BLAST/PSIBLAST alignment of GI: 254780201 and GI: 166713474 at iteration 1
>gi|166713474|ref|ZP_02244681.1| hypothetical protein Xoryp_19045 [Xanthomonas oryzae pv. oryzicola BLS256] Length = 568
 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 120/240 (50%), Gaps = 19/240 (7%)

Query: 146 TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPS----A 201
           ++ S+ AIV+H ++ D    I   +  +  D+D+FV+V   +    +  ++YF      A
Sbjct: 314 SLSSRFAIVLHLFHIDLIDAICAYMRNVIVDYDVFVSVKSISD--RRMAVRYFQEHKIRA 371

Query: 202 QLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLL 261
            +++  N GRDV PF+ LL  G+ DRYD +CKIH KKS    YH   G  WR  L   LL
Sbjct: 372 SVFIHPNIGRDVGPFISLLNTGLLDRYDAVCKIHSKKSV---YHD-GGGQWRDDLMKALL 427

Query: 262 GFSDIAIRIINTFEQNPCLGMIG--SRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTK 319
           G S   +R++  F+ +P  G++G  S      + W    +R  V      LA   G   K
Sbjct: 428 GSSFDVLRVLRAFDDHPACGIVGPESAYLSNARFWGGNEERLRV------LAAETGIEEK 481

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEF 378
           R+ L FF GTMFW +P  L  LR   + + EF+ E   +D  L H +ER F   V    F
Sbjct: 482 RIRLGFFAGTMFWFRPAALSALRARSIGLSEFDPEAGQRDATLAHVIERLFVLWVEQAGF 541