HHsearch alignment for GI: 254780201 and conserved domain: TIGR03030

>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.
Probab=94.23  E-value=0.45  Score=26.51  Aligned_cols=171  Identities=9%  Similarity=0.059  Sum_probs=90.9

Q ss_pred             HHCCCCEEEEEEECCHH--HHHHHHHHHHHCCCCEE---EEEECCCC-----------------HHHHHHHHHHCCCCCE
Q ss_conf             00014738999941677--89999999970899814---99971765-----------------2899999971178738
Q gi|254780201|r  145 LTIKSKIAIVVHCYYQD--TWIEISHILLRLNFDFD---LFVTVVEA-----------------NKDFEQDVLKYFPSAQ  202 (394)
Q Consensus       145 ~~~k~kIAVvlHlyY~D--Ll~E~~~~L~~ip~~~D---L~ITt~~~-----------------~~~~~~~~~~~~~~a~  202 (394)
T Consensus       127 ~~~~PtVDV~IPtYNEp~~vv~~Tl~aa~~ldYP~~kl~V~vLDDG~td~~~~~~~~~~~~~~~rR~e~~~la~~lGv~Y  206 (713)
T TIGR03030       127 PEEWPTVDVFIPTYNEDLEIVATTVLAAKNMDYPADKFRVWILDDGGTDQKRNDPDPEQAEAAQRREELKEFCRKLGVNY  206 (713)
T ss_pred             HHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCEE
T ss_conf             10189534896489999899999999998689998546699997989710023430123333441399999999809865


Q ss_pred             EEEECCCCHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCEEE
Q ss_conf             99945666047999986221002786789997368776777764440789999998747998999999999760997689
Q gi|254780201|r  203 LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGM  282 (394)
Q Consensus       203 V~vv~NRGRDI~PfL~~~~~~~l~~YD~v~klHtKKS~~~~~~~~~G~~Wr~~Ll~~LLGs~~~v~~Il~~F~~~p~lGl  282 (394)
T Consensus       207 itR~~n~hAKAGNLN~AL~--~t-~GelIaVfDAD~----------------------vP~~~FL~~tvg~F~~Dpklal  261 (713)
T TIGR03030       207 ITRPRNVHAKAGNINNALK--HT-DGELILIFDADH----------------------VPTRDFLQRTVGWFVEDPKLFL  261 (713)
T ss_pred             EECCCCCCCCCHHHHHHHH--HC-CCCEEEEECCCC----------------------CCCHHHHHHHHHHHHCCCCEEE
T ss_conf             5379878876167899987--36-987899967887----------------------8668999999898702997699


Q ss_pred             EECCCCCC-CCCCCCCC--CCCCCHHHHHHHHHHCCCCCCC-CCCCCCCEEEEEEEHHHHHHHH
Q ss_conf             81687654-43323455--4322138999999974899885-5477377012332098887576
Q gi|254780201|r  283 IGSRRYRR-YKRWSFFA--KRSEVYRRVIDLAKRAGFPTKR-LHLDFFNGTMFWVKPKCLEPLR  342 (394)
Q Consensus       283 v~p~~~~~-~~~~~~~~--~~~~~~~~~~~L~~rlgi~~~~-~~~~FpaGSMFW~R~~AL~pL~  342 (394)
T Consensus       262 VQTPq~F~N~Dp~~~NL~~~~~~p~e--~~~Fy~~iq~g~d~wnaaf~cGS~aV~RR~AL~eIG  323 (713)
T TIGR03030       262 VQTPHFFVSPDPIERNLGTFRRMPNE--NELFYGLIQDGNDFWNAAFFCGSAAVLRREALDEIG  323 (713)
T ss_pred             EECCEEEECCCHHHHCCHHHCCCCCH--HHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHCC
T ss_conf             94897568988787411120367504--778899985564668807982617987499999807