Query         gi|254780201|ref|YP_003064614.1| hypothetical protein CLIBASIA_00430 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 394
No_of_seqs    155 out of 190
Neff          5.5 
Searched_HMMs 13730
Date          Mon May 23 13:14:21 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780201.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1qg8a_ c.68.1.1 (A:) Spore co  76.8     2.1 0.00015   19.6  11.5  113  149-286     1-125 (255)
  2 d1eyra_ c.68.1.13 (A:) CMP acy  53.7     5.7 0.00041   17.0   3.3  154  161-342    30-190 (225)
  3 d1qwja_ c.68.1.13 (A:) CMP acy  48.7     7.2 0.00052   16.3   8.9  146  161-340    29-186 (228)
  4 d1vlra1 d.13.1.3 (A:146-337) m  31.9     9.6  0.0007   15.6   1.6   49   58-112     4-63  (192)
  5 d1wb9a4 d.75.2.1 (A:2-116) DNA  18.6      24  0.0017   13.2   1.8   61  325-386    30-95  (115)
  6 d1vkra_ c.44.2.1 (A:) PTS syst  17.8      25  0.0018   13.0   3.9   35  171-209    44-78  (97)
  7 d1s5qb_ a.59.1.1 (B:) Sin3A {M  14.6      15  0.0011   14.5  -0.3   58  111-169    12-85  (89)
  8 d1jaea2 c.1.8.1 (A:1-378) Anim  12.7      34  0.0025   12.2   1.4   12   89-100    88-99  (378)
  9 d1ewqa4 d.75.2.1 (A:1-120) DNA   8.1      50  0.0036   11.2   1.3   27  358-385    71-97  (120)
 10 d1omza_ c.68.1.15 (A:) Alpha-1   7.4      54  0.0039   11.0  13.2  162  150-345     4-169 (265)

No 1  
>d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]}
Probab=76.76  E-value=2.1  Score=19.65  Aligned_cols=113  Identities=12%  Similarity=0.278  Sum_probs=67.1

Q ss_pred             CCEEEEEEEC-CHHHHHHHHHHHHHCCCC-EEEEEECCCCHHHHHHHHHHCCCCCEEEEECCC---------CHHHHHHH
Q ss_conf             4738999941-677899999999708998-149997176528999999711787389994566---------60479999
Q gi|254780201|r  149 SKIAIVVHCY-YQDTWIEISHILLRLNFD-FDLFVTVVEANKDFEQDVLKYFPSAQLYVMENK---------GRDVRPFL  217 (394)
Q Consensus       149 ~kIAVvlHly-Y~DLl~E~~~~L~~ip~~-~DL~ITt~~~~~~~~~~~~~~~~~a~V~vv~NR---------GRDI~PfL  217 (394)
                      ++|.|++=.| ..+.+.++++.+.+-..+ +.++|--+-......+.+.+......|+++.|.         +.-.+.-+
T Consensus         1 P~vSiiip~yN~~~~l~~~l~Si~~Qt~~~~eiivvdd~S~d~t~~~l~~~~~~~~i~~~~~~~~~~~~~~~~~g~~~a~   80 (255)
T d1qg8a_           1 PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTRYAALI   80 (255)
T ss_dssp             CCEEEEEEESSCTTTHHHHHHHHHTCSCCCEEEEEEECSCCHHHHHHHGGGGGSTTEEEEECCCCSHHHHHSSCHHHHHH
T ss_pred             CEEEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHCCCC
T ss_conf             97999996279889999999999828899859999989897318999999643012221111234543223210000122


Q ss_pred             -HHHCCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             -862210027867899973687767777644407899999987479989999999997609976898168
Q gi|254780201|r  218 -YLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR  286 (394)
Q Consensus       218 -~~~~~~~l~~YD~v~klHtKKS~~~~~~~~~G~~Wr~~Ll~~LLGs~~~v~~Il~~F~~~p~lGlv~p~  286 (394)
                       .++   ...+.|+++.+++==.                     + .++.++.+++.|.++|.+++++..
T Consensus        81 N~gi---~~a~g~~i~~lD~Dd~---------------------~-~p~~l~~~~~~~~~~~~~~~v~~~  125 (255)
T d1qg8a_          81 NQAI---EMAEGEYITYATDDNI---------------------Y-MPDRLLKMVRELDTHPEKAVIYSA  125 (255)
T ss_dssp             HHHH---HHCCCSEEEEEETTEE---------------------E-CTTHHHHHHHHHHHCTTCCEEEEE
T ss_pred             CCCC---CCCCCCCCCCCCCCCC---------------------C-CCCHHHHHHHHHHHCCCCCEEEEC
T ss_conf             2222---3456663433366532---------------------0-025588999999849877768631


No 2  
>d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]}
Probab=53.72  E-value=5.7  Score=16.97  Aligned_cols=154  Identities=10%  Similarity=-0.011  Sum_probs=72.4

Q ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCEEEE-ECCCCHHHH---HHHHHHCCCCCCCCCEEEEECC
Q ss_conf             789999999970899814999717652899999971178738999-456660479---9998622100278678999736
Q gi|254780201|r  161 DTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYV-MENKGRDVR---PFLYLLELGVFDRYDYLCKIHG  236 (394)
Q Consensus       161 DLl~E~~~~L~~ip~~~DL~ITt~~~~~~~~~~~~~~~~~a~V~v-v~NRGRDI~---PfL~~~~~~~l~~YD~v~klHt  236 (394)
                      -|++-.++.+.+...--+++|+|+++...   .+.+.+....+.. -..-+.+..   -+...+. ....++|+||.++.
T Consensus        30 pLi~~~i~~~~~s~~~~~Iiv~td~~~i~---~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~d~ii~~~~  105 (225)
T d1eyra_          30 SLLGHTINAAISSKCFDRIIVSTDGGLIA---EEAKNFGVEVVLRPAELASDTASSISGVIHALE-TIGSNSGTVTLLQP  105 (225)
T ss_dssp             EHHHHHHHHHHHHTCCSEEEEEESCHHHH---HHHHHTTCEEEECCHHHHSTTCCHHHHHHHHHH-HHTCCSEEEEECCT
T ss_pred             EHHHHHHHHHHHCCCCCEEEEEECCCHHH---HHHHHHCCEEEEECCCCCCCCCCCHHHCCCCCC-CCCCCCCEEEEEEC
T ss_conf             88999999999759976377750222024---566540430464111344321100000021111-12455655999502


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCE-EE-EECCCCCCCCCCCCCCCCCCCHHHHHHHHHHC
Q ss_conf             87767777644407899999987479989999999997609976-89-81687654433234554322138999999974
Q gi|254780201|r  237 KKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCL-GM-IGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRA  314 (394)
Q Consensus       237 KKS~~~~~~~~~G~~Wr~~Ll~~LLGs~~~v~~Il~~F~~~p~l-Gl-v~p~~~~~~~~~~~~~~~~~~~~~~~~L~~rl  314 (394)
                      = +|                    +-+++.+.+.+..|..+..- .+ +.+.. ..+..+... ...+........- ..
T Consensus       106 ~-~P--------------------~~~~~~I~~~i~~~~~~~~d~~~~~~~~~-~~~~~~~~~-~~~~~~~~~~~~~-~~  161 (225)
T d1eyra_         106 T-SP--------------------LRTGAHIREAFSLFDEKIKGSVVSACPME-HHPLKTLLQ-INNGEYAPMRHLS-DL  161 (225)
T ss_dssp             T-CT--------------------TCCHHHHHHHHTTCCTTTCCCEEEEEECS-SCTTSCEEE-CSSSCEEESSCGG-GG
T ss_pred             C-CC--------------------CCCCCCCCCCCEEECCCCCCCCCEEECCC-CCCCCCCCC-CCCCCCCCCCCCC-CC
T ss_conf             3-34--------------------22442221100000144654330010001-113221000-0023432011234-32


Q ss_pred             CCCCCCC-CCCCCCEEEEEEEHHHHHHHH
Q ss_conf             8998855-477377012332098887576
Q gi|254780201|r  315 GFPTKRL-HLDFFNGTMFWVKPKCLEPLR  342 (394)
Q Consensus       315 gi~~~~~-~~~FpaGSMFW~R~~AL~pL~  342 (394)
                      ....... ..-+..|++++++.+.|..--
T Consensus       162 ~~~~~~~~~~y~~~g~iy~~~~~~l~~~~  190 (225)
T d1eyra_         162 EQPRQQLPQAFRPNGAIYINDTASLIANN  190 (225)
T ss_dssp             TSCGGGSCCEEEEEEEEEEEEHHHHHHHT
T ss_pred             CCCCCCCCCEEEECCEEEEEEHHHHHHCC
T ss_conf             22224576222101115785499998709


No 3  
>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]}
Probab=48.74  E-value=7.2  Score=16.35  Aligned_cols=146  Identities=16%  Similarity=0.153  Sum_probs=70.8

Q ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCEEEE--ECCCCH---HHHHHHHHHCCCCCCCCCEEEEEC
Q ss_conf             789999999970899814999717652899999971178738999--456660---479999862210027867899973
Q gi|254780201|r  161 DTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYV--MENKGR---DVRPFLYLLELGVFDRYDYLCKIH  235 (394)
Q Consensus       161 DLl~E~~~~L~~ip~~~DL~ITt~~~~~~~~~~~~~~~~~a~V~v--v~NRGR---DI~PfL~~~~~~~l~~YD~v~klH  235 (394)
                      =|++-.++.+.+...--+++|+|+++...  . +...+. +.+..  -.+-|-   .+.-+...++  ....+|+++-++
T Consensus        29 pLi~~~i~~~~ks~~id~Iivstd~~~i~--~-~~~~~~-~~~~~~~~~~~~~~~~~~~~i~~~~~--~~~~~~~iv~~~  102 (228)
T d1qwja_          29 PLIGWVLRAALDAGVFQSVWVSTDHDEIE--N-VAKQFG-AQVHRRSSETSKDSSTSLDAIVEFLN--YHNEVDIVGNIQ  102 (228)
T ss_dssp             EHHHHHHHHHHHHTCCSEEEEEESCHHHH--H-HHHHTT-CEEEECCGGGSSTTCCHHHHHHHHHT--TCTTCSEEEEEC
T ss_pred             EHHHHHHHHHHHCCCCCEEEEECCHHHHH--H-HHHHCC-CCCCCCCCCCCCCCCHHHHHHHHCCC--CCCCCCEEEEEC
T ss_conf             68999999999669966589722203344--4-665358-64322323224564033433101133--342211145420


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHC-
Q ss_conf             6877677776444078999999874799899999999976099768981687654433234554322138999999974-
Q gi|254780201|r  236 GKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRA-  314 (394)
Q Consensus       236 tKKS~~~~~~~~~G~~Wr~~Ll~~LLGs~~~v~~Il~~F~~~p~lGlv~p~~~~~~~~~~~~~~~~~~~~~~~~L~~rl-  314 (394)
                      . -||                    +-+.+.++..++.|.++..-.++...... ..++......  ..    .+.... 
T Consensus       103 ~-~~P--------------------~~~~~~I~~~i~~~~~~~~d~~~~~~~~~-~~~~~~~~~~--~~----~~~~~~~  154 (228)
T d1qwja_         103 A-TSP--------------------CLHPTDLQKVAEMIREEGYDSVFSVVRRH-QFRWSEIQKG--VR----EVTEPLN  154 (228)
T ss_dssp             T-TCT--------------------TCCHHHHHHHHHHHHSSCCSEEEEEEEEC-CCEECCCCSS--TT----CCCCBSS
T ss_pred             C-CCC--------------------CCCCHHHHHHHHHHHCCCCCCCCCCCCCC-CCCCHHHHHH--CC----CCCCCHH
T ss_conf             1-334--------------------46711212356664036866343322222-3330022221--03----4555102


Q ss_pred             ----CCCCC-C-CCCCCCCEEEEEEEHHHHHH
Q ss_conf             ----89988-5-54773770123320988875
Q gi|254780201|r  315 ----GFPTK-R-LHLDFFNGTMFWVKPKCLEP  340 (394)
Q Consensus       315 ----gi~~~-~-~~~~FpaGSMFW~R~~AL~p  340 (394)
                          ..... + ...-+..|+++|++.+.++.
T Consensus       155 ~~~~~~~~~qd~~~~y~~ng~~~~~k~~~~~~  186 (228)
T d1qwja_         155 LNPAKRPRRQDWDGELYENGSFYFAKRHLIEM  186 (228)
T ss_dssp             SBTTBCCCTTTSCCEEEEEEEEEEEEHHHHHT
T ss_pred             HHHHHCCCCCCCCCEEEEEEEEEEEEHHHHHH
T ss_conf             33331133235652166556999980999964


No 4  
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
Probab=31.87  E-value=9.6  Score=15.57  Aligned_cols=49  Identities=12%  Similarity=0.108  Sum_probs=33.7

Q ss_pred             EECCCHHHHHHHH-----------HHHHHHHHHHHHHCCCCCCCEEEEEEEECCCCCCCCHHHHHH
Q ss_conf             7568978999999-----------999999999751001585643999973137741007326871
Q gi|254780201|r   58 VHFQELSIFESFI-----------FWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMS  112 (394)
Q Consensus        58 ~~~~tP~~f~~~~-----------~wl~~~l~~~~~~~~~~~~~~ivfinaWNEEG~yLePD~~~G  112 (394)
                      ++..||+.|++..           +|..+.+      ....+.+|++|=..=-++|..|-||.+|.
T Consensus         4 ~v~ETpe~Y~~~~~Pyi~~~~~~~~Wv~nIL------~~~~E~e~i~y~D~d~~~gFvllpD~kWd   63 (192)
T d1vlra1           4 LIRETGDDYRTITLPYLESQSLSIQWVYNIL------DKKAEADRIVFENPDPSDGFVLIPDLKWN   63 (192)
T ss_dssp             EEEECHHHHHHTHHHHHHHHCCCCHHHHHHH------TC----CCCSEEECCTTTCEEEEECTTCC
T ss_pred             EEECCHHHHHHHHHHHHHCCCCCHHHHHHHH------HCCCCCCEEEEECCCCCCCEEEECCCCCC
T ss_conf             9961999999863367754675337899987------27776541698479988777993566668


No 5  
>d1wb9a4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
Probab=18.64  E-value=24  Score=13.17  Aligned_cols=61  Identities=21%  Similarity=0.233  Sum_probs=34.6

Q ss_pred             CCCEEEE---EEEHHHHHHHHCCCCC-CC-CCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEHHH
Q ss_conf             3770123---3209888757658822-35-8544688887389999999999999869803352475
Q gi|254780201|r  325 FFNGTMF---WVKPKCLEPLRNLHLI-GE-FEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCV  386 (394)
Q Consensus       325 FpaGSMF---W~R~~AL~pL~~l~l~-~D-F~~E~g~~DGTlaHAIERl~~~iv~~~gf~i~~v~~~  386 (394)
                      |-.|++|   .--...+.+++++.+. .. ....+-+.-|--.|++++-+.-.++ +||+|+-+|=+
T Consensus        30 ~rvG~FYE~y~~DA~~~~~~L~i~lt~~~~~~~~~v~m~GfP~~~l~~yl~~Lv~-~G~kVai~eQ~   95 (115)
T d1wb9a4          30 YRMGDFYTLFYDDAKRASQLLDISLTKRGASAGEPIPMAGIPYHAVENYLAKLVN-QGESVAICEQI   95 (115)
T ss_dssp             EEETTEEEEEHHHHHHHHHHHTCCCEEECCSSSCCEEEEEEEGGGHHHHHHHHHH-TTCCEEEEEEC
T ss_pred             EEECCCHHHHHHHHHHHHHHHEEEEECCCCCCCCCEEEEECCHHHHHHHHHHHHH-CCCEEEEEEEC
T ss_conf             9968651224666999876320588425778898637971678887899999997-89669999742


No 6  
>d1vkra_ c.44.2.1 (A:) PTS system mannitol-specific EIICBA component {Escherichia coli [TaxId: 562]}
Probab=17.76  E-value=25  Score=13.05  Aligned_cols=35  Identities=29%  Similarity=0.347  Sum_probs=21.2

Q ss_pred             HHCCCCEEEEEECCCCHHHHHHHHHHCCCCCEEEEECCC
Q ss_conf             708998149997176528999999711787389994566
Q gi|254780201|r  171 LRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENK  209 (394)
Q Consensus       171 ~~ip~~~DL~ITt~~~~~~~~~~~~~~~~~a~V~vv~NR  209 (394)
                      ..++...|++||+.    +....+....+.+.|..+.|-
T Consensus        44 ~~~~~d~DlIvt~~----~l~~~~~~~~~~~~vi~v~n~   78 (97)
T d1vkra_          44 NNLPPDVDLVITHR----DLTERAMRQVPQAQHISLTNF   78 (97)
T ss_dssp             TCCCTTCSEEEEEH----HHHHHHHHHCTTSEEEEESCT
T ss_pred             HHCCCCCCEEEECH----HHHHHHHHHCCCCEEEEEEEC
T ss_conf             33889998999868----999999843899849999846


No 7  
>d1s5qb_ a.59.1.1 (B:) Sin3A {Mouse (Mus musculus) [TaxId: 10090]}
Probab=14.58  E-value=15  Score=14.47  Aligned_cols=58  Identities=9%  Similarity=0.150  Sum_probs=25.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCC----------------CCCCCCCHHHHHHCCCCEEEEEEECCHHHHHHHHHH
Q ss_conf             71875599999973026642024----------------678221011000001473899994167789999999
Q gi|254780201|r  111 MSNSRMPFDSEKFLYVKELFEGW----------------NDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHI  169 (394)
Q Consensus       111 ~G~~yL~a~~~al~~~~~~~~~~----------------~~~p~~~~~~~~~~k~kIAVvlHlyY~DLl~E~~~~  169 (394)
                      ..-+||+.++++|...|.+++.=                ....+........+-.+|+..++- |+||+.+|-..
T Consensus        12 ~A~~yl~kVK~~f~d~p~~Y~~FL~il~~f~~~~~~~~~~~~~~~~~~~~~~v~~rV~~Lf~~-hpdLi~~Fn~F   85 (89)
T d1s5qb_          12 HAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKN-QEDLLSEFGQF   85 (89)
T ss_dssp             HHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHHHHHHHSCSCCCCSCCHHHHHHHHHHHSCS-CHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHCC-CHHHHHHHHHH
T ss_conf             999999999999815859999999999999973001110012122346699999999999854-87999989966


No 8  
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]}
Probab=12.65  E-value=34  Score=12.22  Aligned_cols=12  Identities=17%  Similarity=0.274  Sum_probs=5.7

Q ss_pred             CCEEEEEEEECC
Q ss_conf             643999973137
Q gi|254780201|r   89 SCRIFFYGSRKE  100 (394)
Q Consensus        89 ~~~ivfinaWNE  100 (394)
                      +-+||..---|-
T Consensus        88 GI~VilDvV~NH   99 (378)
T d1jaea2          88 GVRIYVDAVINH   99 (378)
T ss_dssp             TCEEEEEECCSB
T ss_pred             CCEEEEEECCCC
T ss_conf             724456403442


No 9  
>d1ewqa4 d.75.2.1 (A:1-120) DNA repair protein MutS, domain I {Thermus aquaticus [TaxId: 271]}
Probab=8.12  E-value=50  Score=11.21  Aligned_cols=27  Identities=19%  Similarity=0.238  Sum_probs=13.5

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCEEEEEHH
Q ss_conf             8738999999999999986980335247
Q gi|254780201|r  358 DGALEHAVERFFACSVRYTEFSIESVDC  385 (394)
Q Consensus       358 DGTlaHAIERl~~~iv~~~gf~i~~v~~  385 (394)
                      -|--.|++++-+.-+++ +||+|.-+|=
T Consensus        71 aGfP~~~l~~yl~~L~~-~GytV~v~eQ   97 (120)
T d1ewqa4          71 AGIPLRAFEAYAERLLK-MGFRLAVADQ   97 (120)
T ss_dssp             EEEEGGGHHHHHHHHHH-TTCCEEEEEE
T ss_pred             CCCCHHHHHHHHHHHHH-CCCEEEEEEE
T ss_conf             26877578999999998-7945999987


No 10 
>d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]}
Probab=7.35  E-value=54  Score=10.99  Aligned_cols=162  Identities=9%  Similarity=0.005  Sum_probs=0.0

Q ss_pred             CEEEEEEEC-CHHHHHHHHHHHHHCCCCEEEEEECC---CCHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHCCCCC
Q ss_conf             738999941-67789999999970899814999717---65289999997117873899945666047999986221002
Q gi|254780201|r  150 KIAIVVHCY-YQDTWIEISHILLRLNFDFDLFVTVV---EANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVF  225 (394)
Q Consensus       150 kIAVvlHly-Y~DLl~E~~~~L~~ip~~~DL~ITt~---~~~~~~~~~~~~~~~~a~V~vv~NRGRDI~PfL~~~~~~~l  225 (394)
                      |+.|++=.| -++.+.++++.|.+.+.+-.++|=..   ++..+.........+...++.-+|.|---    ..-.....
T Consensus         4 ~~tvii~tyn~~~~l~~~l~sl~~q~~~~~~iiV~d~~sd~~~~~i~~~~~~~~~~~~~~~~~~g~~~----a~n~~~~~   79 (265)
T d1omza_           4 SFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMR----NRLQVFPE   79 (265)
T ss_dssp             CEEEEEEESSCHHHHHHHHHHHTTSTTEEEEEEEECCTTCCCTHHHHHHTCCCSSCEEEEECSSCCGG----GGGSCCTT
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEEECCCCCCHH----HHHHHHHH
T ss_conf             68999972799899999999997389959699998989996099999875356538987237888234----54254886


Q ss_pred             CCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCHH
Q ss_conf             78678999736877677776444078999999874799899999999976099768981687654433234554322138
Q gi|254780201|r  226 DRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYR  305 (394)
Q Consensus       226 ~~YD~v~klHtKKS~~~~~~~~~G~~Wr~~Ll~~LLGs~~~v~~Il~~F~~~p~lGlv~p~~~~~~~~~~~~~~~~~~~~  305 (394)
                      .+-|+|+.+.+==-+                      .++.++.++..++++|..+..+.................    
T Consensus        80 a~ge~i~~lD~D~~~----------------------~~~~l~~l~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~----  133 (265)
T d1omza_          80 VETNAVLMVDDDTLI----------------------SAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGG----  133 (265)
T ss_dssp             CCSSEEEEECTTEEE----------------------CHHHHHHHHHHHTTSTTSEEESCEEEEEEEETTEEEEEC----
T ss_pred             CCCCEEEEECCCCCC----------------------CHHHHHHHHHHHHHCCCCCEECCCCCCCCCCCCCCCCCC----
T ss_conf             896789996765577----------------------879999999999858874221133200126776421244----


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCEEEEEEEHHHHHHHHCCC
Q ss_conf             9999999748998855477377012332098887576588
Q gi|254780201|r  306 RVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLH  345 (394)
Q Consensus       306 ~~~~L~~rlgi~~~~~~~~FpaGSMFW~R~~AL~pL~~l~  345 (394)
                          ...............+..|++..+|..++.......
T Consensus       134 ----~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~  169 (265)
T d1omza_         134 ----FELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQP  169 (265)
T ss_dssp             ----TTSCCCSSSSSCCBSEECTTEEEEETHHHHHHHTSC
T ss_pred             ----CCCCCCCCCCCCCCCEECCCEEEECHHHHHHHHHHH
T ss_conf             ----322455434455320002431685178999986627


Done!