II chelatases before domain duplication occurred.

Probab=96.76 E-value=0.04 Score=35.46 Aligned_cols=57 Identities=16% Similarity=0.223 Sum_probs=23.5 Q ss_pred HHHHHHHHHHHHCCCCCEEEECCHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCC Q ss_conf 0268999989976998399974405422125588875899999997599758981689 Q gi|254780200|r 264 PPTDKTVEKLAHDGIKSLAIITPGFSSDCLETSYEIAHEAKEIFVNGGGEKFTQVPCL 321 (343) Q Consensus 264 P~t~~~l~~L~~~G~k~v~v~p~gFvsD~lETl~Eidie~~e~~~e~Gg~~~~rvp~l 321 (343) T Consensus 44 P~l~~~l~~l~~~G~~~ivvvP-~fL~~G~H~~~DIP~~l~~~~~~~p~~~~~~~~~l 100 (101) T cd03416 44 PSLAEALDELAAQGATRIVVVP-LFLLAGGHVKEDIPAALAAARARHPGVRIRYAPPL 100 (101) T ss_pred CCHHHHHHHHHHCCCCEEEEEE-EEECCCCCHHHHHHHHHHHHHHHCCCCEEEECCCC T ss_conf 9899999999966998599966-14135743076899999999988899589966999

HHsearch alignment for GI: 254780200 and conserved domain: cd03416